contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
975
|
B
|
Mancala
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
Mancala is a game famous in the Middle East. It is played on a board that consists of 14 holes.
Initially, each hole has $a_i$ stones. When a player makes a move, he chooses a hole which contains a positive number of stones. He takes all the stones inside it and then redistributes these stones one by one in the next holes in a counter-clockwise direction.
Note that the counter-clockwise order means if the player takes the stones from hole $i$, he will put one stone in the $(i+1)$-th hole, then in the $(i+2)$-th, etc. If he puts a stone in the $14$-th hole, the next one will be put in the first hole.
After the move, the player collects all the stones from holes that contain even number of stones. The number of stones collected by player is the score, according to Resli.
Resli is a famous Mancala player. He wants to know the maximum score he can obtain after one move.
|
The only line contains 14 integers $a_1, a_2, \ldots, a_{14}$ ($0 \leq a_i \leq 10^9$) — the number of stones in each hole.
It is guaranteed that for any $i$ ($1\leq i \leq 14$) $a_i$ is either zero or odd, and there is at least one stone in the board.
|
Output one integer, the maximum possible score after one move.
|
[
"0 1 1 0 0 0 0 0 0 7 0 0 0 0\n",
"5 1 1 1 1 0 0 0 0 0 0 0 0 0\n"
] |
[
"4\n",
"8\n"
] |
In the first test case the board after the move from the hole with $7$ stones will look like 1 2 2 0 0 0 0 0 0 0 1 1 1 1. Then the player collects the even numbers and ends up with a score equal to $4$.
| 1,000
|
[
{
"input": "0 1 1 0 0 0 0 0 0 7 0 0 0 0",
"output": "4"
},
{
"input": "5 1 1 1 1 0 0 0 0 0 0 0 0 0",
"output": "8"
},
{
"input": "10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 1",
"output": "54294"
},
{
"input": "0 0 0 0 0 0 0 0 0 0 0 0 0 15",
"output": "2"
},
{
"input": "1 0 0 0 0 1 0 0 0 0 1 0 0 0",
"output": "0"
},
{
"input": "5 5 1 1 1 3 3 3 5 7 5 3 7 5",
"output": "38"
},
{
"input": "787 393 649 463 803 365 81 961 989 531 303 407 579 915",
"output": "7588"
},
{
"input": "8789651 4466447 1218733 6728667 1796977 6198853 8263135 6309291 8242907 7136751 3071237 5397369 6780785 9420869",
"output": "81063456"
},
{
"input": "0 0 0 0 0 0 0 0 0 0 0 0 0 29",
"output": "26"
},
{
"input": "282019717 109496191 150951267 609856495 953855615 569750143 6317733 255875779 645191029 572053369 290936613 338480779 879775193 177172893",
"output": "5841732816"
},
{
"input": "105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505",
"output": "120472578"
},
{
"input": "404418821 993626161 346204297 122439813 461187221 628048227 625919459 628611733 938993057 701270099 398043779 684205961 630975553 575964835",
"output": "8139909016"
},
{
"input": "170651077 730658441 824213789 583764177 129437345 717005779 675398017 314979709 380861369 265878463 746564659 797260041 506575735 335169317",
"output": "6770880638"
},
{
"input": "622585025 48249287 678950449 891575125 637411965 457739735 829353393 235216425 284006447 875591469 492839209 296444305 513776057 810057753",
"output": "7673796644"
},
{
"input": "475989857 930834747 786217439 927967137 489188151 869354161 276693267 56154399 131055697 509249443 143116853 426254423 44465165 105798821",
"output": "6172339560"
},
{
"input": "360122921 409370351 226220005 604004145 85173909 600403773 624052991 138163383 729239967 189036661 619842883 270087537 749500483 243727913",
"output": "5848946922"
},
{
"input": "997102881 755715147 273805839 436713689 547411799 72470207 522269145 647688957 137422311 422612659 197751751 679663349 821420227 387967237",
"output": "6900015198"
},
{
"input": "690518849 754551537 652949719 760695679 491633619 477564457 11669279 700467439 470069297 782338983 718169393 884421719 24619427 215745577",
"output": "7635414974"
},
{
"input": "248332749 486342237 662201929 917696895 555278549 252122023 850296207 463343655 832574345 954281071 168282553 825538865 996753493 461254663",
"output": "6400166934"
},
{
"input": "590789361 636464947 404477303 337309187 476703809 426863069 120608741 703406277 645444697 761482231 996635839 33459441 677458865 483861751",
"output": "7294965518"
},
{
"input": "297857621 238127103 749085829 139033277 597985489 202617713 982184715 183932743 278551059 297781685 330124279 338959601 682874531 187519685",
"output": "5201808164"
},
{
"input": "1 1 1 1 1 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "1 1 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "1 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "2"
},
{
"input": "0 0 0 0 0 0 0 0 0 0 0 0 1 1",
"output": "2"
}
] | 1,655,049,431
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 1,843,200
|
arr = list(map(int, input().split()))
maxx = 0
idx = -1
n = len(arr)
for i in range(len(arr)):
if arr[i]>maxx:
maxx = arr[i]
idx = i
for i in range(idx+1, idx+maxx+1):
arr[i%n] += 1
ans = 0
for i in range(n):
if arr[i]%2==0:
ans+=arr[i]
print(ans)
|
Title: Mancala
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mancala is a game famous in the Middle East. It is played on a board that consists of 14 holes.
Initially, each hole has $a_i$ stones. When a player makes a move, he chooses a hole which contains a positive number of stones. He takes all the stones inside it and then redistributes these stones one by one in the next holes in a counter-clockwise direction.
Note that the counter-clockwise order means if the player takes the stones from hole $i$, he will put one stone in the $(i+1)$-th hole, then in the $(i+2)$-th, etc. If he puts a stone in the $14$-th hole, the next one will be put in the first hole.
After the move, the player collects all the stones from holes that contain even number of stones. The number of stones collected by player is the score, according to Resli.
Resli is a famous Mancala player. He wants to know the maximum score he can obtain after one move.
Input Specification:
The only line contains 14 integers $a_1, a_2, \ldots, a_{14}$ ($0 \leq a_i \leq 10^9$) — the number of stones in each hole.
It is guaranteed that for any $i$ ($1\leq i \leq 14$) $a_i$ is either zero or odd, and there is at least one stone in the board.
Output Specification:
Output one integer, the maximum possible score after one move.
Demo Input:
['0 1 1 0 0 0 0 0 0 7 0 0 0 0\n', '5 1 1 1 1 0 0 0 0 0 0 0 0 0\n']
Demo Output:
['4\n', '8\n']
Note:
In the first test case the board after the move from the hole with $7$ stones will look like 1 2 2 0 0 0 0 0 0 0 1 1 1 1. Then the player collects the even numbers and ends up with a score equal to $4$.
|
```python
arr = list(map(int, input().split()))
maxx = 0
idx = -1
n = len(arr)
for i in range(len(arr)):
if arr[i]>maxx:
maxx = arr[i]
idx = i
for i in range(idx+1, idx+maxx+1):
arr[i%n] += 1
ans = 0
for i in range(n):
if arr[i]%2==0:
ans+=arr[i]
print(ans)
```
| 0
|
|
26
|
A
|
Almost Prime
|
PROGRAMMING
| 900
|
[
"number theory"
] |
A. Almost Prime
|
2
|
256
|
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
|
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
|
Output the amount of almost prime numbers between 1 and *n*, inclusive.
|
[
"10\n",
"21\n"
] |
[
"2\n",
"8\n"
] |
none
| 500
|
[
{
"input": "10",
"output": "2"
},
{
"input": "21",
"output": "8"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "19",
"output": "6"
},
{
"input": "40",
"output": "19"
},
{
"input": "77",
"output": "41"
},
{
"input": "222",
"output": "125"
},
{
"input": "987",
"output": "501"
},
{
"input": "1000",
"output": "508"
},
{
"input": "2000",
"output": "958"
},
{
"input": "3000",
"output": "1375"
},
{
"input": "2999",
"output": "1375"
},
{
"input": "2998",
"output": "1375"
},
{
"input": "2997",
"output": "1374"
},
{
"input": "1429",
"output": "706"
},
{
"input": "1673",
"output": "808"
},
{
"input": "1500",
"output": "732"
},
{
"input": "500",
"output": "266"
},
{
"input": "856",
"output": "439"
}
] | 1,608,442,097
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 23
| 1,526
| 0
|
#code
def isprime(x):
if x==1:
return False
for i in range(2,x):
if x%i==0:
return False
return True
##print(isprime(10))
n=int(input())
c=0
for i in range(1,n+1):
count=0
for j in range(1,i):
if i%j==0:
if isprime(j):
count+=1
if count==2:
c+=1
print(c)
|
Title: Almost Prime
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input Specification:
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output Specification:
Output the amount of almost prime numbers between 1 and *n*, inclusive.
Demo Input:
['10\n', '21\n']
Demo Output:
['2\n', '8\n']
Note:
none
|
```python
#code
def isprime(x):
if x==1:
return False
for i in range(2,x):
if x%i==0:
return False
return True
##print(isprime(10))
n=int(input())
c=0
for i in range(1,n+1):
count=0
for j in range(1,i):
if i%j==0:
if isprime(j):
count+=1
if count==2:
c+=1
print(c)
```
| 3.6185
|
814
|
B
|
An express train to reveries
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms"
] | null | null |
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
|
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
|
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
|
[
"5\n1 2 3 4 3\n1 2 5 4 5\n",
"5\n4 4 2 3 1\n5 4 5 3 1\n",
"4\n1 1 3 4\n1 4 3 4\n"
] |
[
"1 2 5 4 3\n",
"5 4 2 3 1\n",
"1 2 3 4\n"
] |
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints.
| 1,000
|
[
{
"input": "5\n1 2 3 4 3\n1 2 5 4 5",
"output": "1 2 5 4 3"
},
{
"input": "5\n4 4 2 3 1\n5 4 5 3 1",
"output": "5 4 2 3 1"
},
{
"input": "4\n1 1 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "10\n1 2 3 4 7 6 7 8 9 10\n1 2 3 4 5 6 5 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 7 10\n1 2 3 4 5 6 7 8 9 9",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 4 10\n1 2 3 4 5 6 7 6 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n8 6 1 7 9 3 5 2 10 9\n8 6 1 7 4 3 5 2 10 4",
"output": "8 6 1 7 4 3 5 2 10 9"
},
{
"input": "10\n2 9 7 7 8 5 4 10 6 1\n2 8 7 3 8 5 4 10 6 1",
"output": "2 9 7 3 8 5 4 10 6 1"
},
{
"input": "2\n2 2\n1 1",
"output": "1 2"
},
{
"input": "3\n1 2 2\n1 3 3",
"output": "1 3 2"
},
{
"input": "3\n2 2 3\n1 2 1",
"output": "1 2 3"
},
{
"input": "3\n1 3 3\n1 1 3",
"output": "1 2 3"
},
{
"input": "3\n2 1 1\n2 3 3",
"output": "2 3 1"
},
{
"input": "3\n3 3 2\n1 1 2",
"output": "1 3 2"
},
{
"input": "3\n1 3 3\n3 3 2",
"output": "1 3 2"
},
{
"input": "4\n3 2 3 4\n1 2 1 4",
"output": "1 2 3 4"
},
{
"input": "4\n2 2 3 4\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 4 4\n2 2 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n4 1 3 4\n2 1 3 2",
"output": "2 1 3 4"
},
{
"input": "4\n3 2 1 3\n4 2 1 2",
"output": "4 2 1 3"
},
{
"input": "4\n1 4 1 3\n2 4 1 4",
"output": "2 4 1 3"
},
{
"input": "4\n1 3 4 4\n3 3 2 4",
"output": "1 3 2 4"
},
{
"input": "5\n5 4 5 3 1\n4 4 2 3 1",
"output": "5 4 2 3 1"
},
{
"input": "5\n4 1 2 4 5\n3 1 2 5 5",
"output": "3 1 2 4 5"
},
{
"input": "3\n2 2 3\n1 3 3",
"output": "1 2 3"
},
{
"input": "3\n1 1 3\n2 3 3",
"output": "2 1 3"
},
{
"input": "5\n5 4 5 3 1\n2 4 4 3 1",
"output": "2 4 5 3 1"
},
{
"input": "3\n3 3 1\n2 1 1",
"output": "2 3 1"
},
{
"input": "5\n5 4 3 5 2\n5 4 1 1 2",
"output": "5 4 3 1 2"
},
{
"input": "6\n1 2 3 4 2 5\n1 6 3 4 4 5",
"output": "1 6 3 4 2 5"
},
{
"input": "4\n1 3 2 1\n2 3 2 1",
"output": "4 3 2 1"
},
{
"input": "4\n1 3 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 10 10\n1 2 3 4 5 6 7 8 9 10 3",
"output": "1 2 3 4 5 6 7 8 9 10 11"
},
{
"input": "5\n1 2 3 2 5\n1 4 3 3 5",
"output": "1 4 3 2 5"
},
{
"input": "5\n1 2 3 4 3\n1 2 5 4 2",
"output": "1 2 5 4 3"
},
{
"input": "5\n1 2 3 4 4\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n1 3 1 4\n1 3 4 4",
"output": "1 3 2 4"
},
{
"input": "5\n2 5 3 2 1\n4 5 3 3 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 2 5\n1 3 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 2 3 4 5\n2 2 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 4 1 1 2\n5 4 3 5 2",
"output": "5 4 3 1 2"
},
{
"input": "4\n1 4 3 4\n1 3 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 3 1\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "5\n4 5 3 3 1\n2 5 3 2 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 5 5\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n2 3 3 4\n2 4 3 4",
"output": "2 1 3 4"
}
] | 1,496,847,562
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 62
| 307,200
|
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
contain = [1 for i in range(n)]
fail = []
res = []
for i, j in zip(a, b):
if i == j:
contain[i - 1] = 0
res.append(i)
else:
fail.append((i, j))
res.append(0)
falta = []
for i in range(n):
if contain[i] == 1:
falta.append(i + 1)
#print(falta)
#print(fail)
#print(res)
if len(falta) == 1:
for i in range(len(res)):
if res[i] == 0:
res[i] = falta[0]
elif len(falta) == 2:
if fail[0][0] == falta[0] and fail[1][1] == falta[1]:
for i in falta:
for j in range(len(res)):
if res[j] == 0:
res[j] = i
break
elif fail[0][0] == falta[1] and fail[1][1] == falta[0]:
i = 1
while i >= 0:
for j in range(len(res)):
if res[j] == 0:
res[j] = falta[i]
i -= 1
break
elif fail[0][1] == falta[0] and fail[1][0] == falta[1]:
for i in falta:
for j in range(len(res)):
if res[j] == 0:
res[j] = i
break
elif fail[0][1] == falta[1] and fail[1][0] == falta[0]:
i = 1
while i >= 0:
for j in range(len(res)):
if res[j] == 0:
res[j] = falta[i]
i -= 1
break
res = list(map(str, res))
print(' '.join(res))
|
Title: An express train to reveries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
Input Specification:
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Output Specification:
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
Demo Input:
['5\n1 2 3 4 3\n1 2 5 4 5\n', '5\n4 4 2 3 1\n5 4 5 3 1\n', '4\n1 1 3 4\n1 4 3 4\n']
Demo Output:
['1 2 5 4 3\n', '5 4 2 3 1\n', '1 2 3 4\n']
Note:
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints.
|
```python
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
contain = [1 for i in range(n)]
fail = []
res = []
for i, j in zip(a, b):
if i == j:
contain[i - 1] = 0
res.append(i)
else:
fail.append((i, j))
res.append(0)
falta = []
for i in range(n):
if contain[i] == 1:
falta.append(i + 1)
#print(falta)
#print(fail)
#print(res)
if len(falta) == 1:
for i in range(len(res)):
if res[i] == 0:
res[i] = falta[0]
elif len(falta) == 2:
if fail[0][0] == falta[0] and fail[1][1] == falta[1]:
for i in falta:
for j in range(len(res)):
if res[j] == 0:
res[j] = i
break
elif fail[0][0] == falta[1] and fail[1][1] == falta[0]:
i = 1
while i >= 0:
for j in range(len(res)):
if res[j] == 0:
res[j] = falta[i]
i -= 1
break
elif fail[0][1] == falta[0] and fail[1][0] == falta[1]:
for i in falta:
for j in range(len(res)):
if res[j] == 0:
res[j] = i
break
elif fail[0][1] == falta[1] and fail[1][0] == falta[0]:
i = 1
while i >= 0:
for j in range(len(res)):
if res[j] == 0:
res[j] = falta[i]
i -= 1
break
res = list(map(str, res))
print(' '.join(res))
```
| 3
|
|
1,003
|
A
|
Polycarp's Pockets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
|
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
|
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
|
[
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,694,791,210
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 0
|
n = int(input())
a = list(map(int, input().split()))
c = {}
for i in a:
if i in c:
c[i] += 1
else:
c[i] = 1
m = max(c.values())
print(m)
|
Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
Output Specification:
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
n = int(input())
a = list(map(int, input().split()))
c = {}
for i in a:
if i in c:
c[i] += 1
else:
c[i] = 1
m = max(c.values())
print(m)
```
| 3
|
|
616
|
B
|
Dinner with Emma
|
PROGRAMMING
| 1,000
|
[
"games",
"greedy"
] | null | null |
Jack decides to invite Emma out for a dinner. Jack is a modest student, he doesn't want to go to an expensive restaurant. Emma is a girl with high taste, she prefers elite places.
Munhattan consists of *n* streets and *m* avenues. There is exactly one restaurant on the intersection of each street and avenue. The streets are numbered with integers from 1 to *n* and the avenues are numbered with integers from 1 to *m*. The cost of dinner in the restaurant at the intersection of the *i*-th street and the *j*-th avenue is *c**ij*.
Jack and Emma decide to choose the restaurant in the following way. Firstly Emma chooses the street to dinner and then Jack chooses the avenue. Emma and Jack makes their choice optimally: Emma wants to maximize the cost of the dinner, Jack wants to minimize it. Emma takes into account that Jack wants to minimize the cost of the dinner. Find the cost of the dinner for the couple in love.
|
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of streets and avenues in Munhattan.
Each of the next *n* lines contains *m* integers *c**ij* (1<=≤<=*c**ij*<=≤<=109) — the cost of the dinner in the restaurant on the intersection of the *i*-th street and the *j*-th avenue.
|
Print the only integer *a* — the cost of the dinner for Jack and Emma.
|
[
"3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1\n",
"3 3\n1 2 3\n2 3 1\n3 1 2\n"
] |
[
"2\n",
"1\n"
] |
In the first example if Emma chooses the first or the third streets Jack can choose an avenue with the cost of the dinner 1. So she chooses the second street and Jack chooses any avenue. The cost of the dinner is 2.
In the second example regardless of Emma's choice Jack can choose a restaurant with the cost of the dinner 1.
| 0
|
[
{
"input": "3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1",
"output": "2"
},
{
"input": "3 3\n1 2 3\n2 3 1\n3 1 2",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n74 35 82 39 1 84 29 41 70 12",
"output": "1"
},
{
"input": "10 1\n44\n23\n65\n17\n48\n29\n49\n88\n91\n85",
"output": "91"
},
{
"input": "10 10\n256 72 455 45 912 506 235 68 951 92\n246 305 45 212 788 621 449 876 459 899\n732 107 230 357 370 610 997 669 61 192\n131 93 481 527 983 920 825 540 435 54\n777 682 984 20 337 480 264 137 249 502\n51 467 479 228 923 752 714 436 199 973\n3 91 612 571 631 212 751 84 886 948\n252 130 583 23 194 985 234 978 709 16\n636 991 203 469 719 540 184 902 503 652\n826 680 150 284 37 987 360 183 447 51",
"output": "184"
},
{
"input": "1 1\n1000000000",
"output": "1000000000"
},
{
"input": "2 1\n999999999\n1000000000",
"output": "1000000000"
}
] | 1,608,280,358
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 16
| 170
| 1,536,000
|
n,m=map(int,input().split())
minim=-1
for _ in range(n):
k=list(map(int,input().split()))
if min(k)>minim:
minim=min(k)
print(minim)
|
Title: Dinner with Emma
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jack decides to invite Emma out for a dinner. Jack is a modest student, he doesn't want to go to an expensive restaurant. Emma is a girl with high taste, she prefers elite places.
Munhattan consists of *n* streets and *m* avenues. There is exactly one restaurant on the intersection of each street and avenue. The streets are numbered with integers from 1 to *n* and the avenues are numbered with integers from 1 to *m*. The cost of dinner in the restaurant at the intersection of the *i*-th street and the *j*-th avenue is *c**ij*.
Jack and Emma decide to choose the restaurant in the following way. Firstly Emma chooses the street to dinner and then Jack chooses the avenue. Emma and Jack makes their choice optimally: Emma wants to maximize the cost of the dinner, Jack wants to minimize it. Emma takes into account that Jack wants to minimize the cost of the dinner. Find the cost of the dinner for the couple in love.
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of streets and avenues in Munhattan.
Each of the next *n* lines contains *m* integers *c**ij* (1<=≤<=*c**ij*<=≤<=109) — the cost of the dinner in the restaurant on the intersection of the *i*-th street and the *j*-th avenue.
Output Specification:
Print the only integer *a* — the cost of the dinner for Jack and Emma.
Demo Input:
['3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1\n', '3 3\n1 2 3\n2 3 1\n3 1 2\n']
Demo Output:
['2\n', '1\n']
Note:
In the first example if Emma chooses the first or the third streets Jack can choose an avenue with the cost of the dinner 1. So she chooses the second street and Jack chooses any avenue. The cost of the dinner is 2.
In the second example regardless of Emma's choice Jack can choose a restaurant with the cost of the dinner 1.
|
```python
n,m=map(int,input().split())
minim=-1
for _ in range(n):
k=list(map(int,input().split()))
if min(k)>minim:
minim=min(k)
print(minim)
```
| 3
|
|
334
|
A
|
Candy Bags
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
|
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
|
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits.
|
[
"2\n"
] |
[
"1 4\n2 3\n"
] |
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
| 500
|
[
{
"input": "2",
"output": "1 4\n2 3"
},
{
"input": "4",
"output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9"
},
{
"input": "6",
"output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19"
},
{
"input": "8",
"output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33"
},
{
"input": "10",
"output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51"
},
{
"input": "100",
"output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..."
},
{
"input": "62",
"output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..."
},
{
"input": "66",
"output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..."
},
{
"input": "18",
"output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..."
},
{
"input": "68",
"output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..."
},
{
"input": "86",
"output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..."
},
{
"input": "96",
"output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..."
},
{
"input": "12",
"output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73"
},
{
"input": "88",
"output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..."
},
{
"input": "28",
"output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..."
},
{
"input": "80",
"output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..."
},
{
"input": "48",
"output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..."
},
{
"input": "54",
"output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..."
},
{
"input": "58",
"output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..."
},
{
"input": "64",
"output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..."
},
{
"input": "44",
"output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..."
}
] | 1,561,108,547
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 248
| 614,400
|
n, m = int(input()), []
for i in range(n):
m.append([0]*n)
if n % 2 == 0:
for j in range(n):
for i in range(n):
m[i][j] = n*j + ((n-i) if j % 2 == 1 else (i+1))
else:
px, py, v = 0, n//2, 1
while v <= n*n:
if m[px][py] != 0:
px = (px + 1)%n
m[px][py] = v
v, px, py = v + 1, px - 1, py + 1
px = px if px >= 0 else n-1
py = py if py <= n-1 else 0
for i in range(n):
print(*m[i])
|
Title: Candy Bags
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
Input Specification:
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Output Specification:
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits.
Demo Input:
['2\n']
Demo Output:
['1 4\n2 3\n']
Note:
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
|
```python
n, m = int(input()), []
for i in range(n):
m.append([0]*n)
if n % 2 == 0:
for j in range(n):
for i in range(n):
m[i][j] = n*j + ((n-i) if j % 2 == 1 else (i+1))
else:
px, py, v = 0, n//2, 1
while v <= n*n:
if m[px][py] != 0:
px = (px + 1)%n
m[px][py] = v
v, px, py = v + 1, px - 1, py + 1
px = px if px >= 0 else n-1
py = py if py <= n-1 else 0
for i in range(n):
print(*m[i])
```
| 3
|
|
959
|
A
|
Mahmoud and Ehab and the even-odd game
|
PROGRAMMING
| 800
|
[
"games",
"math"
] | null | null |
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that:
- 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd.
If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
|
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
|
[
"1\n",
"2\n"
] |
[
"Ehab",
"Mahmoud"
] |
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins.
In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
| 500
|
[
{
"input": "1",
"output": "Ehab"
},
{
"input": "2",
"output": "Mahmoud"
},
{
"input": "10000",
"output": "Mahmoud"
},
{
"input": "33333",
"output": "Ehab"
},
{
"input": "5",
"output": "Ehab"
},
{
"input": "1000000000",
"output": "Mahmoud"
},
{
"input": "999999999",
"output": "Ehab"
},
{
"input": "123123123",
"output": "Ehab"
},
{
"input": "22222221",
"output": "Ehab"
},
{
"input": "22222220",
"output": "Mahmoud"
},
{
"input": "3",
"output": "Ehab"
},
{
"input": "4",
"output": "Mahmoud"
},
{
"input": "6",
"output": "Mahmoud"
},
{
"input": "7",
"output": "Ehab"
},
{
"input": "8",
"output": "Mahmoud"
},
{
"input": "9",
"output": "Ehab"
},
{
"input": "10",
"output": "Mahmoud"
},
{
"input": "536870912",
"output": "Mahmoud"
},
{
"input": "536870913",
"output": "Ehab"
},
{
"input": "536870911",
"output": "Ehab"
}
] | 1,670,867,539
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
# https://codeforces.com/problemset/problem/959/A
# ehab first chosses n
n_ehab = int(input())
print ("Mahmoud") if n_ehab%2 ==0 else print("Ehab")
# a_mahmoud =# has to be even
# a_ehab = # has to be odd
|
Title: Mahmoud and Ehab and the even-odd game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that:
- 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd.
If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
Output Specification:
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
Demo Input:
['1\n', '2\n']
Demo Output:
['Ehab', 'Mahmoud']
Note:
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins.
In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
|
```python
# https://codeforces.com/problemset/problem/959/A
# ehab first chosses n
n_ehab = int(input())
print ("Mahmoud") if n_ehab%2 ==0 else print("Ehab")
# a_mahmoud =# has to be even
# a_ehab = # has to be odd
```
| 3
|
|
94
|
B
|
Friends
|
PROGRAMMING
| 1,300
|
[
"graphs",
"implementation",
"math"
] |
B. Friends
|
1
|
256
|
One day Igor K. stopped programming and took up math. One late autumn evening he was sitting at a table reading a book and thinking about something.
The following statement caught his attention: "Among any six people there are either three pairwise acquainted people or three pairwise unacquainted people"
Igor just couldn't get why the required minimum is 6 people. "Well, that's the same for five people, too!" — he kept on repeating in his mind. — "Let's take, say, Max, Ilya, Vova — here, they all know each other! And now let's add Dima and Oleg to Vova — none of them is acquainted with each other! Now, that math is just rubbish!"
Igor K. took 5 friends of his and wrote down who of them is friends with whom. Now he wants to check whether it is true for the five people that among them there are either three pairwise acquainted or three pairwise not acquainted people.
|
The first line contains an integer *m* (0<=≤<=*m*<=≤<=10), which is the number of relations of acquaintances among the five friends of Igor's.
Each of the following *m* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=5;*a**i*<=≠<=*b**i*), where (*a**i*,<=*b**i*) is a pair of acquainted people. It is guaranteed that each pair of the acquaintances is described exactly once. The acquaintance relation is symmetrical, i.e. if *x* is acquainted with *y*, then *y* is also acquainted with *x*.
|
Print "FAIL", if among those five people there are no either three pairwise acquainted or three pairwise unacquainted people. Otherwise print "WIN".
|
[
"4\n1 3\n2 3\n1 4\n5 3\n",
"5\n1 2\n2 3\n3 4\n4 5\n5 1\n"
] |
[
"WIN\n",
"FAIL\n"
] |
none
| 1,000
|
[
{
"input": "4\n1 3\n2 3\n1 4\n5 3",
"output": "WIN"
},
{
"input": "5\n1 2\n2 3\n3 4\n4 5\n5 1",
"output": "FAIL"
},
{
"input": "1\n4 3",
"output": "WIN"
},
{
"input": "6\n1 3\n2 3\n1 2\n5 3\n4 2\n4 5",
"output": "WIN"
},
{
"input": "2\n1 3\n2 5",
"output": "WIN"
},
{
"input": "3\n5 3\n4 3\n4 5",
"output": "WIN"
},
{
"input": "5\n1 3\n3 2\n2 4\n5 4\n1 5",
"output": "FAIL"
},
{
"input": "7\n1 3\n5 1\n1 4\n2 1\n5 3\n4 5\n2 5",
"output": "WIN"
},
{
"input": "5\n5 1\n4 1\n2 3\n4 5\n3 1",
"output": "WIN"
},
{
"input": "0",
"output": "WIN"
},
{
"input": "10\n1 2\n1 3\n1 4\n1 5\n2 3\n2 4\n2 5\n3 4\n3 5\n4 5",
"output": "WIN"
},
{
"input": "4\n1 2\n2 3\n3 4\n4 1",
"output": "WIN"
},
{
"input": "1\n2 1",
"output": "WIN"
},
{
"input": "1\n2 5",
"output": "WIN"
},
{
"input": "2\n2 1\n1 5",
"output": "WIN"
},
{
"input": "2\n4 2\n1 5",
"output": "WIN"
},
{
"input": "2\n3 4\n5 2",
"output": "WIN"
},
{
"input": "2\n1 5\n4 3",
"output": "WIN"
},
{
"input": "3\n4 1\n4 5\n2 1",
"output": "WIN"
},
{
"input": "3\n5 1\n5 3\n2 5",
"output": "WIN"
},
{
"input": "3\n1 2\n4 2\n1 3",
"output": "WIN"
},
{
"input": "3\n3 2\n1 5\n5 3",
"output": "WIN"
},
{
"input": "3\n1 2\n2 4\n3 2",
"output": "WIN"
},
{
"input": "3\n2 1\n1 3\n5 4",
"output": "WIN"
},
{
"input": "4\n4 2\n2 5\n1 4\n4 5",
"output": "WIN"
},
{
"input": "4\n5 2\n2 4\n5 3\n1 5",
"output": "WIN"
},
{
"input": "4\n2 5\n1 3\n4 3\n4 2",
"output": "WIN"
},
{
"input": "4\n1 4\n3 1\n2 3\n1 2",
"output": "WIN"
},
{
"input": "4\n5 4\n2 3\n1 5\n5 2",
"output": "WIN"
},
{
"input": "4\n2 5\n5 4\n1 4\n5 3",
"output": "WIN"
},
{
"input": "4\n2 1\n2 4\n5 1\n4 1",
"output": "WIN"
},
{
"input": "4\n1 2\n1 5\n4 5\n2 3",
"output": "WIN"
},
{
"input": "5\n4 1\n2 4\n3 2\n5 3\n1 5",
"output": "FAIL"
},
{
"input": "5\n1 3\n4 1\n5 2\n2 4\n3 5",
"output": "FAIL"
},
{
"input": "5\n3 5\n4 2\n1 3\n2 1\n5 4",
"output": "FAIL"
},
{
"input": "5\n5 2\n1 3\n4 5\n2 1\n3 4",
"output": "FAIL"
},
{
"input": "5\n2 3\n3 5\n1 2\n4 1\n5 4",
"output": "FAIL"
},
{
"input": "5\n1 2\n4 5\n5 3\n3 1\n2 4",
"output": "FAIL"
},
{
"input": "5\n5 3\n3 2\n2 4\n1 5\n4 1",
"output": "FAIL"
},
{
"input": "5\n3 2\n4 1\n2 5\n1 3\n5 4",
"output": "FAIL"
},
{
"input": "5\n3 5\n1 4\n5 1\n2 3\n4 2",
"output": "FAIL"
},
{
"input": "5\n4 2\n5 3\n2 1\n3 4\n1 5",
"output": "FAIL"
},
{
"input": "5\n3 1\n5 1\n4 5\n2 4\n5 3",
"output": "WIN"
},
{
"input": "5\n5 4\n5 3\n3 1\n1 4\n2 3",
"output": "WIN"
},
{
"input": "5\n4 1\n3 5\n3 4\n5 4\n5 2",
"output": "WIN"
},
{
"input": "5\n4 1\n5 2\n3 1\n4 2\n5 1",
"output": "WIN"
},
{
"input": "5\n2 3\n1 5\n5 3\n2 4\n1 4",
"output": "FAIL"
},
{
"input": "5\n5 4\n5 3\n2 3\n5 2\n5 1",
"output": "WIN"
},
{
"input": "5\n2 4\n3 4\n1 4\n2 1\n3 2",
"output": "WIN"
},
{
"input": "5\n2 3\n3 4\n1 3\n4 1\n5 2",
"output": "WIN"
},
{
"input": "5\n1 2\n2 5\n4 2\n4 3\n3 1",
"output": "WIN"
},
{
"input": "5\n2 1\n2 5\n4 5\n2 3\n3 5",
"output": "WIN"
},
{
"input": "5\n4 1\n5 1\n5 4\n4 3\n5 2",
"output": "WIN"
},
{
"input": "5\n1 3\n2 4\n1 5\n5 2\n4 1",
"output": "WIN"
},
{
"input": "5\n1 5\n3 5\n2 3\n4 1\n3 1",
"output": "WIN"
},
{
"input": "5\n5 2\n3 2\n2 1\n4 3\n4 2",
"output": "WIN"
},
{
"input": "5\n1 3\n4 5\n3 4\n3 5\n5 1",
"output": "WIN"
},
{
"input": "5\n4 5\n2 5\n5 3\n4 2\n4 1",
"output": "WIN"
},
{
"input": "5\n2 5\n1 5\n1 3\n3 5\n1 2",
"output": "WIN"
},
{
"input": "5\n2 4\n1 2\n5 2\n5 3\n4 5",
"output": "WIN"
},
{
"input": "5\n2 1\n4 5\n5 3\n1 5\n1 4",
"output": "WIN"
},
{
"input": "5\n1 3\n2 5\n4 2\n3 4\n4 1",
"output": "WIN"
},
{
"input": "6\n3 2\n2 4\n3 1\n3 5\n5 2\n1 2",
"output": "WIN"
},
{
"input": "6\n2 1\n5 1\n5 4\n3 5\n3 4\n4 1",
"output": "WIN"
},
{
"input": "6\n3 1\n1 4\n5 4\n2 1\n4 2\n1 5",
"output": "WIN"
},
{
"input": "6\n5 1\n5 4\n3 4\n1 3\n1 4\n4 2",
"output": "WIN"
},
{
"input": "6\n1 3\n5 4\n4 2\n2 1\n4 1\n2 3",
"output": "WIN"
},
{
"input": "6\n4 3\n5 3\n4 1\n1 3\n1 2\n2 4",
"output": "WIN"
},
{
"input": "6\n4 1\n3 5\n4 5\n3 1\n4 3\n5 2",
"output": "WIN"
},
{
"input": "6\n2 1\n1 4\n4 5\n5 2\n1 3\n3 2",
"output": "WIN"
},
{
"input": "7\n5 1\n3 5\n2 5\n4 5\n2 3\n3 1\n4 3",
"output": "WIN"
},
{
"input": "7\n5 3\n5 1\n4 2\n4 5\n3 2\n3 4\n1 3",
"output": "WIN"
},
{
"input": "7\n3 5\n1 4\n5 2\n1 5\n1 3\n4 2\n4 3",
"output": "WIN"
},
{
"input": "7\n5 1\n5 4\n2 4\n2 3\n3 5\n2 5\n4 1",
"output": "WIN"
},
{
"input": "7\n1 3\n2 5\n4 3\n2 1\n2 3\n4 5\n2 4",
"output": "WIN"
},
{
"input": "7\n3 1\n4 5\n3 5\n5 1\n2 4\n1 2\n1 4",
"output": "WIN"
},
{
"input": "8\n1 5\n3 1\n2 5\n4 2\n2 1\n4 5\n4 3\n4 1",
"output": "WIN"
},
{
"input": "8\n4 2\n3 1\n4 3\n2 5\n3 2\n4 5\n1 2\n3 5",
"output": "WIN"
},
{
"input": "8\n2 4\n3 2\n2 5\n3 4\n3 1\n5 1\n4 5\n5 3",
"output": "WIN"
},
{
"input": "8\n2 3\n1 5\n1 3\n4 5\n2 4\n1 4\n3 5\n3 4",
"output": "WIN"
},
{
"input": "9\n3 5\n3 2\n1 5\n4 3\n5 4\n1 4\n1 3\n4 2\n5 2",
"output": "WIN"
},
{
"input": "9\n3 5\n2 5\n5 1\n4 5\n1 3\n3 2\n1 4\n4 3\n4 2",
"output": "WIN"
},
{
"input": "3\n3 4\n4 5\n5 3",
"output": "WIN"
},
{
"input": "3\n1 2\n1 3\n4 5",
"output": "WIN"
},
{
"input": "3\n2 3\n3 5\n2 5",
"output": "WIN"
}
] | 1,622,005,545
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 61
| 0
|
l = []
for i in range(int(input())):
x, y = map(int, input().split())
if x not in l:
l.append(x)
if len(l) <= 3:
print('WIN')
else:
print('FAIL')
|
Title: Friends
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Igor K. stopped programming and took up math. One late autumn evening he was sitting at a table reading a book and thinking about something.
The following statement caught his attention: "Among any six people there are either three pairwise acquainted people or three pairwise unacquainted people"
Igor just couldn't get why the required minimum is 6 people. "Well, that's the same for five people, too!" — he kept on repeating in his mind. — "Let's take, say, Max, Ilya, Vova — here, they all know each other! And now let's add Dima and Oleg to Vova — none of them is acquainted with each other! Now, that math is just rubbish!"
Igor K. took 5 friends of his and wrote down who of them is friends with whom. Now he wants to check whether it is true for the five people that among them there are either three pairwise acquainted or three pairwise not acquainted people.
Input Specification:
The first line contains an integer *m* (0<=≤<=*m*<=≤<=10), which is the number of relations of acquaintances among the five friends of Igor's.
Each of the following *m* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=5;*a**i*<=≠<=*b**i*), where (*a**i*,<=*b**i*) is a pair of acquainted people. It is guaranteed that each pair of the acquaintances is described exactly once. The acquaintance relation is symmetrical, i.e. if *x* is acquainted with *y*, then *y* is also acquainted with *x*.
Output Specification:
Print "FAIL", if among those five people there are no either three pairwise acquainted or three pairwise unacquainted people. Otherwise print "WIN".
Demo Input:
['4\n1 3\n2 3\n1 4\n5 3\n', '5\n1 2\n2 3\n3 4\n4 5\n5 1\n']
Demo Output:
['WIN\n', 'FAIL\n']
Note:
none
|
```python
l = []
for i in range(int(input())):
x, y = map(int, input().split())
if x not in l:
l.append(x)
if len(l) <= 3:
print('WIN')
else:
print('FAIL')
```
| 0
|
938
|
A
|
Word Correction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
|
Output the word *s* after the correction.
|
[
"5\nweird\n",
"4\nword\n",
"5\naaeaa\n"
] |
[
"werd\n",
"word\n",
"a\n"
] |
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
| 0
|
[
{
"input": "5\nweird",
"output": "werd"
},
{
"input": "4\nword",
"output": "word"
},
{
"input": "5\naaeaa",
"output": "a"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyw",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyw"
},
{
"input": "69\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "12\nmmmmmmmmmmmm",
"output": "mmmmmmmmmmmm"
},
{
"input": "18\nyaywptqwuyiqypwoyw",
"output": "ywptqwuqypwow"
},
{
"input": "85\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "13\nmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmm"
},
{
"input": "10\nmmmmmmmmmm",
"output": "mmmmmmmmmm"
},
{
"input": "11\nmmmmmmmmmmm",
"output": "mmmmmmmmmmm"
},
{
"input": "15\nmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmm"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "14\nmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmm"
},
{
"input": "33\nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm"
},
{
"input": "79\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "90\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "2\naa",
"output": "a"
},
{
"input": "18\niuiuqpyyaoaetiwliu",
"output": "iqpytiwli"
},
{
"input": "5\nxxxxx",
"output": "xxxxx"
},
{
"input": "6\nxxxahg",
"output": "xxxahg"
},
{
"input": "3\nzcv",
"output": "zcv"
},
{
"input": "4\naepo",
"output": "apo"
},
{
"input": "5\nqqqqq",
"output": "qqqqq"
},
{
"input": "6\naaaaaa",
"output": "a"
},
{
"input": "4\naeta",
"output": "ata"
},
{
"input": "20\nttyttlwaoieulyiluuri",
"output": "ttyttlwalyluri"
},
{
"input": "1\nb",
"output": "b"
},
{
"input": "3\nanc",
"output": "anc"
},
{
"input": "1\ne",
"output": "e"
},
{
"input": "3\naie",
"output": "a"
},
{
"input": "3\nvio",
"output": "vi"
},
{
"input": "2\nea",
"output": "e"
},
{
"input": "3\nuas",
"output": "us"
},
{
"input": "2\nba",
"output": "ba"
},
{
"input": "2\naq",
"output": "aq"
},
{
"input": "2\nya",
"output": "y"
},
{
"input": "2\nou",
"output": "o"
},
{
"input": "2\nbb",
"output": "bb"
},
{
"input": "7\nayylmao",
"output": "alma"
},
{
"input": "2\nab",
"output": "ab"
},
{
"input": "19\nyuouiyaoiiweqrryqqp",
"output": "yweqrryqqp"
},
{
"input": "25\niqypwqpriiioetiuqqqttouei",
"output": "iqypwqpritiqqqtto"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyz",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyz"
},
{
"input": "17\naccccccccccccccca",
"output": "accccccccccccccca"
},
{
"input": "5\nababa",
"output": "ababa"
},
{
"input": "10\naaaaaaaaaa",
"output": "a"
},
{
"input": "22\naaaaabbbbboyoyoyoyoyac",
"output": "abbbbboc"
},
{
"input": "7\nmahmoud",
"output": "mahmod"
}
] | 1,550,587,507
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 109
| 0
|
n=int(input())
ch=str(input())
l=list(ch)
#print(l)
for i in range(n-1):
if((l[i] in {'a','e','i','o','u','y'}) or (l[i] in {"."})):
if(l[i+1] in {'a','e','i','o','u','y'}):
l[i+1]="."
ch=""
for i in l:
if (i!="."):
ch=ch+i
print(ch)
|
Title: Word Correction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
Output Specification:
Output the word *s* after the correction.
Demo Input:
['5\nweird\n', '4\nword\n', '5\naaeaa\n']
Demo Output:
['werd\n', 'word\n', 'a\n']
Note:
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
|
```python
n=int(input())
ch=str(input())
l=list(ch)
#print(l)
for i in range(n-1):
if((l[i] in {'a','e','i','o','u','y'}) or (l[i] in {"."})):
if(l[i+1] in {'a','e','i','o','u','y'}):
l[i+1]="."
ch=""
for i in l:
if (i!="."):
ch=ch+i
print(ch)
```
| 3
|
|
975
|
A
|
Aramic script
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
In Aramic language words can only represent objects.
Words in Aramic have special properties:
- A word is a root if it does not contain the same letter more than once. - A root and all its permutations represent the same object. - The root $x$ of a word $y$ is the word that contains all letters that appear in $y$ in a way that each letter appears once. For example, the root of "aaaa", "aa", "aaa" is "a", the root of "aabb", "bab", "baabb", "ab" is "ab". - Any word in Aramic represents the same object as its root.
You have an ancient script in Aramic. What is the number of different objects mentioned in the script?
|
The first line contains one integer $n$ ($1 \leq n \leq 10^3$) — the number of words in the script.
The second line contains $n$ words $s_1, s_2, \ldots, s_n$ — the script itself. The length of each string does not exceed $10^3$.
It is guaranteed that all characters of the strings are small latin letters.
|
Output one integer — the number of different objects mentioned in the given ancient Aramic script.
|
[
"5\na aa aaa ab abb\n",
"3\namer arem mrea\n"
] |
[
"2",
"1"
] |
In the first test, there are two objects mentioned. The roots that represent them are "a","ab".
In the second test, there is only one object, its root is "amer", the other strings are just permutations of "amer".
| 500
|
[
{
"input": "5\na aa aaa ab abb",
"output": "2"
},
{
"input": "3\namer arem mrea",
"output": "1"
},
{
"input": "10\nbda bbb cda dca dda dcb bcd dcb ada ddd",
"output": "6"
},
{
"input": "2\nfhjlqs aceginpr",
"output": "2"
},
{
"input": "2\nbcdfghimn efghijlmo",
"output": "2"
}
] | 1,667,893,897
| 97
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 7,475,200
|
import sys
from math import factorial
input = sys.stdin.readline
#X,Y,Z = list(map(int,input().strip().split()))
n = input()
arr = list(map(str,input().strip().split()))
roots = []
for i in arr:
word = []
for j in i :
if j not in word:
word.append(j)
roots.append(word)
sortedroots = []
for i in roots:
i = list(i)
i.sort()
sortedroots.append(i)
ans = []
for j in sortedroots:
if j not in ans :
ans.append(j)
print(len(ans))
|
Title: Aramic script
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Aramic language words can only represent objects.
Words in Aramic have special properties:
- A word is a root if it does not contain the same letter more than once. - A root and all its permutations represent the same object. - The root $x$ of a word $y$ is the word that contains all letters that appear in $y$ in a way that each letter appears once. For example, the root of "aaaa", "aa", "aaa" is "a", the root of "aabb", "bab", "baabb", "ab" is "ab". - Any word in Aramic represents the same object as its root.
You have an ancient script in Aramic. What is the number of different objects mentioned in the script?
Input Specification:
The first line contains one integer $n$ ($1 \leq n \leq 10^3$) — the number of words in the script.
The second line contains $n$ words $s_1, s_2, \ldots, s_n$ — the script itself. The length of each string does not exceed $10^3$.
It is guaranteed that all characters of the strings are small latin letters.
Output Specification:
Output one integer — the number of different objects mentioned in the given ancient Aramic script.
Demo Input:
['5\na aa aaa ab abb\n', '3\namer arem mrea\n']
Demo Output:
['2', '1']
Note:
In the first test, there are two objects mentioned. The roots that represent them are "a","ab".
In the second test, there is only one object, its root is "amer", the other strings are just permutations of "amer".
|
```python
import sys
from math import factorial
input = sys.stdin.readline
#X,Y,Z = list(map(int,input().strip().split()))
n = input()
arr = list(map(str,input().strip().split()))
roots = []
for i in arr:
word = []
for j in i :
if j not in word:
word.append(j)
roots.append(word)
sortedroots = []
for i in roots:
i = list(i)
i.sort()
sortedroots.append(i)
ans = []
for j in sortedroots:
if j not in ans :
ans.append(j)
print(len(ans))
```
| 3
|
|
141
|
A
|
Amusing Joke
|
PROGRAMMING
| 800
|
[
"implementation",
"sortings",
"strings"
] | null | null |
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door.
The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters.
Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
|
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
|
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
|
[
"SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n",
"PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n",
"BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left.
In the second sample letter "P" is missing from the pile and there's an extra letter "L".
In the third sample there's an extra letter "L".
| 500
|
[
{
"input": "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS",
"output": "YES"
},
{
"input": "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI",
"output": "NO"
},
{
"input": "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER",
"output": "NO"
},
{
"input": "B\nA\nAB",
"output": "YES"
},
{
"input": "ONDOL\nJNPB\nONLNJBODP",
"output": "YES"
},
{
"input": "Y\nW\nYW",
"output": "YES"
},
{
"input": "OI\nM\nIMO",
"output": "YES"
},
{
"input": "VFQRWWWACX\nGHZJPOQUSXRAQDGOGMR\nOPAWDOUSGWWCGQXXQAZJRQRGHRMVF",
"output": "YES"
},
{
"input": "JUTCN\nPIGMZOPMEUFADQBW\nNWQGZMAIPUPOMCDUB",
"output": "NO"
},
{
"input": "Z\nO\nZOCNDOLTBZKQLTBOLDEGXRHZGTTPBJBLSJCVSVXISQZCSFDEBXRCSGBGTHWOVIXYHACAGBRYBKBJAEPIQZHVEGLYH",
"output": "NO"
},
{
"input": "IQ\nOQ\nQOQIGGKFNHJSGCGM",
"output": "NO"
},
{
"input": "ROUWANOPNIGTVMIITVMZ\nOQTUPZMTKUGY\nVTVNGZITGPUNPMQOOATUUIYIWMMKZOTR",
"output": "YES"
},
{
"input": "OVQELLOGFIOLEHXMEMBJDIGBPGEYFG\nJNKFPFFIJOFHRIFHXEWYZOPDJBZTJZKBWQTECNHRFSJPJOAPQT\nYAIPFFFEXJJNEJPLREIGODEGQZVMCOBDFKWTMWJSBEBTOFFQOHIQJLHFNXIGOHEZRZLFOKJBJPTPHPGY",
"output": "YES"
},
{
"input": "NBJGVNGUISUXQTBOBKYHQCOOVQWUXWPXBUDLXPKX\nNSFQDFUMQDQWQ\nWXKKVNTDQQFXCUQBIMQGQHSLVGWSBFYBUPOWPBDUUJUXQNOQDNXOX",
"output": "YES"
},
{
"input": "IJHHGKCXWDBRWJUPRDBZJLNTTNWKXLUGJSBWBOAUKWRAQWGFNL\nNJMWRMBCNPHXTDQQNZ\nWDNJRCLILNQRHWBANLTXWMJBPKUPGKJDJZAQWKTZFBRCTXHHBNXRGUQUNBNMWODGSJWW",
"output": "YES"
},
{
"input": "SRROWANGUGZHCIEFYMQVTWVOMDWPUZJFRDUMVFHYNHNTTGNXCJ\nDJYWGLBFCCECXFHOLORDGDCNRHPWXNHXFCXQCEZUHRRNAEKUIX\nWCUJDNYHNHYOPWMHLDCDYRWBVOGHFFUKOZTXJRXJHRGWICCMRNEVNEGQWTZPNFCSHDRFCFQDCXMHTLUGZAXOFNXNVGUEXIACRERU",
"output": "YES"
},
{
"input": "H\nJKFGHMIAHNDBMFXWYQLZRSVNOTEGCQSVUBYUOZBTNKTXPFQDCMKAGFITEUGOYDFIYQIORMFJEOJDNTFVIQEBICSNGKOSNLNXJWC\nBQSVDOGIHCHXSYNYTQFCHNJGYFIXTSOQINZOKSVQJMTKNTGFNXAVTUYEONMBQMGJLEWJOFGEARIOPKFUFCEMUBRBDNIIDFZDCLWK",
"output": "YES"
},
{
"input": "DSWNZRFVXQ\nPVULCZGOOU\nUOLVZXNUPOQRZGWFVDSCANQTCLEIE",
"output": "NO"
},
{
"input": "EUHTSCENIPXLTSBMLFHD\nIZAVSZPDLXOAGESUSE\nLXAELAZ",
"output": "NO"
},
{
"input": "WYSJFEREGELSKRQRXDXCGBODEFZVSI\nPEJKMGFLBFFDWRCRFSHVEFLEBTJCVCHRJTLDTISHPOGFWPLEWNYJLMXWIAOTYOXMV\nHXERTZWLEXTPIOTFRVMEJVYFFJLRPFMXDEBNSGCEOFFCWTKIDDGCFYSJKGLHBORWEPLDRXRSJYBGASSVCMHEEJFLVI",
"output": "NO"
},
{
"input": "EPBMDIUQAAUGLBIETKOKFLMTCVEPETWJRHHYKCKU\nHGMAETVPCFZYNNKDQXVXUALHYLOTCHM\nECGXACVKEYMCEDOTMKAUFHLHOMT",
"output": "NO"
},
{
"input": "NUBKQEJHALANSHEIFUZHYEZKKDRFHQKAJHLAOWTZIMOCWOVVDW\nEFVOBIGAUAUSQGVSNBKNOBDMINODMFSHDL\nKLAMKNTHBFFOHVKWICHBKNDDQNEISODUSDNLUSIOAVWY",
"output": "NO"
},
{
"input": "VXINHOMEQCATZUGAJEIUIZZLPYFGUTVLNBNWCUVMEENUXKBWBGZTMRJJVJDLVSLBABVCEUDDSQFHOYPYQTWVAGTWOLKYISAGHBMC\nZMRGXPZSHOGCSAECAPGVOIGCWEOWWOJXLGYRDMPXBLOKZVRACPYQLEQGFQCVYXAGBEBELUTDAYEAGPFKXRULZCKFHZCHVCWIRGPK\nRCVUXGQVNWFGRUDLLENNDQEJHYYVWMKTLOVIPELKPWCLSQPTAXAYEMGWCBXEVAIZGGDDRBRT",
"output": "NO"
},
{
"input": "PHBDHHWUUTZAHELGSGGOPOQXSXEZIXHZTOKYFBQLBDYWPVCNQSXHEAXRRPVHFJBVBYCJIFOTQTWSUOWXLKMVJJBNLGTVITWTCZZ\nFUPDLNVIHRWTEEEHOOEC\nLOUSUUSZCHJBPEWIILUOXEXRQNCJEGTOBRVZLTTZAHTKVEJSNGHFTAYGY",
"output": "NO"
},
{
"input": "GDSLNIIKTO\nJF\nPDQYFKDTNOLI",
"output": "NO"
},
{
"input": "AHOKHEKKPJLJIIWJRCGY\nORELJCSIX\nZVWPXVFWFSWOXXLIHJKPXIOKRELYE",
"output": "NO"
},
{
"input": "ZWCOJFORBPHXCOVJIDPKVECMHVHCOC\nTEV\nJVGTBFTLFVIEPCCHODOFOMCVZHWXVCPEH",
"output": "NO"
},
{
"input": "AGFIGYWJLVMYZGNQHEHWKJIAWBPUAQFERMCDROFN\nPMJNHMVNRGCYZAVRWNDSMLSZHFNYIUWFPUSKKIGU\nMCDVPPRXGUAYLSDRHRURZASXUWZSIIEZCPXUVEONKNGNWRYGOSFMCKESMVJZHWWUCHWDQMLASLNNMHAU",
"output": "NO"
},
{
"input": "XLOWVFCZSSXCSYQTIIDKHNTKNKEEDFMDZKXSPVLBIDIREDUAIN\nZKIWNDGBISDB\nSLPKLYFYSRNRMOSWYLJJDGFFENPOXYLPZFTQDANKBDNZDIIEWSUTTKYBKVICLG",
"output": "NO"
},
{
"input": "PMUKBTRKFIAYVGBKHZHUSJYSSEPEOEWPOSPJLWLOCTUYZODLTUAFCMVKGQKRRUSOMPAYOTBTFPXYAZXLOADDEJBDLYOTXJCJYTHA\nTWRRAJLCQJTKOKWCGUH\nEWDPNXVCXWCDQCOYKKSOYTFSZTOOPKPRDKFJDETKSRAJRVCPDOBWUGPYRJPUWJYWCBLKOOTUPBESTOFXZHTYLLMCAXDYAEBUTAHM",
"output": "NO"
},
{
"input": "QMIMGQRQDMJDPNFEFXSXQMCHEJKTWCTCVZPUAYICOIRYOWKUSIWXJLHDYWSBOITHTMINXFKBKAWZTXXBJIVYCRWKXNKIYKLDDXL\nV\nFWACCXBVDOJFIUAVYRALBYJKXXWIIFORRUHKHCXLDBZMXIYJWISFEAWTIQFIZSBXMKNOCQKVKRWDNDAMQSTKYLDNYVTUCGOJXJTW",
"output": "NO"
},
{
"input": "XJXPVOOQODELPPWUISSYVVXRJTYBPDHJNENQEVQNVFIXSESKXVYPVVHPMOSX\nLEXOPFPVPSZK\nZVXVPYEYOYXVOISVLXPOVHEQVXPNQJIOPFDTXEUNMPEPPHELNXKKWSVSOXSBPSJDPVJVSRFQ",
"output": "YES"
},
{
"input": "OSKFHGYNQLSRFSAHPXKGPXUHXTRBJNAQRBSSWJVEENLJCDDHFXVCUNPZAIVVO\nFNUOCXAGRRHNDJAHVVLGGEZQHWARYHENBKHP\nUOEFNWVXCUNERLKVTHAGPSHKHDYFPYWZHJKHQLSNFBJHVJANRXCNSDUGVDABGHVAOVHBJZXGRACHRXEGNRPQEAPORQSILNXFS",
"output": "YES"
},
{
"input": "VYXYVVACMLPDHONBUTQFZTRREERBLKUJYKAHZRCTRLRCLOZYWVPBRGDQPFPQIF\nFE\nRNRPEVDRLYUQFYRZBCQLCYZEABKLRXCJLKVZBVFUEYRATOMDRTHFPGOWQVTIFPPH",
"output": "YES"
},
{
"input": "WYXUZQJQNLASEGLHPMSARWMTTQMQLVAZLGHPIZTRVTCXDXBOLNXZPOFCTEHCXBZ\nBLQZRRWP\nGIQZXPLTTMNHQVWPPEAPLOCDMBSTHRCFLCQRRZXLVAOQEGZBRUZJXXZTMAWLZHSLWNQTYXB",
"output": "YES"
},
{
"input": "MKVJTSSTDGKPVVDPYSRJJYEVGKBMSIOKHLZQAEWLRIBINVRDAJIBCEITKDHUCCVY\nPUJJQFHOGZKTAVNUGKQUHMKTNHCCTI\nQVJKUSIGTSVYUMOMLEGHWYKSKQTGATTKBNTKCJKJPCAIRJIRMHKBIZISEGFHVUVQZBDERJCVAKDLNTHUDCHONDCVVJIYPP",
"output": "YES"
},
{
"input": "OKNJOEYVMZXJMLVJHCSPLUCNYGTDASKSGKKCRVIDGEIBEWRVBVRVZZTLMCJLXHJIA\nDJBFVRTARTFZOWN\nAGHNVUNJVCPLWSVYBJKZSVTFGLELZASLWTIXDDJXCZDICTVIJOTMVEYOVRNMJGRKKHRMEBORAKFCZJBR",
"output": "YES"
},
{
"input": "OQZACLPSAGYDWHFXDFYFRRXWGIEJGSXWUONAFWNFXDTGVNDEWNQPHUXUJNZWWLBPYL\nOHBKWRFDRQUAFRCMT\nWIQRYXRJQWWRUWCYXNXALKFZGXFTLOODWRDPGURFUFUQOHPWBASZNVWXNCAGHWEHFYESJNFBMNFDDAPLDGT",
"output": "YES"
},
{
"input": "OVIRQRFQOOWVDEPLCJETWQSINIOPLTLXHSQWUYUJNFBMKDNOSHNJQQCDHZOJVPRYVSV\nMYYDQKOOYPOOUELCRIT\nNZSOTVLJTTVQLFHDQEJONEOUOFOLYVSOIYUDNOSIQVIRMVOERCLMYSHPCQKIDRDOQPCUPQBWWRYYOXJWJQPNKH",
"output": "YES"
},
{
"input": "WGMBZWNMSJXNGDUQUJTCNXDSJJLYRDOPEGPQXYUGBESDLFTJRZDDCAAFGCOCYCQMDBWK\nYOBMOVYTUATTFGJLYUQD\nDYXVTLQCYFJUNJTUXPUYOPCBCLBWNSDUJRJGWDOJDSQAAMUOJWSYERDYDXYTMTOTMQCGQZDCGNFBALGGDFKZMEBG",
"output": "YES"
},
{
"input": "CWLRBPMEZCXAPUUQFXCUHAQTLPBTXUUKWVXKBHKNSSJFEXLZMXGVFHHVTPYAQYTIKXJJE\nMUFOSEUEXEQTOVLGDSCWM\nJUKEQCXOXWEHCGKFPBIGMWVJLXUONFXBYTUAXERYTXKCESKLXAEHVPZMMUFTHLXTTZSDMBJLQPEUWCVUHSQQVUASPF",
"output": "YES"
},
{
"input": "IDQRX\nWETHO\nODPDGBHVUVSSISROHQJTUKPUCLXABIZQQPPBPKOSEWGEHRSRRNBAVLYEMZISMWWGKHVTXKUGUXEFBSWOIWUHRJGMWBMHQLDZHBWA",
"output": "NO"
},
{
"input": "IXFDY\nJRMOU\nDF",
"output": "NO"
},
{
"input": "JPSPZ\nUGCUB\nJMZZZZZZZZ",
"output": "NO"
},
{
"input": "AC\nA\nBBA",
"output": "NO"
},
{
"input": "UIKWWKXLSHTOOZOVGXKYSOJEHAUEEG\nKZXQDWJJWRXFHKJDQHJK\nXMZHTFOGEXAUJXXJUYVJIFOTKLZHDKELJWERHMGAWGKWAQKEKHIDWGGZVYOHKXRPWSJDPESFJUMKQYWBYUTHQYEFZUGKQOBHYDWB",
"output": "NO"
},
{
"input": "PXWRXRPFLR\nPJRWWXIVHODV\nXW",
"output": "NO"
},
{
"input": "CHTAZVHGSHCVIBK\nEQINEBKXEPYJSAZIMLDF\nZCZZZZDZMCZZEZDZZEZZZZQZZBZZZOZZCZE",
"output": "NO"
},
{
"input": "GXPZFSELJJNDAXYRV\nUYBKPMVBSOVOJWMONLTJOJCNQKMTAHEWLHOWIIBH\nHCWNFWJPEJIWOVPTBMVCRJLSISSVNOHCKLBFMIUAIMASQWPXEYXBOXQGFEMYJLBKDCZIMJNHOJEDGGANIVYKQTUOSOVOPWHVJGXH",
"output": "NO"
},
{
"input": "LFGJCJJDUTUP\nOVSBILTIYCJCRHKCIXCETJQJJ\nGIJJTJCLTJJJ",
"output": "NO"
},
{
"input": "GIO\nPRL\nPRL",
"output": "NO"
},
{
"input": "A\nB\nABC",
"output": "NO"
},
{
"input": "KKK\nKKK\nZZZZZ",
"output": "NO"
},
{
"input": "ZMYGQLDBLAPN\nZFJBKWHROVNPSJQUDFTHOCGREUFLYIWYICD\nZMJZZEDAZANKZZZZZZEZZBZDZZZZZZKHZZFZZZDZNZMDZZA",
"output": "NO"
}
] | 1,687,259,682
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 92
| 0
|
# -*- coding: utf-8 -*-
"""141A.ipynb
Automatically generated by Colaboratory.
Original file is located at
https://colab.research.google.com/drive/1YAcE_C3NXDvEY0NY_rHyte8StemSWBIK
"""
g= input()
h= input()
pile= input()
cn = g+h
sort_cn = sorted(cn)
sort_pile = sorted(pile)
if sort_cn== sort_pile:
print("YES")
else:
print("NO")
|
Title: Amusing Joke
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door.
The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters.
Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
Input Specification:
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
Output Specification:
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
Demo Input:
['SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n', 'PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n', 'BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left.
In the second sample letter "P" is missing from the pile and there's an extra letter "L".
In the third sample there's an extra letter "L".
|
```python
# -*- coding: utf-8 -*-
"""141A.ipynb
Automatically generated by Colaboratory.
Original file is located at
https://colab.research.google.com/drive/1YAcE_C3NXDvEY0NY_rHyte8StemSWBIK
"""
g= input()
h= input()
pile= input()
cn = g+h
sort_cn = sorted(cn)
sort_pile = sorted(pile)
if sort_cn== sort_pile:
print("YES")
else:
print("NO")
```
| 3
|
|
222
|
A
|
Shooshuns and Sequence
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps:
1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence.
The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
|
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
|
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
|
[
"3 2\n3 1 1\n",
"3 1\n3 1 1\n"
] |
[
"1\n",
"-1\n"
] |
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one.
In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
| 500
|
[
{
"input": "3 2\n3 1 1",
"output": "1"
},
{
"input": "3 1\n3 1 1",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "0"
},
{
"input": "2 1\n2 1",
"output": "-1"
},
{
"input": "4 4\n1 2 3 4",
"output": "3"
},
{
"input": "4 3\n1 2 3 4",
"output": "-1"
},
{
"input": "5 3\n2 1 1 1 1",
"output": "1"
},
{
"input": "5 3\n1 1 1 1 1",
"output": "0"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "0"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "10 1\n1 2 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 1\n2 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 2\n2 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "10 2\n1 2 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 3\n3 2 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "10 1\n1 2 3 4 5 6 7 8 9 10",
"output": "-1"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "20 10\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "20 11\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "10"
},
{
"input": "20 9\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "20 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "20 20\n20 1 19 2 18 3 17 4 16 5 15 6 14 7 13 8 12 9 11 10",
"output": "19"
}
] | 1,661,947,750
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 47
| 154
| 13,414,400
|
## Fast I/O
import io,os,sys
# Fast input. Use s = input().decode() for strings
# input = io.BytesIO(os.read(0,os.fstat(0).st_size)).readline
# Fast output
def print(*args, sep = ' ', end = '\n'):
string = sep.join(map(str, args))+end
sys.stdout.write(string)
def debug(*args, sep = ' ', end = '\n'):
string = "Debug: " + sep.join(map(str, args)) + end
sys.stderr.write(string)
# from collections import Counter, defaultdict
# from functools import lru_cache
# from math import floor, ceil, sqrt, gcd
# from sys import stderr
N, K = map(int, input().split())
A = list(map(int, input().split()))
for i in range(K, N):
if A[i] != A[K-1]:
print(-1)
break
else:
for i in range(K-2, -1, -1):
if A[i] != A[K-1]:
print(i+1)
break
else:
print(0)
#
# @PoustouFlan
# Code:Choke?!
# [ 极客 ]
#
|
Title: Shooshuns and Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps:
1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence.
The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
Input Specification:
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
Output Specification:
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
Demo Input:
['3 2\n3 1 1\n', '3 1\n3 1 1\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one.
In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
|
```python
## Fast I/O
import io,os,sys
# Fast input. Use s = input().decode() for strings
# input = io.BytesIO(os.read(0,os.fstat(0).st_size)).readline
# Fast output
def print(*args, sep = ' ', end = '\n'):
string = sep.join(map(str, args))+end
sys.stdout.write(string)
def debug(*args, sep = ' ', end = '\n'):
string = "Debug: " + sep.join(map(str, args)) + end
sys.stderr.write(string)
# from collections import Counter, defaultdict
# from functools import lru_cache
# from math import floor, ceil, sqrt, gcd
# from sys import stderr
N, K = map(int, input().split())
A = list(map(int, input().split()))
for i in range(K, N):
if A[i] != A[K-1]:
print(-1)
break
else:
for i in range(K-2, -1, -1):
if A[i] != A[K-1]:
print(i+1)
break
else:
print(0)
#
# @PoustouFlan
# Code:Choke?!
# [ 极客 ]
#
```
| 3
|
|
938
|
A
|
Word Correction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
|
Output the word *s* after the correction.
|
[
"5\nweird\n",
"4\nword\n",
"5\naaeaa\n"
] |
[
"werd\n",
"word\n",
"a\n"
] |
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
| 0
|
[
{
"input": "5\nweird",
"output": "werd"
},
{
"input": "4\nword",
"output": "word"
},
{
"input": "5\naaeaa",
"output": "a"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyw",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyw"
},
{
"input": "69\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "12\nmmmmmmmmmmmm",
"output": "mmmmmmmmmmmm"
},
{
"input": "18\nyaywptqwuyiqypwoyw",
"output": "ywptqwuqypwow"
},
{
"input": "85\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "13\nmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmm"
},
{
"input": "10\nmmmmmmmmmm",
"output": "mmmmmmmmmm"
},
{
"input": "11\nmmmmmmmmmmm",
"output": "mmmmmmmmmmm"
},
{
"input": "15\nmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmm"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "14\nmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmm"
},
{
"input": "33\nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm"
},
{
"input": "79\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "90\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "2\naa",
"output": "a"
},
{
"input": "18\niuiuqpyyaoaetiwliu",
"output": "iqpytiwli"
},
{
"input": "5\nxxxxx",
"output": "xxxxx"
},
{
"input": "6\nxxxahg",
"output": "xxxahg"
},
{
"input": "3\nzcv",
"output": "zcv"
},
{
"input": "4\naepo",
"output": "apo"
},
{
"input": "5\nqqqqq",
"output": "qqqqq"
},
{
"input": "6\naaaaaa",
"output": "a"
},
{
"input": "4\naeta",
"output": "ata"
},
{
"input": "20\nttyttlwaoieulyiluuri",
"output": "ttyttlwalyluri"
},
{
"input": "1\nb",
"output": "b"
},
{
"input": "3\nanc",
"output": "anc"
},
{
"input": "1\ne",
"output": "e"
},
{
"input": "3\naie",
"output": "a"
},
{
"input": "3\nvio",
"output": "vi"
},
{
"input": "2\nea",
"output": "e"
},
{
"input": "3\nuas",
"output": "us"
},
{
"input": "2\nba",
"output": "ba"
},
{
"input": "2\naq",
"output": "aq"
},
{
"input": "2\nya",
"output": "y"
},
{
"input": "2\nou",
"output": "o"
},
{
"input": "2\nbb",
"output": "bb"
},
{
"input": "7\nayylmao",
"output": "alma"
},
{
"input": "2\nab",
"output": "ab"
},
{
"input": "19\nyuouiyaoiiweqrryqqp",
"output": "yweqrryqqp"
},
{
"input": "25\niqypwqpriiioetiuqqqttouei",
"output": "iqypwqpritiqqqtto"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyz",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyz"
},
{
"input": "17\naccccccccccccccca",
"output": "accccccccccccccca"
},
{
"input": "5\nababa",
"output": "ababa"
},
{
"input": "10\naaaaaaaaaa",
"output": "a"
},
{
"input": "22\naaaaabbbbboyoyoyoyoyac",
"output": "abbbbboc"
},
{
"input": "7\nmahmoud",
"output": "mahmod"
}
] | 1,522,828,247
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 6,963,200
|
n=int(input())
ch=input()
l=["a","e","i","o","u"]
b=0
for c in ch:
if (c in l) and (b==0):
b=1
print(c)
elif not((c in l)):
b=0
print(c)
|
Title: Word Correction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
Output Specification:
Output the word *s* after the correction.
Demo Input:
['5\nweird\n', '4\nword\n', '5\naaeaa\n']
Demo Output:
['werd\n', 'word\n', 'a\n']
Note:
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
|
```python
n=int(input())
ch=input()
l=["a","e","i","o","u"]
b=0
for c in ch:
if (c in l) and (b==0):
b=1
print(c)
elif not((c in l)):
b=0
print(c)
```
| 0
|
|
456
|
A
|
Laptops
|
PROGRAMMING
| 1,100
|
[
"sortings"
] | null | null |
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
|
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
|
[
"2\n1 2\n2 1\n"
] |
[
"Happy Alex\n"
] |
none
| 500
|
[
{
"input": "2\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "2\n1 1\n2 2",
"output": "Poor Alex"
},
{
"input": "3\n2 2\n3 3\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n3 3\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "1\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n2 3\n1 1\n3 2",
"output": "Happy Alex"
},
{
"input": "4\n4 1\n3 2\n2 3\n1 4",
"output": "Happy Alex"
},
{
"input": "2\n2 1\n1 2",
"output": "Happy Alex"
},
{
"input": "3\n3 2\n1 1\n2 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 1\n3 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
}
] | 1,671,863,922
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 404
| 13,926,400
|
n=int(input());l=[];l2=[];l3=[]
for i in range(n):
a,b=[int(x) for x in input().split()]
l.append([a,b]); l2.append(b);l3.append(a)
l=dict(l);l3.sort();l2.sort()
for i in range(n):
if l[l3[i]]!=l2[i]:
print("Happy Alex")
exit()
print("Poor Alex")
|
Title: Laptops
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
Output Specification:
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
Demo Input:
['2\n1 2\n2 1\n']
Demo Output:
['Happy Alex\n']
Note:
none
|
```python
n=int(input());l=[];l2=[];l3=[]
for i in range(n):
a,b=[int(x) for x in input().split()]
l.append([a,b]); l2.append(b);l3.append(a)
l=dict(l);l3.sort();l2.sort()
for i in range(n):
if l[l3[i]]!=l2[i]:
print("Happy Alex")
exit()
print("Poor Alex")
```
| 3
|
|
4
|
A
|
Watermelon
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Watermelon
|
1
|
64
|
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
|
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
|
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
|
[
"8\n"
] |
[
"YES\n"
] |
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
| 0
|
[
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,695,285,711
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 62
| 0
|
x=int(input())
if 1<=x<=100 and x%2==0 :
print('yes')
else:
print('no')
|
Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
|
```python
x=int(input())
if 1<=x<=100 and x%2==0 :
print('yes')
else:
print('no')
```
| 0
|
577
|
A
|
Multiplication Table
|
PROGRAMMING
| 1,000
|
[
"implementation",
"number theory"
] | null | null |
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1.
You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
|
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
|
Print a single number: the number of times *x* occurs in the table.
|
[
"10 5\n",
"6 12\n",
"5 13\n"
] |
[
"2\n",
"4\n",
"0\n"
] |
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
| 500
|
[
{
"input": "10 5",
"output": "2"
},
{
"input": "6 12",
"output": "4"
},
{
"input": "5 13",
"output": "0"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "1 1000000000",
"output": "0"
},
{
"input": "100000 1000000000",
"output": "16"
},
{
"input": "100000 362880",
"output": "154"
},
{
"input": "1 4",
"output": "0"
},
{
"input": "9 12",
"output": "4"
},
{
"input": "10 123",
"output": "0"
},
{
"input": "9551 975275379",
"output": "0"
},
{
"input": "17286 948615687",
"output": "0"
},
{
"input": "58942 936593001",
"output": "0"
},
{
"input": "50000 989460910",
"output": "4"
},
{
"input": "22741 989460910",
"output": "0"
},
{
"input": "22740 989460910",
"output": "0"
},
{
"input": "100000 989460910",
"output": "4"
},
{
"input": "100000 98280",
"output": "128"
},
{
"input": "100000 997920",
"output": "222"
},
{
"input": "100000 720720",
"output": "226"
},
{
"input": "100000 2162160",
"output": "282"
},
{
"input": "100000 4324320",
"output": "320"
},
{
"input": "100000 8648640",
"output": "348"
},
{
"input": "100000 183783600",
"output": "438"
},
{
"input": "100000 551350800",
"output": "392"
},
{
"input": "40000 551350800",
"output": "150"
},
{
"input": "20000 400000000",
"output": "1"
},
{
"input": "19999 400000000",
"output": "0"
},
{
"input": "19999 399960001",
"output": "1"
},
{
"input": "31621 999887641",
"output": "1"
},
{
"input": "31622 999887641",
"output": "1"
},
{
"input": "31620 999887641",
"output": "0"
},
{
"input": "100000 999887641",
"output": "3"
},
{
"input": "100000 25",
"output": "3"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "100000 3628800",
"output": "220"
},
{
"input": "100000 39916800",
"output": "328"
},
{
"input": "100000 479001600",
"output": "254"
},
{
"input": "4 9",
"output": "1"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "20 100",
"output": "3"
},
{
"input": "10 3",
"output": "2"
},
{
"input": "4 4",
"output": "3"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "89874 1",
"output": "1"
}
] | 1,695,973,130
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 46
| 0
|
a,b=map(int,input().split())
c=0
for x in range(1,a+1):
if b%x==0 and b//x<=a:
c+=1
print(c)
|
Title: Multiplication Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1.
You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
Input Specification:
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
Output Specification:
Print a single number: the number of times *x* occurs in the table.
Demo Input:
['10 5\n', '6 12\n', '5 13\n']
Demo Output:
['2\n', '4\n', '0\n']
Note:
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
|
```python
a,b=map(int,input().split())
c=0
for x in range(1,a+1):
if b%x==0 and b//x<=a:
c+=1
print(c)
```
| 3
|
|
5
|
C
|
Longest Regular Bracket Sequence
|
PROGRAMMING
| 1,900
|
[
"constructive algorithms",
"data structures",
"dp",
"greedy",
"sortings",
"strings"
] |
C. Longest Regular Bracket Sequence
|
2
|
256
|
This is yet another problem dealing with regular bracket sequences.
We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well.
|
The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106.
|
Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1".
|
[
")((())))(()())\n",
"))(\n"
] |
[
"6 2\n",
"0 1\n"
] |
none
| 0
|
[
{
"input": ")((())))(()())",
"output": "6 2"
},
{
"input": "))(",
"output": "0 1"
},
{
"input": "()(())()",
"output": "8 1"
},
{
"input": "((((()(((",
"output": "2 1"
},
{
"input": "))))()())))",
"output": "4 1"
},
{
"input": "(()())()(())()()())())()((()(()(())()()())((()(())()(()()()()))()(())()(((()())()(()((())()(())(()))",
"output": "28 1"
},
{
"input": ")(()(((((())))))(((()))))))((()(((((((())())()))))((((((((())))((((((())))))(()((((()))))(()))))))))",
"output": "68 1"
},
{
"input": "())(((((())())((((()))(())))())())(((()(()()()())(())()))((()(())())()()))()(()())))))(()))((())((((",
"output": "80 1"
},
{
"input": "))(((((((()((((())(((((((((()()))))(()())()((())())))((((()))(()()()))))(()()))())))))((())())()))((",
"output": "92 1"
}
] | 1,638,993,676
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
from collections import deque
s= deque()
nb1=0
nb2=0
c=0
for i in input():
if s and i==')' and (s[-1]=='('):
s.pop()
nb1+=1
nb2= True
else:
s.append(i)
if nb2: c+=1
nb2= False
if nb1==0:print(0,'',1)
else:print(nb1,c)
|
Title: Longest Regular Bracket Sequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
This is yet another problem dealing with regular bracket sequences.
We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well.
Input Specification:
The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1".
Demo Input:
[')((())))(()())\n', '))(\n']
Demo Output:
['6 2\n', '0 1\n']
Note:
none
|
```python
from collections import deque
s= deque()
nb1=0
nb2=0
c=0
for i in input():
if s and i==')' and (s[-1]=='('):
s.pop()
nb1+=1
nb2= True
else:
s.append(i)
if nb2: c+=1
nb2= False
if nb1==0:print(0,'',1)
else:print(nb1,c)
```
| 0
|
332
|
A
|
Down the Hatch!
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Everybody knows that the Berland citizens are keen on health, especially students. Berland students are so tough that all they drink is orange juice!
Yesterday one student, Vasya and his mates made some barbecue and they drank this healthy drink only. After they ran out of the first barrel of juice, they decided to play a simple game. All *n* people who came to the barbecue sat in a circle (thus each person received a unique index *b**i* from 0 to *n*<=-<=1). The person number 0 started the game (this time it was Vasya). All turns in the game were numbered by integers starting from 1. If the *j*-th turn was made by the person with index *b**i*, then this person acted like that:
1. he pointed at the person with index (*b**i*<=+<=1) *mod* *n* either with an elbow or with a nod (*x* *mod* *y* is the remainder after dividing *x* by *y*); 1. if *j*<=≥<=4 and the players who had turns number *j*<=-<=1, *j*<=-<=2, *j*<=-<=3, made during their turns the same moves as player *b**i* on the current turn, then he had drunk a glass of juice; 1. the turn went to person number (*b**i*<=+<=1) *mod* *n*.
The person who was pointed on the last turn did not make any actions.
The problem was, Vasya's drunk too much juice and can't remember the goal of the game. However, Vasya's got the recorded sequence of all the participants' actions (including himself). Now Vasya wants to find out the maximum amount of juice he could drink if he played optimally well (the other players' actions do not change). Help him.
You can assume that in any scenario, there is enough juice for everybody.
|
The first line contains a single integer *n* (4<=≤<=*n*<=≤<=2000) — the number of participants in the game. The second line describes the actual game: the *i*-th character of this line equals 'a', if the participant who moved *i*-th pointed at the next person with his elbow, and 'b', if the participant pointed with a nod. The game continued for at least 1 and at most 2000 turns.
|
Print a single integer — the number of glasses of juice Vasya could have drunk if he had played optimally well.
|
[
"4\nabbba\n",
"4\nabbab\n"
] |
[
"1\n",
"0\n"
] |
In both samples Vasya has got two turns — 1 and 5. In the first sample, Vasya could have drunk a glass of juice during the fifth turn if he had pointed at the next person with a nod. In this case, the sequence of moves would look like "abbbb". In the second sample Vasya wouldn't drink a single glass of juice as the moves performed during turns 3 and 4 are different.
| 500
|
[
{
"input": "4\nabbba",
"output": "1"
},
{
"input": "4\nabbab",
"output": "0"
},
{
"input": "4\naaa",
"output": "0"
},
{
"input": "4\naab",
"output": "0"
},
{
"input": "4\naabaabbba",
"output": "1"
},
{
"input": "6\naaaaaaaaaaaaaaaa",
"output": "2"
},
{
"input": "7\nabbbaaabbbaaaab",
"output": "2"
},
{
"input": "9\naaaabaaaaa",
"output": "1"
},
{
"input": "4\na",
"output": "0"
},
{
"input": "4\nb",
"output": "0"
},
{
"input": "4\nab",
"output": "0"
},
{
"input": "4\nbb",
"output": "0"
},
{
"input": "4\naba",
"output": "0"
},
{
"input": "4\nbbb",
"output": "0"
},
{
"input": "4\nabab",
"output": "0"
},
{
"input": "4\nabaa",
"output": "0"
},
{
"input": "4\nabbbaaabba",
"output": "1"
},
{
"input": "4\nababba",
"output": "0"
},
{
"input": "4\naaaaaa",
"output": "1"
},
{
"input": "5\nbbbbaabaaa",
"output": "0"
},
{
"input": "2000\na",
"output": "0"
},
{
"input": "2000\naabaaabaabababbbbbbabbbbb",
"output": "0"
},
{
"input": "4\nabbb",
"output": "0"
},
{
"input": "5\nbbbbb",
"output": "0"
}
] | 1,658,073,224
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 41
| 124
| 0
|
import sys
input = sys.stdin.readline
n = int(input())
s = input()[:-1]
c = 0
for i in range(len(s))[n::n]:
if s[i-1] == s[i-2] == s[i-3]:
c += 1
print(c)
|
Title: Down the Hatch!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody knows that the Berland citizens are keen on health, especially students. Berland students are so tough that all they drink is orange juice!
Yesterday one student, Vasya and his mates made some barbecue and they drank this healthy drink only. After they ran out of the first barrel of juice, they decided to play a simple game. All *n* people who came to the barbecue sat in a circle (thus each person received a unique index *b**i* from 0 to *n*<=-<=1). The person number 0 started the game (this time it was Vasya). All turns in the game were numbered by integers starting from 1. If the *j*-th turn was made by the person with index *b**i*, then this person acted like that:
1. he pointed at the person with index (*b**i*<=+<=1) *mod* *n* either with an elbow or with a nod (*x* *mod* *y* is the remainder after dividing *x* by *y*); 1. if *j*<=≥<=4 and the players who had turns number *j*<=-<=1, *j*<=-<=2, *j*<=-<=3, made during their turns the same moves as player *b**i* on the current turn, then he had drunk a glass of juice; 1. the turn went to person number (*b**i*<=+<=1) *mod* *n*.
The person who was pointed on the last turn did not make any actions.
The problem was, Vasya's drunk too much juice and can't remember the goal of the game. However, Vasya's got the recorded sequence of all the participants' actions (including himself). Now Vasya wants to find out the maximum amount of juice he could drink if he played optimally well (the other players' actions do not change). Help him.
You can assume that in any scenario, there is enough juice for everybody.
Input Specification:
The first line contains a single integer *n* (4<=≤<=*n*<=≤<=2000) — the number of participants in the game. The second line describes the actual game: the *i*-th character of this line equals 'a', if the participant who moved *i*-th pointed at the next person with his elbow, and 'b', if the participant pointed with a nod. The game continued for at least 1 and at most 2000 turns.
Output Specification:
Print a single integer — the number of glasses of juice Vasya could have drunk if he had played optimally well.
Demo Input:
['4\nabbba\n', '4\nabbab\n']
Demo Output:
['1\n', '0\n']
Note:
In both samples Vasya has got two turns — 1 and 5. In the first sample, Vasya could have drunk a glass of juice during the fifth turn if he had pointed at the next person with a nod. In this case, the sequence of moves would look like "abbbb". In the second sample Vasya wouldn't drink a single glass of juice as the moves performed during turns 3 and 4 are different.
|
```python
import sys
input = sys.stdin.readline
n = int(input())
s = input()[:-1]
c = 0
for i in range(len(s))[n::n]:
if s[i-1] == s[i-2] == s[i-3]:
c += 1
print(c)
```
| 3
|
|
94
|
A
|
Restoring Password
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Restoring Password
|
2
|
256
|
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
|
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
|
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
|
[
"01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n",
"10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n"
] |
[
"12345678\n",
"30234919\n"
] |
none
| 500
|
[
{
"input": "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110",
"output": "12345678"
},
{
"input": "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000",
"output": "30234919"
},
{
"input": "00010101101110110101100110101100010101100010101111000101011010011010110010000011\n0101010110\n0001001101\n1001101011\n0000100011\n0010101111\n1110110101\n0001010110\n0110111000\n0000111110\n0010000011",
"output": "65264629"
},
{
"input": "10100100010010010011011001101000100100110110011010011001101011000100110110011010\n1111110011\n1001000111\n1001000100\n1100010011\n0110011010\n0010000001\n1110101110\n0010000110\n0010010011\n1010010001",
"output": "98484434"
},
{
"input": "00101100011111010001001000000110110000000110010011001111111010110010001011000000\n0010000001\n0110010011\n0010000010\n1011001000\n0011111110\n0110001000\n1111010001\n1011000000\n0000100110\n0010110001",
"output": "96071437"
},
{
"input": "10001110111110000001000010001010001110110000100010100010111101101101010000100010\n0000010110\n1101010111\n1000101111\n0001011110\n0011110101\n0101100100\n0110110101\n0000100010\n1000111011\n1110000001",
"output": "89787267"
},
{
"input": "10010100011001010001010101001101010100110100111011001010111100011001000010100000\n0011100000\n1001100100\n0001100100\n0010100000\n0101010011\n0010101110\n0010101111\n0100111011\n1001010001\n1111111110",
"output": "88447623"
},
{
"input": "01101100111000000101011011001110000001011111111000111111100001011010001001011001\n1000000101\n0101101000\n0101110101\n1101011110\n0000101100\n1111111000\n0001001101\n0110111011\n0110110011\n1001011001",
"output": "80805519"
},
{
"input": "11100011000100010110010011101010101010011110001100011010111110011000011010110111\n1110001100\n0110101111\n0100111010\n0101000000\n1001100001\n1010101001\n0000100010\n1010110111\n1100011100\n0100010110",
"output": "09250147"
},
{
"input": "10000110110000010100000010001000111101110110101011110111000100001101000000100010\n0000010100\n0000110001\n0110101011\n1101110001\n1000011011\n0000110100\n0011110111\n1000110010\n0000100010\n0000011011",
"output": "40862358"
},
{
"input": "01000000010000000110100101000110110000100100000001101100001000011111111001010001\n1011000010\n1111101010\n0111110011\n0000000110\n0000001001\n0001111111\n0110010010\n0100000001\n1011001000\n1001010001",
"output": "73907059"
},
{
"input": "01111000111110011001110101110011110000111110010001101100110110100111101011001101\n1110010001\n1001100000\n1100001000\n1010011110\n1011001101\n0111100011\n1101011100\n1110011001\n1111000011\n0010000101",
"output": "57680434"
},
{
"input": "01001100101000100010001011110001000101001001100010010000001001001100101001011111\n1001011111\n1110010111\n0111101011\n1000100010\n0011100101\n0100000010\n0010111100\n0100010100\n1001100010\n0100110010",
"output": "93678590"
},
{
"input": "01110111110000111011101010110110101011010100110111000011101101110101011101001000\n0110000101\n1010101101\n1101010111\n1101011100\n0100110111\n0111011111\n1100011001\n0111010101\n0000111011\n1101001000",
"output": "58114879"
},
{
"input": "11101001111100110101110011010100110011011110100111010110110011000111000011001101\n1100011100\n1100110101\n1011101000\n0011011110\n0011001101\n0100010001\n1110100111\n1010101100\n1110110100\n0101101100",
"output": "61146904"
},
{
"input": "10101010001011010001001001011000100101100001011011101010101110101010001010101000\n0010110101\n1010011010\n1010101000\n1011010001\n1010101011\n0010010110\n0110100010\n1010100101\n0001011011\n0110100001",
"output": "23558422"
},
{
"input": "11110101001100010000110100001110101011011111010100110001000001001010001001101111\n0101101100\n1001101111\n1010101101\n0100101000\n1111110000\n0101010010\n1100010000\n1111010100\n1101000011\n1011111111",
"output": "76827631"
},
{
"input": "10001100110000110111100011001101111110110011110101000011011100001101110000110111\n0011110101\n0101100011\n1000110011\n1011011001\n0111111011\n0101111011\n0000110111\n0100001110\n1000000111\n0110110111",
"output": "26240666"
},
{
"input": "10000100010000111101100100111101111011101000001001100001000110000010010000111101\n1001001111\n0000111101\n1000010001\n0110011101\n0110101000\n1011111001\n0111101110\n1000001001\n1101011111\n0001010100",
"output": "21067271"
},
{
"input": "01101111000110111100011011110001101111001010001100101000110001010101100100000010\n1010001100\n0011010011\n0101010110\n1111001100\n1100011000\n0100101100\n1001100101\n0110111100\n0011001101\n0100000010",
"output": "77770029"
},
{
"input": "10100111011010001011111000000111100000010101000011000010111101010000111010011101\n1010011101\n1010111111\n0110100110\n1111000100\n1110000001\n0000101111\n0011111000\n1000110001\n0101000011\n1010001011",
"output": "09448580"
},
{
"input": "10000111111000011111001010101010010011111001001111000010010100100011000010001100\n1101101110\n1001001111\n0000100101\n1100111010\n0010101010\n1110000110\n1100111101\n0010001100\n1110000001\n1000011111",
"output": "99411277"
},
{
"input": "10110110111011001111101100111100111111011011011011001111110110010011100010000111\n0111010011\n0111101100\n1001101010\n0101000101\n0010000111\n0011111101\n1011001111\n1101111000\n1011011011\n1001001110",
"output": "86658594"
},
{
"input": "01001001100101100011110110111100000110001111001000100000110111110010000000011000\n0100100110\n1000001011\n1000111110\n0000011000\n0101100011\n1101101111\n1111001000\n1011011001\n1000001101\n0010101000",
"output": "04536863"
},
{
"input": "10010100011101000011100100001100101111000010111100000010010000001001001101011101\n1001000011\n1101000011\n1001010001\n1101011101\n1000010110\n0011111101\n0010111100\n0000100100\n1010001000\n0101000110",
"output": "21066773"
},
{
"input": "01111111110101111111011111111111010010000001100000101000100100111001011010001001\n0111111111\n0101111111\n0100101101\n0001100000\n0011000101\n0011100101\n1101001000\n0010111110\n1010001001\n1111000111",
"output": "01063858"
},
{
"input": "00100011111001001010001111000011101000001110100000000100101011101000001001001010\n0010001111\n1001001010\n1010011001\n0011100111\n1000111000\n0011110000\n0000100010\n0001001010\n1111110111\n1110100000",
"output": "01599791"
},
{
"input": "11011101000100110100110011010101100011111010011010010011010010010010100110101111\n0100110100\n1001001010\n0001111101\n1101011010\n1101110100\n1100110101\n0110101111\n0110001111\n0001101000\n1010011010",
"output": "40579016"
},
{
"input": "10000010111101110110011000111110000011100110001111100100000111000011011000001011\n0111010100\n1010110110\n1000001110\n1110000100\n0110001111\n1101110110\n1100001101\n1000001011\n0000000101\n1001000001",
"output": "75424967"
},
{
"input": "11101100101110111110111011111010001111111111000001001001000010001111111110110010\n0101100001\n1111010011\n1110111110\n0100110100\n1110011111\n1000111111\n0010010000\n1110110010\n0011000010\n1111000001",
"output": "72259657"
},
{
"input": "01011110100101111010011000001001100000101001110011010111101011010000110110010101\n0100111100\n0101110011\n0101111010\n0110000010\n0101001111\n1101000011\n0110010101\n0111011010\n0001101110\n1001110011",
"output": "22339256"
},
{
"input": "01100000100101111000100001100010000110000010100100100001100000110011101001110000\n0101111000\n1001110000\n0001000101\n0110110111\n0010100100\n1000011000\n1101110110\n0110000010\n0001011010\n0011001110",
"output": "70554591"
},
{
"input": "11110011011000001001111100110101001000010100100000110011001110011111100100100001\n1010011000\n1111001101\n0100100001\n1111010011\n0100100000\n1001111110\n1010100111\n1000100111\n1000001001\n1100110011",
"output": "18124952"
},
{
"input": "10001001011000100101010110011101011001110010000001010110000101000100101111101010\n0101100001\n1100001100\n1111101010\n1000100101\n0010000001\n0100010010\n0010110110\n0101100111\n0000001110\n1101001110",
"output": "33774052"
},
{
"input": "00110010000111001001001100100010010111101011011110001011111100000101000100000001\n0100000001\n1011011110\n0010111111\n0111100111\n0100111001\n0000010100\n1001011110\n0111001001\n0100010011\n0011001000",
"output": "97961250"
},
{
"input": "01101100001000110101101100101111101110010011010111100011010100010001101000110101\n1001101001\n1000110101\n0110110000\n0111100100\n0011010111\n1110111001\n0001000110\n0000000100\n0001101001\n1011001011",
"output": "21954161"
},
{
"input": "10101110000011010110101011100000101101000110100000101101101101110101000011110010\n0110100000\n1011011011\n0011110010\n0001110110\n0010110100\n1100010010\n0001101011\n1010111000\n0011010110\n0111010100",
"output": "78740192"
},
{
"input": "11000101011100100111010000010001000001001100101100000011000000001100000101011010\n1100010101\n1111101011\n0101011010\n0100000100\n1000110111\n1100100111\n1100101100\n0111001000\n0000110000\n0110011111",
"output": "05336882"
},
{
"input": "11110100010000101110010110001000001011100101100010110011011011111110001100110110\n0101100010\n0100010001\n0000101110\n1100110110\n0101000101\n0011001011\n1111010001\n1000110010\n1111111000\n1010011111",
"output": "62020383"
},
{
"input": "00011001111110000011101011010001010111100110100101000110011111011001100000001100\n0111001101\n0101011110\n0001100111\n1101011111\n1110000011\n0000001100\n0111010001\n1101100110\n1010110100\n0110100101",
"output": "24819275"
},
{
"input": "10111110010011111001001111100101010111010011111001001110101000111110011001111101\n0011111001\n0101011101\n0100001010\n0001110010\n1001111101\n0011101010\n1111001001\n1100100001\n1001101000\n1011111001",
"output": "90010504"
},
{
"input": "01111101111100101010001001011110111001110111110111011111011110110111111011011111\n1111110111\n0010000101\n0110000100\n0111111011\n1011100111\n1100101010\n1011011111\n1100010001\n0111110111\n0010010111",
"output": "85948866"
},
{
"input": "01111100000111110000110010111001111100001001101010110010111010001000101001101010\n0100010101\n1011110101\n1010100100\n1010000001\n1001101010\n0101100110\n1000100010\n0111110000\n1100101110\n0110010110",
"output": "77874864"
},
{
"input": "11100011010000000010011110010111001011111001000111000000001000000000100111100101\n0000000010\n1110001101\n0011010101\n0111100101\n1001000111\n1101001111\n0111010110\n1100101111\n0110000000\n1101101011",
"output": "10374003"
},
{
"input": "01111011100111101110011001000110001111101000111110100100100001011111001011100010\n0110010100\n1100010001\n0111101110\n1001001000\n1010011011\n1000111110\n0010110101\n1011100010\n0101111100\n0110010001",
"output": "22955387"
},
{
"input": "11011010001100000011000100110011010101000110011110110000001100111100001000011111\n0000100010\n1000011111\n1101101000\n0110011110\n0011110000\n1100000011\n0010001100\n0101101000\n0001001100\n1101010100",
"output": "25893541"
},
{
"input": "01011001011111010010101111011001000011001100011101101111011011010011101011110110\n0100001100\n0101100101\n1111111011\n1111010010\n1111101100\n1100011101\n1011000011\n1101001110\n1011110110\n0110001010",
"output": "13805878"
},
{
"input": "11110011011000111111001100111110001111111100000010111100110100110011111111001101\n1111001101\n1001101010\n1100110010\n0011001111\n0001011110\n1000110011\n1000111111\n0110001010\n1001011101\n1100000010",
"output": "06369030"
},
{
"input": "01110011110010000011011001011000001000010110010110011001100001100110001100101000\n0000100001\n0110011000\n1010000010\n1110011101\n0111001111\n1100101000\n0010000011\n0110010000\n1100100101\n0110010110",
"output": "46909115"
},
{
"input": "00001011001111110111111111011111111101110101110100010111010010100101100001010110\n1111110111\n0001010110\n0111011011\n0111000001\n1010010110\n0101110100\n0001000101\n0000111000\n0110100001\n0000101100",
"output": "90005541"
}
] | 1,678,021,795
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 50
| 124
| 0
|
password=input();nums=[];ans=''
for i in range(10):num=input();nums.append(num)
for i in range(0,80,10):ans+=str(nums.index(password[i:i+10]))
print(ans)
|
Title: Restoring Password
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
Input Specification:
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
Output Specification:
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
Demo Input:
['01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n', '10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n']
Demo Output:
['12345678\n', '30234919\n']
Note:
none
|
```python
password=input();nums=[];ans=''
for i in range(10):num=input();nums.append(num)
for i in range(0,80,10):ans+=str(nums.index(password[i:i+10]))
print(ans)
```
| 3.969
|
735
|
B
|
Urbanization
|
PROGRAMMING
| 1,100
|
[
"greedy",
"number theory",
"sortings"
] | null | null |
Local authorities have heard a lot about combinatorial abilities of Ostap Bender so they decided to ask his help in the question of urbanization. There are *n* people who plan to move to the cities. The wealth of the *i* of them is equal to *a**i*. Authorities plan to build two cities, first for *n*1 people and second for *n*2 people. Of course, each of *n* candidates can settle in only one of the cities. Thus, first some subset of candidates of size *n*1 settle in the first city and then some subset of size *n*2 is chosen among the remaining candidates and the move to the second city. All other candidates receive an official refuse and go back home.
To make the statistic of local region look better in the eyes of their bosses, local authorities decided to pick subsets of candidates in such a way that the sum of arithmetic mean of wealth of people in each of the cities is as large as possible. Arithmetic mean of wealth in one city is the sum of wealth *a**i* among all its residents divided by the number of them (*n*1 or *n*2 depending on the city). The division should be done in real numbers without any rounding.
Please, help authorities find the optimal way to pick residents for two cities.
|
The first line of the input contains three integers *n*, *n*1 and *n*2 (1<=≤<=*n*,<=*n*1,<=*n*2<=≤<=100<=000, *n*1<=+<=*n*2<=≤<=*n*) — the number of candidates who want to move to the cities, the planned number of residents of the first city and the planned number of residents of the second city.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000), the *i*-th of them is equal to the wealth of the *i*-th candidate.
|
Print one real value — the maximum possible sum of arithmetic means of wealth of cities' residents. You answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
|
[
"2 1 1\n1 5\n",
"4 2 1\n1 4 2 3\n"
] |
[
"6.00000000\n",
"6.50000000\n"
] |
In the first sample, one of the optimal solutions is to move candidate 1 to the first city and candidate 2 to the second.
In the second sample, the optimal solution is to pick candidates 3 and 4 for the first city, and candidate 2 for the second one. Thus we obtain (*a*<sub class="lower-index">3</sub> + *a*<sub class="lower-index">4</sub>) / 2 + *a*<sub class="lower-index">2</sub> = (3 + 2) / 2 + 4 = 6.5
| 1,000
|
[
{
"input": "2 1 1\n1 5",
"output": "6.00000000"
},
{
"input": "4 2 1\n1 4 2 3",
"output": "6.50000000"
},
{
"input": "3 1 2\n1 2 3",
"output": "4.50000000"
},
{
"input": "10 4 6\n3 5 7 9 12 25 67 69 83 96",
"output": "88.91666667"
},
{
"input": "19 7 12\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 100000 100000",
"output": "47052.10714286"
},
{
"input": "100 9 6\n109 711 40 95 935 48 228 253 308 726 816 534 252 8 966 363 162 508 84 83 807 506 748 178 45 30 106 108 764 698 825 198 336 353 158 790 64 262 403 334 577 571 742 541 946 602 279 621 910 776 421 886 29 133 114 394 762 965 339 263 750 530 49 80 124 31 322 292 27 590 960 278 111 932 849 491 561 744 469 511 106 271 156 160 836 363 149 473 457 543 976 809 490 29 85 626 265 88 995 946",
"output": "1849.66666667"
},
{
"input": "69 6 63\n53475 22876 79144 6335 33763 79104 65441 45527 65847 94406 74670 43529 75330 19403 67629 56187 57949 23071 64910 54409 55348 18056 855 24961 50565 6622 26467 33989 22660 79469 41246 13965 79706 14422 16075 93378 81313 48173 13470 97348 2346 27452 59427 29925 29847 73823 32021 10988 24609 98855 90919 45939 17203 8439 43007 40138 55693 30314 71734 33458 66850 4011 20089 20546 92090 50842 78859 62756 40177",
"output": "135712.88888889"
},
{
"input": "69 6 9\n2612 17461 69001 33130 10662 85485 88195 45974 16712 81365 67119 87797 15559 20197 74716 92979 97268 49466 68603 48351 99905 35606 54242 98603 68232 54398 82637 49647 38979 46171 54680 23334 15892 92186 69670 29711 67999 2220 32317 717 70667 68262 86760 55720 97158 61122 7251 138 21022 27197 12691 59331 13576 66999 38332 13574 83484 66646 17704 33065 98583 80259 64631 16745 69431 40747 82089 82788 32739",
"output": "183129.44444444"
}
] | 1,596,738,661
| 6,781
|
PyPy 3
|
OK
|
TESTS
| 37
| 202
| 30,720,000
|
n,n1,n2=map(int ,input().split());
l=list(map(int,input().split()));
l.sort(reverse=True)
n1,n2=max(n1,n2),min(n1,n2);
s1=0
s2=0
for i in range(n2):
s1+=l[i]
for i in range(n2,n1+n2):
s2+=l[i]
print(s1/n2+s2/n1)
|
Title: Urbanization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Local authorities have heard a lot about combinatorial abilities of Ostap Bender so they decided to ask his help in the question of urbanization. There are *n* people who plan to move to the cities. The wealth of the *i* of them is equal to *a**i*. Authorities plan to build two cities, first for *n*1 people and second for *n*2 people. Of course, each of *n* candidates can settle in only one of the cities. Thus, first some subset of candidates of size *n*1 settle in the first city and then some subset of size *n*2 is chosen among the remaining candidates and the move to the second city. All other candidates receive an official refuse and go back home.
To make the statistic of local region look better in the eyes of their bosses, local authorities decided to pick subsets of candidates in such a way that the sum of arithmetic mean of wealth of people in each of the cities is as large as possible. Arithmetic mean of wealth in one city is the sum of wealth *a**i* among all its residents divided by the number of them (*n*1 or *n*2 depending on the city). The division should be done in real numbers without any rounding.
Please, help authorities find the optimal way to pick residents for two cities.
Input Specification:
The first line of the input contains three integers *n*, *n*1 and *n*2 (1<=≤<=*n*,<=*n*1,<=*n*2<=≤<=100<=000, *n*1<=+<=*n*2<=≤<=*n*) — the number of candidates who want to move to the cities, the planned number of residents of the first city and the planned number of residents of the second city.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000), the *i*-th of them is equal to the wealth of the *i*-th candidate.
Output Specification:
Print one real value — the maximum possible sum of arithmetic means of wealth of cities' residents. You answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
Demo Input:
['2 1 1\n1 5\n', '4 2 1\n1 4 2 3\n']
Demo Output:
['6.00000000\n', '6.50000000\n']
Note:
In the first sample, one of the optimal solutions is to move candidate 1 to the first city and candidate 2 to the second.
In the second sample, the optimal solution is to pick candidates 3 and 4 for the first city, and candidate 2 for the second one. Thus we obtain (*a*<sub class="lower-index">3</sub> + *a*<sub class="lower-index">4</sub>) / 2 + *a*<sub class="lower-index">2</sub> = (3 + 2) / 2 + 4 = 6.5
|
```python
n,n1,n2=map(int ,input().split());
l=list(map(int,input().split()));
l.sort(reverse=True)
n1,n2=max(n1,n2),min(n1,n2);
s1=0
s2=0
for i in range(n2):
s1+=l[i]
for i in range(n2,n1+n2):
s2+=l[i]
print(s1/n2+s2/n1)
```
| 3
|
|
797
|
D
|
Broken BST
|
PROGRAMMING
| 2,100
|
[
"data structures",
"dfs and similar"
] | null | null |
Let *T* be arbitrary binary tree — tree, every vertex of which has no more than two children. Given tree is rooted, so there exists only one vertex which doesn't have a parent — it's the root of a tree. Every vertex has an integer number written on it. Following algorithm is run on every value from the tree *T*:
1. Set pointer to the root of a tree. 1. Return success if the value in the current vertex is equal to the number you are looking for 1. Go to the left child of the vertex if the value in the current vertex is greater than the number you are looking for 1. Go to the right child of the vertex if the value in the current vertex is less than the number you are looking for 1. Return fail if you try to go to the vertex that doesn't exist
Here is the pseudo-code of the described algorithm:
The described algorithm works correctly if the tree is binary search tree (i.e. for each node the values of left subtree are less than the value in the node, the values of right subtree are greater than the value in the node). But it can return invalid result if tree is not a binary search tree.
Since the given tree is not necessarily a binary search tree, not all numbers can be found this way. Your task is to calculate, how many times the search will fail being running on every value from the tree.
If the tree has multiple vertices with the same values on them then you should run algorithm on every one of them separately.
|
First line contains integer number *n* (1<=≤<=*n*<=≤<=105) — number of vertices in the tree.
Each of the next *n* lines contains 3 numbers *v*, *l*, *r* (0<=≤<=*v*<=≤<=109) — value on current vertex, index of the left child of the vertex and index of the right child of the vertex, respectively. If some child doesn't exist then number <=-<=1 is set instead. Note that different vertices of the tree may contain the same values.
|
Print number of times when search algorithm will fail.
|
[
"3\n15 -1 -1\n10 1 3\n5 -1 -1\n",
"8\n6 2 3\n3 4 5\n12 6 7\n1 -1 8\n4 -1 -1\n5 -1 -1\n14 -1 -1\n2 -1 -1\n"
] |
[
"2\n",
"1\n"
] |
In the example the root of the tree in vertex 2. Search of numbers 5 and 15 will return fail because on the first step algorithm will choose the subtree which doesn't contain numbers you are looking for.
| 0
|
[
{
"input": "3\n15 -1 -1\n10 1 3\n5 -1 -1",
"output": "2"
},
{
"input": "8\n6 2 3\n3 4 5\n12 6 7\n1 -1 8\n4 -1 -1\n5 -1 -1\n14 -1 -1\n2 -1 -1",
"output": "1"
},
{
"input": "1\n493041212 -1 -1",
"output": "0"
},
{
"input": "10\n921294733 5 9\n341281094 -1 -1\n35060484 10 -1\n363363160 -1 -1\n771156014 6 8\n140806462 -1 -1\n118732846 4 2\n603229555 -1 -1\n359289513 3 7\n423237010 -1 -1",
"output": "7"
},
{
"input": "10\n911605217 -1 -1\n801852416 -1 -1\n140035920 -1 9\n981454947 10 2\n404988051 6 3\n307545107 8 7\n278188888 4 1\n523010786 -1 -1\n441817740 -1 -1\n789680429 -1 -1",
"output": "7"
},
{
"input": "10\n921072710 6 8\n727122964 -1 -1\n248695736 2 -1\n947477665 -1 -1\n41229309 -1 -1\n422047611 3 9\n424558429 -1 4\n665046372 -1 5\n74510531 -1 -1\n630373520 7 1",
"output": "7"
},
{
"input": "1\n815121916 -1 -1",
"output": "0"
},
{
"input": "1\n901418150 -1 -1",
"output": "0"
},
{
"input": "3\n2 -1 -1\n1 1 3\n2 -1 -1",
"output": "0"
},
{
"input": "4\n20 2 3\n16 4 -1\n20 -1 -1\n20 -1 -1",
"output": "0"
},
{
"input": "3\n2 2 3\n1 -1 -1\n1 -1 -1",
"output": "0"
},
{
"input": "4\n7122 2 3\n87 4 -1\n7122 -1 -1\n7122 -1 -1",
"output": "0"
},
{
"input": "4\n712222 2 3\n98887 4 -1\n712222 -1 -1\n712222 -1 -1",
"output": "0"
},
{
"input": "3\n6 2 3\n5 -1 -1\n5 -1 -1",
"output": "0"
},
{
"input": "4\n1 -1 2\n0 3 -1\n100 -1 4\n1 -1 -1",
"output": "2"
},
{
"input": "4\n98 2 3\n95 4 -1\n98 -1 -1\n98 -1 -1",
"output": "0"
},
{
"input": "3\n15 2 3\n1 -1 -1\n1 -1 -1",
"output": "0"
},
{
"input": "4\n6 2 -1\n6 3 4\n6 -1 -1\n7 -1 -1",
"output": "1"
},
{
"input": "3\n2 2 3\n3 -1 -1\n3 -1 -1",
"output": "0"
},
{
"input": "4\n1 -1 2\n0 3 -1\n1 -1 4\n0 -1 -1",
"output": "2"
},
{
"input": "4\n1 2 3\n2 -1 -1\n3 4 -1\n2 -1 -1",
"output": "0"
},
{
"input": "1\n0 -1 -1",
"output": "0"
},
{
"input": "3\n5 2 -1\n6 -1 3\n5 -1 -1",
"output": "1"
},
{
"input": "10\n2 -1 -1\n1 -1 8\n2 4 9\n5 -1 2\n5 7 6\n1 -1 1\n4 -1 -1\n0 -1 -1\n8 5 10\n5 -1 -1",
"output": "3"
},
{
"input": "8\n6 -1 -1\n0 5 -1\n4 6 7\n3 -1 -1\n4 3 1\n1 -1 -1\n2 8 4\n2 -1 -1",
"output": "7"
},
{
"input": "4\n5 3 -1\n1 4 -1\n3 -1 2\n1 -1 -1",
"output": "2"
},
{
"input": "3\n10 2 3\n5 -1 -1\n5 -1 -1",
"output": "0"
}
] | 1,675,146,125
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 28
| 888
| 31,232,000
|
from collections import defaultdict
import sys
class Node:
def __init__(self, val):
self.val = val
self.left = None
self.right = None
n = int(input())
m = defaultdict(list)
cnt = defaultdict(int)
for i in range(n):
val, left, right = list(map(int, input().split()))
node = Node(val)
cnt[val] += 1
m[i + 1] = [node, left, right]
noParent = set([i for i in range(1, n+1)])
for i, li in m.items():
node, left, right = li
if left != -1:
node.left = m[left][0]
noParent.remove(left)
if right != -1:
node.right = m[right][0]
noParent.remove(right)
root = m[list(noParent)[0]][0]
ans = n
def dfs(node, left, right):
global ans
if not node: return
if left <= node.val and node.val <= right:
ans -= cnt[node.val]
if left < node.val:
dfs(node.left, left, min(node.val - 1, right))
if right > node.val:
dfs(node.right, max(left, node.val + 1), right)
dfs(root, 0, sys.maxsize)
print(ans)
|
Title: Broken BST
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let *T* be arbitrary binary tree — tree, every vertex of which has no more than two children. Given tree is rooted, so there exists only one vertex which doesn't have a parent — it's the root of a tree. Every vertex has an integer number written on it. Following algorithm is run on every value from the tree *T*:
1. Set pointer to the root of a tree. 1. Return success if the value in the current vertex is equal to the number you are looking for 1. Go to the left child of the vertex if the value in the current vertex is greater than the number you are looking for 1. Go to the right child of the vertex if the value in the current vertex is less than the number you are looking for 1. Return fail if you try to go to the vertex that doesn't exist
Here is the pseudo-code of the described algorithm:
The described algorithm works correctly if the tree is binary search tree (i.e. for each node the values of left subtree are less than the value in the node, the values of right subtree are greater than the value in the node). But it can return invalid result if tree is not a binary search tree.
Since the given tree is not necessarily a binary search tree, not all numbers can be found this way. Your task is to calculate, how many times the search will fail being running on every value from the tree.
If the tree has multiple vertices with the same values on them then you should run algorithm on every one of them separately.
Input Specification:
First line contains integer number *n* (1<=≤<=*n*<=≤<=105) — number of vertices in the tree.
Each of the next *n* lines contains 3 numbers *v*, *l*, *r* (0<=≤<=*v*<=≤<=109) — value on current vertex, index of the left child of the vertex and index of the right child of the vertex, respectively. If some child doesn't exist then number <=-<=1 is set instead. Note that different vertices of the tree may contain the same values.
Output Specification:
Print number of times when search algorithm will fail.
Demo Input:
['3\n15 -1 -1\n10 1 3\n5 -1 -1\n', '8\n6 2 3\n3 4 5\n12 6 7\n1 -1 8\n4 -1 -1\n5 -1 -1\n14 -1 -1\n2 -1 -1\n']
Demo Output:
['2\n', '1\n']
Note:
In the example the root of the tree in vertex 2. Search of numbers 5 and 15 will return fail because on the first step algorithm will choose the subtree which doesn't contain numbers you are looking for.
|
```python
from collections import defaultdict
import sys
class Node:
def __init__(self, val):
self.val = val
self.left = None
self.right = None
n = int(input())
m = defaultdict(list)
cnt = defaultdict(int)
for i in range(n):
val, left, right = list(map(int, input().split()))
node = Node(val)
cnt[val] += 1
m[i + 1] = [node, left, right]
noParent = set([i for i in range(1, n+1)])
for i, li in m.items():
node, left, right = li
if left != -1:
node.left = m[left][0]
noParent.remove(left)
if right != -1:
node.right = m[right][0]
noParent.remove(right)
root = m[list(noParent)[0]][0]
ans = n
def dfs(node, left, right):
global ans
if not node: return
if left <= node.val and node.val <= right:
ans -= cnt[node.val]
if left < node.val:
dfs(node.left, left, min(node.val - 1, right))
if right > node.val:
dfs(node.right, max(left, node.val + 1), right)
dfs(root, 0, sys.maxsize)
print(ans)
```
| -1
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,698,080,209
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
n = int(input())
subjects = []
for _ in range(n):
s1, s2, s3 = map(int, input().split())
subjects.append((s1, s2, s3))
cannot_solve_alone = 0
for s1, s2, s3 in subjects:
if s1 == 0 and s2 == 1:
cannot_solve_alone += 1
can_solve = n - cannot_solve_alone
print(can_solve)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
n = int(input())
subjects = []
for _ in range(n):
s1, s2, s3 = map(int, input().split())
subjects.append((s1, s2, s3))
cannot_solve_alone = 0
for s1, s2, s3 in subjects:
if s1 == 0 and s2 == 1:
cannot_solve_alone += 1
can_solve = n - cannot_solve_alone
print(can_solve)
```
| 0
|
|
886
|
E
|
Maximum Element
|
PROGRAMMING
| 2,400
|
[
"combinatorics",
"dp",
"math"
] | null | null |
One day Petya was solving a very interesting problem. But although he used many optimization techniques, his solution still got Time limit exceeded verdict. Petya conducted a thorough analysis of his program and found out that his function for finding maximum element in an array of *n* positive integers was too slow. Desperate, Petya decided to use a somewhat unexpected optimization using parameter *k*, so now his function contains the following code:
That way the function iteratively checks array elements, storing the intermediate maximum, and if after *k* consecutive iterations that maximum has not changed, it is returned as the answer.
Now Petya is interested in fault rate of his function. He asked you to find the number of permutations of integers from 1 to *n* such that the return value of his function on those permutations is not equal to *n*. Since this number could be very big, output the answer modulo 109<=+<=7.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=106), separated by a space — the length of the permutations and the parameter *k*.
|
Output the answer to the problem modulo 109<=+<=7.
|
[
"5 2\n",
"5 3\n",
"6 3\n"
] |
[
"22\n",
"6\n",
"84\n"
] |
Permutations from second example:
[4, 1, 2, 3, 5], [4, 1, 3, 2, 5], [4, 2, 1, 3, 5], [4, 2, 3, 1, 5], [4, 3, 1, 2, 5], [4, 3, 2, 1, 5].
| 2,500
|
[
{
"input": "5 2",
"output": "22"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "6 3",
"output": "84"
},
{
"input": "5 10",
"output": "0"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "2 1",
"output": "0"
},
{
"input": "2 2",
"output": "0"
},
{
"input": "3 1",
"output": "1"
},
{
"input": "3 2",
"output": "0"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "4 1",
"output": "8"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "4 3",
"output": "0"
},
{
"input": "4 4",
"output": "0"
},
{
"input": "5 1",
"output": "55"
},
{
"input": "5 4",
"output": "0"
},
{
"input": "5 5",
"output": "0"
},
{
"input": "1000000 500000",
"output": "900097839"
},
{
"input": "1000000 1000000",
"output": "0"
},
{
"input": "1000000 1",
"output": "131797017"
},
{
"input": "1 1000000",
"output": "0"
},
{
"input": "959139 199252",
"output": "770937198"
},
{
"input": "9859 748096",
"output": "0"
},
{
"input": "125987 264237",
"output": "0"
},
{
"input": "209411 813081",
"output": "0"
},
{
"input": "325539 329221",
"output": "0"
},
{
"input": "376259 910770",
"output": "0"
},
{
"input": "492387 235422",
"output": "249147139"
},
{
"input": "608515 751563",
"output": "0"
},
{
"input": "691939 300407",
"output": "700547157"
},
{
"input": "30518 196518",
"output": "0"
},
{
"input": "146646 521171",
"output": "0"
},
{
"input": "230070 37311",
"output": "993306535"
},
{
"input": "313494 586155",
"output": "0"
},
{
"input": "396918 167704",
"output": "943821934"
},
{
"input": "513046 683844",
"output": "0"
},
{
"input": "629174 232688",
"output": "831745227"
},
{
"input": "679894 524637",
"output": "655418678"
},
{
"input": "796022 73481",
"output": "883548575"
},
{
"input": "879446 655030",
"output": "563982505"
},
{
"input": "405440 588704",
"output": "0"
}
] | 1,626,303,337
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 14
| 108
| 15,052,800
|
import math
n, k = map(int,input().split())
def mod(n):
return n%1000000007
def variacion(n, p):
s=1
for i in range(n-p+1,n+1):
s = mod(s*mod(i))
return s
factoriales=[0]*1000000
factoriales[0]=1
mask=[False]*1000000
mask[0]=True
ultimo_factorial=0
def factorial(n):
if n==0:
return 1
if mask[n-1]:
return factoriales[n-1]
for i in range(ultimo_factorial+1,n+1):
factoriales[i] = mod(factoriales[i-1]*(i+1))
mask[i]=True
return factoriales[n-1]
def fallos(n,k):
s=0
for q in range(k+1,n):
parcial=0
for i in range(q-k):
parcial+=mod(factorial(i)*factorial(n-k-i-1))
s+=mod(mod(parcial)*variacion(q-1,k))
return s
print(fallos(n,k))
|
Title: Maximum Element
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Petya was solving a very interesting problem. But although he used many optimization techniques, his solution still got Time limit exceeded verdict. Petya conducted a thorough analysis of his program and found out that his function for finding maximum element in an array of *n* positive integers was too slow. Desperate, Petya decided to use a somewhat unexpected optimization using parameter *k*, so now his function contains the following code:
That way the function iteratively checks array elements, storing the intermediate maximum, and if after *k* consecutive iterations that maximum has not changed, it is returned as the answer.
Now Petya is interested in fault rate of his function. He asked you to find the number of permutations of integers from 1 to *n* such that the return value of his function on those permutations is not equal to *n*. Since this number could be very big, output the answer modulo 109<=+<=7.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=106), separated by a space — the length of the permutations and the parameter *k*.
Output Specification:
Output the answer to the problem modulo 109<=+<=7.
Demo Input:
['5 2\n', '5 3\n', '6 3\n']
Demo Output:
['22\n', '6\n', '84\n']
Note:
Permutations from second example:
[4, 1, 2, 3, 5], [4, 1, 3, 2, 5], [4, 2, 1, 3, 5], [4, 2, 3, 1, 5], [4, 3, 1, 2, 5], [4, 3, 2, 1, 5].
|
```python
import math
n, k = map(int,input().split())
def mod(n):
return n%1000000007
def variacion(n, p):
s=1
for i in range(n-p+1,n+1):
s = mod(s*mod(i))
return s
factoriales=[0]*1000000
factoriales[0]=1
mask=[False]*1000000
mask[0]=True
ultimo_factorial=0
def factorial(n):
if n==0:
return 1
if mask[n-1]:
return factoriales[n-1]
for i in range(ultimo_factorial+1,n+1):
factoriales[i] = mod(factoriales[i-1]*(i+1))
mask[i]=True
return factoriales[n-1]
def fallos(n,k):
s=0
for q in range(k+1,n):
parcial=0
for i in range(q-k):
parcial+=mod(factorial(i)*factorial(n-k-i-1))
s+=mod(mod(parcial)*variacion(q-1,k))
return s
print(fallos(n,k))
```
| 0
|
|
579
|
A
|
Raising Bacteria
|
PROGRAMMING
| 1,000
|
[
"bitmasks"
] | null | null |
You are a lover of bacteria. You want to raise some bacteria in a box.
Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment.
What is the minimum number of bacteria you need to put into the box across those days?
|
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
|
The only line containing one integer: the answer.
|
[
"5\n",
"8\n"
] |
[
"2\n",
"1\n"
] |
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2.
For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
| 250
|
[
{
"input": "5",
"output": "2"
},
{
"input": "8",
"output": "1"
},
{
"input": "536870911",
"output": "29"
},
{
"input": "1",
"output": "1"
},
{
"input": "343000816",
"output": "14"
},
{
"input": "559980448",
"output": "12"
},
{
"input": "697681824",
"output": "14"
},
{
"input": "41313494",
"output": "14"
},
{
"input": "673935585",
"output": "13"
},
{
"input": "117422204",
"output": "19"
},
{
"input": "954746654",
"output": "15"
},
{
"input": "536838144",
"output": "14"
},
{
"input": "1000000000",
"output": "13"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "6",
"output": "2"
},
{
"input": "7",
"output": "3"
},
{
"input": "9",
"output": "2"
},
{
"input": "10",
"output": "2"
},
{
"input": "999999999",
"output": "21"
},
{
"input": "999999998",
"output": "20"
},
{
"input": "999999997",
"output": "20"
},
{
"input": "999999996",
"output": "19"
},
{
"input": "999999995",
"output": "20"
},
{
"input": "999999994",
"output": "19"
},
{
"input": "999999993",
"output": "19"
},
{
"input": "999999992",
"output": "18"
},
{
"input": "999999991",
"output": "20"
},
{
"input": "999999990",
"output": "19"
},
{
"input": "536870910",
"output": "28"
},
{
"input": "536870912",
"output": "1"
},
{
"input": "536870913",
"output": "2"
},
{
"input": "536870914",
"output": "2"
},
{
"input": "22",
"output": "3"
},
{
"input": "14",
"output": "3"
}
] | 1,670,853,546
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 46
| 0
|
x=int(input())
ans=0
while x>0:
if x%2==1:
ans+=1
x//=2
print(ans)
|
Title: Raising Bacteria
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are a lover of bacteria. You want to raise some bacteria in a box.
Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment.
What is the minimum number of bacteria you need to put into the box across those days?
Input Specification:
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
Output Specification:
The only line containing one integer: the answer.
Demo Input:
['5\n', '8\n']
Demo Output:
['2\n', '1\n']
Note:
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2.
For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
|
```python
x=int(input())
ans=0
while x>0:
if x%2==1:
ans+=1
x//=2
print(ans)
```
| 3
|
|
525
|
A
|
Vitaliy and Pie
|
PROGRAMMING
| 1,100
|
[
"greedy",
"hashing",
"strings"
] | null | null |
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
|
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
|
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
|
[
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] |
[
"0\n",
"3\n",
"2\n"
] |
none
| 250
|
[
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,598,408,145
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 202
| 819,200
|
from collections import defaultdict
n = int(input())
s = input()
count = 0
d = defaultdict(int)
for i in range(1,len(s),2):
if s[i].lower() == s[i-1]:
continue
elif s[i].lower() in d:
d[s[i].lower()]-=1
if d[s[i].lower()] == 0:
d.pop(s[i].lower())
continue
else:
d[s[i-1]]+=1
count+=1
print(count)
|
Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none
|
```python
from collections import defaultdict
n = int(input())
s = input()
count = 0
d = defaultdict(int)
for i in range(1,len(s),2):
if s[i].lower() == s[i-1]:
continue
elif s[i].lower() in d:
d[s[i].lower()]-=1
if d[s[i].lower()] == 0:
d.pop(s[i].lower())
continue
else:
d[s[i-1]]+=1
count+=1
print(count)
```
| 0
|
|
1,006
|
C
|
Three Parts of the Array
|
PROGRAMMING
| 1,200
|
[
"binary search",
"data structures",
"two pointers"
] | null | null |
You are given an array $d_1, d_2, \dots, d_n$ consisting of $n$ integer numbers.
Your task is to split this array into three parts (some of which may be empty) in such a way that each element of the array belongs to exactly one of the three parts, and each of the parts forms a consecutive contiguous subsegment (possibly, empty) of the original array.
Let the sum of elements of the first part be $sum_1$, the sum of elements of the second part be $sum_2$ and the sum of elements of the third part be $sum_3$. Among all possible ways to split the array you have to choose a way such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
More formally, if the first part of the array contains $a$ elements, the second part of the array contains $b$ elements and the third part contains $c$ elements, then:
$$sum_1 = \sum\limits_{1 \le i \le a}d_i,$$ $$sum_2 = \sum\limits_{a + 1 \le i \le a + b}d_i,$$ $$sum_3 = \sum\limits_{a + b + 1 \le i \le a + b + c}d_i.$$
The sum of an empty array is $0$.
Your task is to find a way to split the array such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
|
The first line of the input contains one integer $n$ ($1 \le n \le 2 \cdot 10^5$) — the number of elements in the array $d$.
The second line of the input contains $n$ integers $d_1, d_2, \dots, d_n$ ($1 \le d_i \le 10^9$) — the elements of the array $d$.
|
Print a single integer — the maximum possible value of $sum_1$, considering that the condition $sum_1 = sum_3$ must be met.
Obviously, at least one valid way to split the array exists (use $a=c=0$ and $b=n$).
|
[
"5\n1 3 1 1 4\n",
"5\n1 3 2 1 4\n",
"3\n4 1 2\n"
] |
[
"5\n",
"4\n",
"0\n"
] |
In the first example there is only one possible splitting which maximizes $sum_1$: $[1, 3, 1], [~], [1, 4]$.
In the second example the only way to have $sum_1=4$ is: $[1, 3], [2, 1], [4]$.
In the third example there is only one way to split the array: $[~], [4, 1, 2], [~]$.
| 0
|
[
{
"input": "5\n1 3 1 1 4",
"output": "5"
},
{
"input": "5\n1 3 2 1 4",
"output": "4"
},
{
"input": "3\n4 1 2",
"output": "0"
},
{
"input": "1\n1000000000",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "5\n1 3 5 4 5",
"output": "9"
}
] | 1,629,191,633
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 343
| 24,678,400
|
n = int(input())
a = list(map(int, input().split()))
s = [a[0]]
for i in range(1, n):
s.append(s[i-1]+a[i])
sa = s[n-1]
l = 0
r = n-1
res = 0
while r-l > 0:
if s[l] == sa - s[r-1]:
res = max(res, s[l])
l += 1
elif s[l] > sa - s[r-1]:
r -= 1
else:
l += 1
print(res)
|
Title: Three Parts of the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array $d_1, d_2, \dots, d_n$ consisting of $n$ integer numbers.
Your task is to split this array into three parts (some of which may be empty) in such a way that each element of the array belongs to exactly one of the three parts, and each of the parts forms a consecutive contiguous subsegment (possibly, empty) of the original array.
Let the sum of elements of the first part be $sum_1$, the sum of elements of the second part be $sum_2$ and the sum of elements of the third part be $sum_3$. Among all possible ways to split the array you have to choose a way such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
More formally, if the first part of the array contains $a$ elements, the second part of the array contains $b$ elements and the third part contains $c$ elements, then:
$$sum_1 = \sum\limits_{1 \le i \le a}d_i,$$ $$sum_2 = \sum\limits_{a + 1 \le i \le a + b}d_i,$$ $$sum_3 = \sum\limits_{a + b + 1 \le i \le a + b + c}d_i.$$
The sum of an empty array is $0$.
Your task is to find a way to split the array such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 2 \cdot 10^5$) — the number of elements in the array $d$.
The second line of the input contains $n$ integers $d_1, d_2, \dots, d_n$ ($1 \le d_i \le 10^9$) — the elements of the array $d$.
Output Specification:
Print a single integer — the maximum possible value of $sum_1$, considering that the condition $sum_1 = sum_3$ must be met.
Obviously, at least one valid way to split the array exists (use $a=c=0$ and $b=n$).
Demo Input:
['5\n1 3 1 1 4\n', '5\n1 3 2 1 4\n', '3\n4 1 2\n']
Demo Output:
['5\n', '4\n', '0\n']
Note:
In the first example there is only one possible splitting which maximizes $sum_1$: $[1, 3, 1], [~], [1, 4]$.
In the second example the only way to have $sum_1=4$ is: $[1, 3], [2, 1], [4]$.
In the third example there is only one way to split the array: $[~], [4, 1, 2], [~]$.
|
```python
n = int(input())
a = list(map(int, input().split()))
s = [a[0]]
for i in range(1, n):
s.append(s[i-1]+a[i])
sa = s[n-1]
l = 0
r = n-1
res = 0
while r-l > 0:
if s[l] == sa - s[r-1]:
res = max(res, s[l])
l += 1
elif s[l] > sa - s[r-1]:
r -= 1
else:
l += 1
print(res)
```
| 3
|
|
358
|
A
|
Dima and Continuous Line
|
PROGRAMMING
| 1,400
|
[
"brute force",
"implementation"
] | null | null |
Dima and Seryozha live in an ordinary dormitory room for two. One day Dima had a date with his girl and he asked Seryozha to leave the room. As a compensation, Seryozha made Dima do his homework.
The teacher gave Seryozha the coordinates of *n* distinct points on the abscissa axis and asked to consecutively connect them by semi-circus in a certain order: first connect the first point with the second one, then connect the second point with the third one, then the third one with the fourth one and so on to the *n*-th point. Two points with coordinates (*x*1,<=0) and (*x*2,<=0) should be connected by a semi-circle that passes above the abscissa axis with the diameter that coincides with the segment between points. Seryozha needs to find out if the line on the picture intersects itself. For clarifications, see the picture Seryozha showed to Dima (the left picture has self-intersections, the right picture doesn't have any).
Seryozha is not a small boy, so the coordinates of the points can be rather large. Help Dima cope with the problem.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=103). The second line contains *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=106<=≤<=*x**i*<=≤<=106) — the *i*-th point has coordinates (*x**i*,<=0). The points are not necessarily sorted by their *x* coordinate.
|
In the single line print "yes" (without the quotes), if the line has self-intersections. Otherwise, print "no" (without the quotes).
|
[
"4\n0 10 5 15\n",
"4\n0 15 5 10\n"
] |
[
"yes\n",
"no\n"
] |
The first test from the statement is on the picture to the left, the second test is on the picture to the right.
| 500
|
[
{
"input": "4\n0 10 5 15",
"output": "yes"
},
{
"input": "4\n0 15 5 10",
"output": "no"
},
{
"input": "5\n0 1000 2000 3000 1500",
"output": "yes"
},
{
"input": "5\n-724093 710736 -383722 -359011 439613",
"output": "no"
},
{
"input": "50\n384672 661179 -775591 -989608 611120 442691 601796 502406 384323 -315945 -934146 873993 -156910 -94123 -930137 208544 816236 466922 473696 463604 794454 -872433 -149791 -858684 -467655 -555239 623978 -217138 -408658 493342 -733576 -350871 711210 884148 -426172 519986 -356885 527171 661680 977247 141654 906254 -961045 -759474 -48634 891473 -606365 -513781 -966166 27696",
"output": "yes"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "no"
},
{
"input": "11\n1 11 10 2 3 9 8 4 5 7 6",
"output": "no"
},
{
"input": "10\n3 2 4 5 1 6 9 7 8 10",
"output": "yes"
},
{
"input": "11\n3 4 2 5 1 6 11 7 10 8 9",
"output": "no"
},
{
"input": "15\n0 -1 1 2 3 13 12 4 11 10 5 6 7 9 8",
"output": "no"
},
{
"input": "16\n6 7 8 9 5 10 11 12 13 14 15 4 16 2 1 3",
"output": "yes"
},
{
"input": "1\n0",
"output": "no"
},
{
"input": "4\n3 1 4 2",
"output": "yes"
},
{
"input": "5\n0 2 4 -2 5",
"output": "no"
},
{
"input": "5\n1 9 8 7 0",
"output": "yes"
},
{
"input": "3\n5 10 0",
"output": "no"
},
{
"input": "6\n1 3 -1 5 2 4",
"output": "yes"
},
{
"input": "4\n3 2 4 1",
"output": "no"
},
{
"input": "4\n10 5 15 0",
"output": "no"
},
{
"input": "2\n-5 -10",
"output": "no"
},
{
"input": "3\n1 0 3",
"output": "no"
},
{
"input": "4\n-2 -4 1 -3",
"output": "yes"
},
{
"input": "4\n3 6 0 2",
"output": "no"
},
{
"input": "4\n-9 10 -10 0",
"output": "yes"
},
{
"input": "4\n5 10 1 15",
"output": "no"
},
{
"input": "3\n1 0 2",
"output": "no"
},
{
"input": "4\n2 3 4 1",
"output": "no"
},
{
"input": "4\n7 5 9 12",
"output": "no"
}
] | 1,595,996,449
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 20,172,800
|
inf = int(1e9+5)
n = int(input())
ar = list(map(int, input().split()))
up_lim = inf
low_lim = ar[0]
intersect = False
for i in range(n-1):
if ar[i+1]>ar[i] and ar[i+1]<=up_lim:
up_lim = ar[i+1]
elif ar[i+1]<ar[i] and ar[i+1]>=low_lim:
low_lim = ar[i+1]
else:
intersect = True
break
if intersect:
print("yes")
else:
print("no")
|
Title: Dima and Continuous Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and Seryozha live in an ordinary dormitory room for two. One day Dima had a date with his girl and he asked Seryozha to leave the room. As a compensation, Seryozha made Dima do his homework.
The teacher gave Seryozha the coordinates of *n* distinct points on the abscissa axis and asked to consecutively connect them by semi-circus in a certain order: first connect the first point with the second one, then connect the second point with the third one, then the third one with the fourth one and so on to the *n*-th point. Two points with coordinates (*x*1,<=0) and (*x*2,<=0) should be connected by a semi-circle that passes above the abscissa axis with the diameter that coincides with the segment between points. Seryozha needs to find out if the line on the picture intersects itself. For clarifications, see the picture Seryozha showed to Dima (the left picture has self-intersections, the right picture doesn't have any).
Seryozha is not a small boy, so the coordinates of the points can be rather large. Help Dima cope with the problem.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=103). The second line contains *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=106<=≤<=*x**i*<=≤<=106) — the *i*-th point has coordinates (*x**i*,<=0). The points are not necessarily sorted by their *x* coordinate.
Output Specification:
In the single line print "yes" (without the quotes), if the line has self-intersections. Otherwise, print "no" (without the quotes).
Demo Input:
['4\n0 10 5 15\n', '4\n0 15 5 10\n']
Demo Output:
['yes\n', 'no\n']
Note:
The first test from the statement is on the picture to the left, the second test is on the picture to the right.
|
```python
inf = int(1e9+5)
n = int(input())
ar = list(map(int, input().split()))
up_lim = inf
low_lim = ar[0]
intersect = False
for i in range(n-1):
if ar[i+1]>ar[i] and ar[i+1]<=up_lim:
up_lim = ar[i+1]
elif ar[i+1]<ar[i] and ar[i+1]>=low_lim:
low_lim = ar[i+1]
else:
intersect = True
break
if intersect:
print("yes")
else:
print("no")
```
| 0
|
|
343
|
B
|
Alternating Current
|
PROGRAMMING
| 1,600
|
[
"data structures",
"greedy",
"implementation"
] | null | null |
Mad scientist Mike has just finished constructing a new device to search for extraterrestrial intelligence! He was in such a hurry to launch it for the first time that he plugged in the power wires without giving it a proper glance and started experimenting right away. After a while Mike observed that the wires ended up entangled and now have to be untangled again.
The device is powered by two wires "plus" and "minus". The wires run along the floor from the wall (on the left) to the device (on the right). Both the wall and the device have two contacts in them on the same level, into which the wires are plugged in some order. The wires are considered entangled if there are one or more places where one wire runs above the other one. For example, the picture below has four such places (top view):
Mike knows the sequence in which the wires run above each other. Mike also noticed that on the left side, the "plus" wire is always plugged into the top contact (as seen on the picture). He would like to untangle the wires without unplugging them and without moving the device. Determine if it is possible to do that. A wire can be freely moved and stretched on the floor, but cannot be cut.
To understand the problem better please read the notes to the test samples.
|
The single line of the input contains a sequence of characters "+" and "-" of length *n* (1<=≤<=*n*<=≤<=100000). The *i*-th (1<=≤<=*i*<=≤<=*n*) position of the sequence contains the character "+", if on the *i*-th step from the wall the "plus" wire runs above the "minus" wire, and the character "-" otherwise.
|
Print either "Yes" (without the quotes) if the wires can be untangled or "No" (without the quotes) if the wires cannot be untangled.
|
[
"-++-\n",
"+-\n",
"++\n",
"-\n"
] |
[
"Yes\n",
"No\n",
"Yes\n",
"No\n"
] |
The first testcase corresponds to the picture in the statement. To untangle the wires, one can first move the "plus" wire lower, thus eliminating the two crosses in the middle, and then draw it under the "minus" wire, eliminating also the remaining two crosses.
In the second testcase the "plus" wire makes one full revolution around the "minus" wire. Thus the wires cannot be untangled:
In the third testcase the "plus" wire simply runs above the "minus" wire twice in sequence. The wires can be untangled by lifting "plus" and moving it higher:
In the fourth testcase the "minus" wire runs above the "plus" wire once. The wires cannot be untangled without moving the device itself:
| 1,000
|
[
{
"input": "-++-",
"output": "Yes"
},
{
"input": "+-",
"output": "No"
},
{
"input": "++",
"output": "Yes"
},
{
"input": "-",
"output": "No"
},
{
"input": "+-+-",
"output": "No"
},
{
"input": "-+-",
"output": "No"
},
{
"input": "-++-+--+",
"output": "Yes"
},
{
"input": "+",
"output": "No"
},
{
"input": "-+",
"output": "No"
},
{
"input": "--",
"output": "Yes"
},
{
"input": "+++",
"output": "No"
},
{
"input": "--+",
"output": "No"
},
{
"input": "++--++",
"output": "Yes"
},
{
"input": "+-++-+",
"output": "Yes"
},
{
"input": "+-+--+",
"output": "No"
},
{
"input": "--++-+",
"output": "No"
},
{
"input": "-+-+--",
"output": "No"
},
{
"input": "+-+++-",
"output": "No"
},
{
"input": "-+-+-+",
"output": "No"
},
{
"input": "-++-+--++--+-++-",
"output": "Yes"
},
{
"input": "+-----+-++---+------+++-++++",
"output": "No"
},
{
"input": "-+-++--+++-++++---+--+----+--+-+-+++-+++-+---++-++++-+--+--+--+-+-++-+-+-++++++---++--+++++-+--++--+-+--++-----+--+-++---+++---++----+++-++++--++-++-",
"output": "No"
},
{
"input": "-+-----++++--++-+-++",
"output": "Yes"
},
{
"input": "+--+--+------+++++++-+-+++--++---+--+-+---+--+++-+++-------+++++-+-++++--+-+-+++++++----+----+++----+-+++-+++-----+++-+-++-+-+++++-+--++----+--+-++-----+-+-++++---+++---+-+-+-++++--+--+++---+++++-+---+-----+++-++--+++---++-++-+-+++-+-+-+---+++--+--++++-+-+--++-------+--+---++-----+++--+-+++--++-+-+++-++--+++-++++++++++-++-++++++-+++--+--++-+++--+++-++++----+++---+-+----++++-+-+",
"output": "Yes"
},
{
"input": "-+-+-++-+-+-",
"output": "Yes"
},
{
"input": "-+-++-+-",
"output": "Yes"
},
{
"input": "-+-++-+-+-",
"output": "No"
},
{
"input": "++-+-+-+-+--+",
"output": "No"
},
{
"input": "+++---",
"output": "No"
},
{
"input": "+-+-+-+-+--+-+-+-+-++--++--+",
"output": "Yes"
},
{
"input": "+-+-++",
"output": "No"
},
{
"input": "-++--+--+++-+-+-+-+-",
"output": "No"
},
{
"input": "+---+-+-",
"output": "No"
},
{
"input": "+-+--+-+",
"output": "Yes"
},
{
"input": "+++---+++---",
"output": "No"
},
{
"input": "-+++++",
"output": "No"
},
{
"input": "-+-+-+-+-+-+-++-+-+-+-+-+-+-",
"output": "Yes"
},
{
"input": "-+++--",
"output": "No"
},
{
"input": "+---+",
"output": "No"
},
{
"input": "-++",
"output": "No"
},
{
"input": "-+--+-",
"output": "Yes"
},
{
"input": "+---++--++",
"output": "No"
},
{
"input": "+++-",
"output": "No"
},
{
"input": "--+++",
"output": "No"
},
{
"input": "++-+",
"output": "No"
}
] | 1,658,613,244
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 92
| 0
|
array = input()
j = len(array) - 1
i = 0
result = True
while len(array) > 0:
if len(array) % 2 != 0:
result = False
break
if array[j] != array[0]:
result = False
break
array = array[1: j]
j -= 2
if result:
print("Yes")
else:
print("No")
|
Title: Alternating Current
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mad scientist Mike has just finished constructing a new device to search for extraterrestrial intelligence! He was in such a hurry to launch it for the first time that he plugged in the power wires without giving it a proper glance and started experimenting right away. After a while Mike observed that the wires ended up entangled and now have to be untangled again.
The device is powered by two wires "plus" and "minus". The wires run along the floor from the wall (on the left) to the device (on the right). Both the wall and the device have two contacts in them on the same level, into which the wires are plugged in some order. The wires are considered entangled if there are one or more places where one wire runs above the other one. For example, the picture below has four such places (top view):
Mike knows the sequence in which the wires run above each other. Mike also noticed that on the left side, the "plus" wire is always plugged into the top contact (as seen on the picture). He would like to untangle the wires without unplugging them and without moving the device. Determine if it is possible to do that. A wire can be freely moved and stretched on the floor, but cannot be cut.
To understand the problem better please read the notes to the test samples.
Input Specification:
The single line of the input contains a sequence of characters "+" and "-" of length *n* (1<=≤<=*n*<=≤<=100000). The *i*-th (1<=≤<=*i*<=≤<=*n*) position of the sequence contains the character "+", if on the *i*-th step from the wall the "plus" wire runs above the "minus" wire, and the character "-" otherwise.
Output Specification:
Print either "Yes" (without the quotes) if the wires can be untangled or "No" (without the quotes) if the wires cannot be untangled.
Demo Input:
['-++-\n', '+-\n', '++\n', '-\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n', 'No\n']
Note:
The first testcase corresponds to the picture in the statement. To untangle the wires, one can first move the "plus" wire lower, thus eliminating the two crosses in the middle, and then draw it under the "minus" wire, eliminating also the remaining two crosses.
In the second testcase the "plus" wire makes one full revolution around the "minus" wire. Thus the wires cannot be untangled:
In the third testcase the "plus" wire simply runs above the "minus" wire twice in sequence. The wires can be untangled by lifting "plus" and moving it higher:
In the fourth testcase the "minus" wire runs above the "plus" wire once. The wires cannot be untangled without moving the device itself:
|
```python
array = input()
j = len(array) - 1
i = 0
result = True
while len(array) > 0:
if len(array) % 2 != 0:
result = False
break
if array[j] != array[0]:
result = False
break
array = array[1: j]
j -= 2
if result:
print("Yes")
else:
print("No")
```
| 0
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,645,158,899
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 92
| 0
|
n = int(input())
r1,r2,r3 = 0,0,0
for i in range(n):
a,b,c = map(int,input().split())
r1 += a
r2 += b
r3 += c
if(r1==0 and r2 == 0 and r3 == 0):
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n = int(input())
r1,r2,r3 = 0,0,0
for i in range(n):
a,b,c = map(int,input().split())
r1 += a
r2 += b
r3 += c
if(r1==0 and r2 == 0 and r3 == 0):
print("YES")
else:
print("NO")
```
| 3.977
|
451
|
A
|
Game With Sticks
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
After winning gold and silver in IOI 2014, Akshat and Malvika want to have some fun. Now they are playing a game on a grid made of *n* horizontal and *m* vertical sticks.
An intersection point is any point on the grid which is formed by the intersection of one horizontal stick and one vertical stick.
In the grid shown below, *n*<==<=3 and *m*<==<=3. There are *n*<=+<=*m*<==<=6 sticks in total (horizontal sticks are shown in red and vertical sticks are shown in green). There are *n*·*m*<==<=9 intersection points, numbered from 1 to 9.
The rules of the game are very simple. The players move in turns. Akshat won gold, so he makes the first move. During his/her move, a player must choose any remaining intersection point and remove from the grid all sticks which pass through this point. A player will lose the game if he/she cannot make a move (i.e. there are no intersection points remaining on the grid at his/her move).
Assume that both players play optimally. Who will win the game?
|
The first line of input contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
|
Print a single line containing "Akshat" or "Malvika" (without the quotes), depending on the winner of the game.
|
[
"2 2\n",
"2 3\n",
"3 3\n"
] |
[
"Malvika\n",
"Malvika\n",
"Akshat\n"
] |
Explanation of the first sample:
The grid has four intersection points, numbered from 1 to 4.
If Akshat chooses intersection point 1, then he will remove two sticks (1 - 2 and 1 - 3). The resulting grid will look like this.
Now there is only one remaining intersection point (i.e. 4). Malvika must choose it and remove both remaining sticks. After her move the grid will be empty.
In the empty grid, Akshat cannot make any move, hence he will lose.
Since all 4 intersection points of the grid are equivalent, Akshat will lose no matter which one he picks.
| 500
|
[
{
"input": "2 2",
"output": "Malvika"
},
{
"input": "2 3",
"output": "Malvika"
},
{
"input": "3 3",
"output": "Akshat"
},
{
"input": "20 68",
"output": "Malvika"
},
{
"input": "1 1",
"output": "Akshat"
},
{
"input": "1 2",
"output": "Akshat"
},
{
"input": "1 3",
"output": "Akshat"
},
{
"input": "2 1",
"output": "Akshat"
},
{
"input": "2 2",
"output": "Malvika"
},
{
"input": "3 1",
"output": "Akshat"
},
{
"input": "3 2",
"output": "Malvika"
},
{
"input": "68 42",
"output": "Malvika"
},
{
"input": "1 35",
"output": "Akshat"
},
{
"input": "25 70",
"output": "Akshat"
},
{
"input": "59 79",
"output": "Akshat"
},
{
"input": "65 63",
"output": "Akshat"
},
{
"input": "46 6",
"output": "Malvika"
},
{
"input": "28 82",
"output": "Malvika"
},
{
"input": "98 98",
"output": "Malvika"
},
{
"input": "98 99",
"output": "Malvika"
},
{
"input": "98 100",
"output": "Malvika"
},
{
"input": "99 98",
"output": "Malvika"
},
{
"input": "99 99",
"output": "Akshat"
},
{
"input": "99 100",
"output": "Akshat"
},
{
"input": "100 98",
"output": "Malvika"
},
{
"input": "100 99",
"output": "Akshat"
},
{
"input": "100 100",
"output": "Malvika"
},
{
"input": "3 4",
"output": "Akshat"
}
] | 1,678,719,097
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 46
| 0
|
n,m=map(int,input().split())
if (n*m)%2==0:
print("Malvika")
else:
print("Akshat")
|
Title: Game With Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After winning gold and silver in IOI 2014, Akshat and Malvika want to have some fun. Now they are playing a game on a grid made of *n* horizontal and *m* vertical sticks.
An intersection point is any point on the grid which is formed by the intersection of one horizontal stick and one vertical stick.
In the grid shown below, *n*<==<=3 and *m*<==<=3. There are *n*<=+<=*m*<==<=6 sticks in total (horizontal sticks are shown in red and vertical sticks are shown in green). There are *n*·*m*<==<=9 intersection points, numbered from 1 to 9.
The rules of the game are very simple. The players move in turns. Akshat won gold, so he makes the first move. During his/her move, a player must choose any remaining intersection point and remove from the grid all sticks which pass through this point. A player will lose the game if he/she cannot make a move (i.e. there are no intersection points remaining on the grid at his/her move).
Assume that both players play optimally. Who will win the game?
Input Specification:
The first line of input contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Output Specification:
Print a single line containing "Akshat" or "Malvika" (without the quotes), depending on the winner of the game.
Demo Input:
['2 2\n', '2 3\n', '3 3\n']
Demo Output:
['Malvika\n', 'Malvika\n', 'Akshat\n']
Note:
Explanation of the first sample:
The grid has four intersection points, numbered from 1 to 4.
If Akshat chooses intersection point 1, then he will remove two sticks (1 - 2 and 1 - 3). The resulting grid will look like this.
Now there is only one remaining intersection point (i.e. 4). Malvika must choose it and remove both remaining sticks. After her move the grid will be empty.
In the empty grid, Akshat cannot make any move, hence he will lose.
Since all 4 intersection points of the grid are equivalent, Akshat will lose no matter which one he picks.
|
```python
n,m=map(int,input().split())
if (n*m)%2==0:
print("Malvika")
else:
print("Akshat")
```
| 0
|
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,695,916,191
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 124
| 0
|
tv_sets,carry_limit=map(int,input().split())
prices=list(map(int,input().split()))
prices.sort()
print(abs(sum(prices[:carry_limit:])))
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
tv_sets,carry_limit=map(int,input().split())
prices=list(map(int,input().split()))
prices.sort()
print(abs(sum(prices[:carry_limit:])))
```
| 0
|
990
|
D
|
Graph And Its Complement
|
PROGRAMMING
| 1,700
|
[
"constructive algorithms",
"graphs",
"implementation"
] | null | null |
Given three numbers $n, a, b$. You need to find an adjacency matrix of such an undirected graph that the number of components in it is equal to $a$, and the number of components in its complement is $b$. The matrix must be symmetric, and all digits on the main diagonal must be zeroes.
In an undirected graph loops (edges from a vertex to itself) are not allowed. It can be at most one edge between a pair of vertices.
The adjacency matrix of an undirected graph is a square matrix of size $n$ consisting only of "0" and "1", where $n$ is the number of vertices of the graph and the $i$-th row and the $i$-th column correspond to the $i$-th vertex of the graph. The cell $(i,j)$ of the adjacency matrix contains $1$ if and only if the $i$-th and $j$-th vertices in the graph are connected by an edge.
A connected component is a set of vertices $X$ such that for every two vertices from this set there exists at least one path in the graph connecting this pair of vertices, but adding any other vertex to $X$ violates this rule.
The complement or inverse of a graph $G$ is a graph $H$ on the same vertices such that two distinct vertices of $H$ are adjacent if and only if they are not adjacent in $G$.
|
In a single line, three numbers are given $n, a, b \,(1 \le n \le 1000, 1 \le a, b \le n)$: is the number of vertexes of the graph, the required number of connectivity components in it, and the required amount of the connectivity component in it's complement.
|
If there is no graph that satisfies these constraints on a single line, print "NO" (without quotes).
Otherwise, on the first line, print "YES"(without quotes). In each of the next $n$ lines, output $n$ digits such that $j$-th digit of $i$-th line must be $1$ if and only if there is an edge between vertices $i$ and $j$ in $G$ (and $0$ otherwise). Note that the matrix must be symmetric, and all digits on the main diagonal must be zeroes.
If there are several matrices that satisfy the conditions — output any of them.
|
[
"3 1 2\n",
"3 3 3\n"
] |
[
"YES\n001\n001\n110\n",
"NO\n"
] |
none
| 0
|
[
{
"input": "3 1 2",
"output": "YES\n001\n001\n110"
},
{
"input": "3 3 3",
"output": "NO"
},
{
"input": "5 1 1",
"output": "YES\n01000\n10100\n01010\n00101\n00010"
},
{
"input": "123 1 84",
"output": "YES\n001111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n000111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n100011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n110001111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n111000..."
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "1 1 1",
"output": "YES\n0"
},
{
"input": "3 1 1",
"output": "NO"
},
{
"input": "5 2 2",
"output": "NO"
},
{
"input": "1000 734 1",
"output": "YES\n01000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "1000 1 1000",
"output": "YES\n01111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111..."
},
{
"input": "1000 1 1",
"output": "YES\n01000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "4 1 1",
"output": "YES\n0100\n1010\n0101\n0010"
},
{
"input": "4 4 1",
"output": "YES\n0000\n0000\n0000\n0000"
},
{
"input": "3 1 3",
"output": "YES\n011\n101\n110"
},
{
"input": "2 1 2",
"output": "YES\n01\n10"
},
{
"input": "101 1 1",
"output": "YES\n01000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n10100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n01010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n00101000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0001010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "102 1 1",
"output": "YES\n010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n101000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n010100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n001010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n000101000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "103 1 1",
"output": "YES\n0100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n1010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0101000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0010100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n00010100000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "104 1 1",
"output": "YES\n01000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n10100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n01010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n00101000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0001010000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "6 1 1",
"output": "YES\n010000\n101000\n010100\n001010\n000101\n000010"
},
{
"input": "3 2 1",
"output": "YES\n010\n100\n000"
},
{
"input": "5 1 2",
"output": "YES\n00111\n00011\n10001\n11001\n11110"
},
{
"input": "4 1 2",
"output": "YES\n0011\n0001\n1001\n1110"
},
{
"input": "2 2 1",
"output": "YES\n00\n00"
},
{
"input": "3 3 1",
"output": "YES\n000\n000\n000"
},
{
"input": "2 2 2",
"output": "NO"
},
{
"input": "1 1 1",
"output": "YES\n0"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "2 1 2",
"output": "YES\n01\n10"
},
{
"input": "2 2 1",
"output": "YES\n00\n00"
},
{
"input": "2 2 2",
"output": "NO"
},
{
"input": "3 1 1",
"output": "NO"
},
{
"input": "3 1 2",
"output": "YES\n001\n001\n110"
},
{
"input": "3 1 3",
"output": "YES\n011\n101\n110"
},
{
"input": "3 2 1",
"output": "YES\n010\n100\n000"
},
{
"input": "3 2 2",
"output": "NO"
},
{
"input": "3 2 3",
"output": "NO"
},
{
"input": "3 3 1",
"output": "YES\n000\n000\n000"
},
{
"input": "3 3 2",
"output": "NO"
},
{
"input": "3 3 3",
"output": "NO"
},
{
"input": "4 1 1",
"output": "YES\n0100\n1010\n0101\n0010"
},
{
"input": "4 1 2",
"output": "YES\n0011\n0001\n1001\n1110"
},
{
"input": "4 1 3",
"output": "YES\n0011\n0011\n1101\n1110"
},
{
"input": "4 1 4",
"output": "YES\n0111\n1011\n1101\n1110"
},
{
"input": "4 2 1",
"output": "YES\n0100\n1010\n0100\n0000"
},
{
"input": "4 2 2",
"output": "NO"
},
{
"input": "4 2 3",
"output": "NO"
},
{
"input": "4 2 4",
"output": "NO"
},
{
"input": "4 3 1",
"output": "YES\n0100\n1000\n0000\n0000"
},
{
"input": "4 3 2",
"output": "NO"
},
{
"input": "4 3 3",
"output": "NO"
},
{
"input": "4 3 4",
"output": "NO"
},
{
"input": "4 4 1",
"output": "YES\n0000\n0000\n0000\n0000"
},
{
"input": "4 4 2",
"output": "NO"
},
{
"input": "4 4 3",
"output": "NO"
},
{
"input": "4 4 4",
"output": "NO"
}
] | 1,685,631,024
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 202
| 8,396,800
|
n, a, b = [int(x) for x in input().split()]
flag = False
if b > a:
a, b = b, a
flag = True
def possible(n, a, b):
if a > n:
return False
if a > 1:
return b == 1
if a == 1:
return n >= 4 or n == 1
if possible(n, a, b):
print("YES")
mat = [['0']*n for _ in range(n)]
for i in range(n-a):
mat[i][i+1] = mat[i+1][i] = '1'
if flag:
for i in range(n):
for j in range(n):
if i == j: continue
if mat[i][j] == '0':
mat[i][j] = '1'
else:
mat[i][j] = '0'
for row in mat:
print(''.join(row))
else:
print("NO")
|
Title: Graph And Its Complement
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Given three numbers $n, a, b$. You need to find an adjacency matrix of such an undirected graph that the number of components in it is equal to $a$, and the number of components in its complement is $b$. The matrix must be symmetric, and all digits on the main diagonal must be zeroes.
In an undirected graph loops (edges from a vertex to itself) are not allowed. It can be at most one edge between a pair of vertices.
The adjacency matrix of an undirected graph is a square matrix of size $n$ consisting only of "0" and "1", where $n$ is the number of vertices of the graph and the $i$-th row and the $i$-th column correspond to the $i$-th vertex of the graph. The cell $(i,j)$ of the adjacency matrix contains $1$ if and only if the $i$-th and $j$-th vertices in the graph are connected by an edge.
A connected component is a set of vertices $X$ such that for every two vertices from this set there exists at least one path in the graph connecting this pair of vertices, but adding any other vertex to $X$ violates this rule.
The complement or inverse of a graph $G$ is a graph $H$ on the same vertices such that two distinct vertices of $H$ are adjacent if and only if they are not adjacent in $G$.
Input Specification:
In a single line, three numbers are given $n, a, b \,(1 \le n \le 1000, 1 \le a, b \le n)$: is the number of vertexes of the graph, the required number of connectivity components in it, and the required amount of the connectivity component in it's complement.
Output Specification:
If there is no graph that satisfies these constraints on a single line, print "NO" (without quotes).
Otherwise, on the first line, print "YES"(without quotes). In each of the next $n$ lines, output $n$ digits such that $j$-th digit of $i$-th line must be $1$ if and only if there is an edge between vertices $i$ and $j$ in $G$ (and $0$ otherwise). Note that the matrix must be symmetric, and all digits on the main diagonal must be zeroes.
If there are several matrices that satisfy the conditions — output any of them.
Demo Input:
['3 1 2\n', '3 3 3\n']
Demo Output:
['YES\n001\n001\n110\n', 'NO\n']
Note:
none
|
```python
n, a, b = [int(x) for x in input().split()]
flag = False
if b > a:
a, b = b, a
flag = True
def possible(n, a, b):
if a > n:
return False
if a > 1:
return b == 1
if a == 1:
return n >= 4 or n == 1
if possible(n, a, b):
print("YES")
mat = [['0']*n for _ in range(n)]
for i in range(n-a):
mat[i][i+1] = mat[i+1][i] = '1'
if flag:
for i in range(n):
for j in range(n):
if i == j: continue
if mat[i][j] == '0':
mat[i][j] = '1'
else:
mat[i][j] = '0'
for row in mat:
print(''.join(row))
else:
print("NO")
```
| 3
|
|
348
|
A
|
Mafia
|
PROGRAMMING
| 1,600
|
[
"binary search",
"math",
"sortings"
] | null | null |
One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want?
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the *i*-th number in the list is the number of rounds the *i*-th person wants to play.
|
In a single line print a single integer — the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"3\n3 2 2\n",
"4\n2 2 2 2\n"
] |
[
"4\n",
"3\n"
] |
You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
| 500
|
[
{
"input": "3\n3 2 2",
"output": "4"
},
{
"input": "4\n2 2 2 2",
"output": "3"
},
{
"input": "7\n9 7 7 8 8 7 8",
"output": "9"
},
{
"input": "10\n13 12 10 13 13 14 10 10 12 12",
"output": "14"
},
{
"input": "10\n94 96 91 95 99 94 96 92 95 99",
"output": "106"
},
{
"input": "100\n1 555 876 444 262 234 231 598 416 261 206 165 181 988 469 123 602 592 533 97 864 716 831 156 962 341 207 377 892 51 866 96 757 317 832 476 549 472 770 1000 887 145 956 515 992 653 972 677 973 527 984 559 280 346 580 30 372 547 209 929 492 520 446 726 47 170 699 560 814 206 688 955 308 287 26 102 77 430 262 71 415 586 532 562 419 615 732 658 108 315 268 574 86 12 23 429 640 995 342 305",
"output": "1000"
},
{
"input": "3\n1 1 1",
"output": "2"
},
{
"input": "30\n94 93 90 94 90 91 93 91 93 94 93 90 100 94 97 94 94 95 94 96 94 98 97 95 97 91 91 95 98 96",
"output": "100"
},
{
"input": "5\n1000000000 5 5 4 4",
"output": "1000000000"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "4\n1 2 3 4",
"output": "4"
},
{
"input": "3\n1000000000 1000000000 10000000",
"output": "1005000000"
},
{
"input": "3\n677876423 834056477 553175531",
"output": "1032554216"
},
{
"input": "5\n1000000000 1 1 1 1",
"output": "1000000000"
},
{
"input": "4\n1000000000 1000000000 1000000000 1000000000",
"output": "1333333334"
},
{
"input": "3\n4 10 11",
"output": "13"
},
{
"input": "5\n1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1250000000"
}
] | 1,610,086,084
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 468
| 10,956,800
|
import math
n=int(input())
l=list(map(int,input().split()))
print(max(max(l),math.ceil(sum(l)/(n-1))))
|
Title: Mafia
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want?
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the *i*-th number in the list is the number of rounds the *i*-th person wants to play.
Output Specification:
In a single line print a single integer — the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['3\n3 2 2\n', '4\n2 2 2 2\n']
Demo Output:
['4\n', '3\n']
Note:
You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
|
```python
import math
n=int(input())
l=list(map(int,input().split()))
print(max(max(l),math.ceil(sum(l)/(n-1))))
```
| 3
|
|
216
|
A
|
Tiling with Hexagons
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Several ages ago Berland was a kingdom. The King of Berland adored math. That's why, when he first visited one of his many palaces, he first of all paid attention to the floor in one hall. The floor was tiled with hexagonal tiles.
The hall also turned out hexagonal in its shape. The King walked along the perimeter of the hall and concluded that each of the six sides has *a*, *b*, *c*, *a*, *b* and *c* adjacent tiles, correspondingly.
To better visualize the situation, look at the picture showing a similar hexagon for *a*<==<=2, *b*<==<=3 and *c*<==<=4.
According to the legend, as the King of Berland obtained the values *a*, *b* and *c*, he almost immediately calculated the total number of tiles on the hall floor. Can you do the same?
|
The first line contains three integers: *a*, *b* and *c* (2<=≤<=*a*,<=*b*,<=*c*<=≤<=1000).
|
Print a single number — the total number of tiles on the hall floor.
|
[
"2 3 4\n"
] |
[
"18"
] |
none
| 500
|
[
{
"input": "2 3 4",
"output": "18"
},
{
"input": "2 2 2",
"output": "7"
},
{
"input": "7 8 13",
"output": "224"
},
{
"input": "14 7 75",
"output": "1578"
},
{
"input": "201 108 304",
"output": "115032"
},
{
"input": "999 998 996",
"output": "2983022"
},
{
"input": "2 2 3",
"output": "10"
},
{
"input": "2 3 2",
"output": "10"
},
{
"input": "3 2 2",
"output": "10"
},
{
"input": "2 3 3",
"output": "14"
},
{
"input": "3 2 3",
"output": "14"
},
{
"input": "3 3 2",
"output": "14"
},
{
"input": "3 3 3",
"output": "19"
},
{
"input": "4 5 3",
"output": "36"
},
{
"input": "2 2 856",
"output": "2569"
},
{
"input": "2 986 2",
"output": "2959"
},
{
"input": "985 2 2",
"output": "2956"
},
{
"input": "2 958 983",
"output": "943654"
},
{
"input": "992 2 912",
"output": "906607"
},
{
"input": "789 894 2",
"output": "707048"
},
{
"input": "1000 1000 1000",
"output": "2997001"
},
{
"input": "384 458 284",
"output": "413875"
},
{
"input": "709 14 290",
"output": "218584"
},
{
"input": "485 117 521",
"output": "369265"
},
{
"input": "849 333 102",
"output": "401998"
},
{
"input": "998 999 1000",
"output": "2991006"
},
{
"input": "2 2 1000",
"output": "3001"
},
{
"input": "2 1000 2",
"output": "3001"
},
{
"input": "1000 2 2",
"output": "3001"
},
{
"input": "1000 2 1000",
"output": "1001999"
},
{
"input": "865 291 383",
"output": "692925"
},
{
"input": "41 49 28",
"output": "4412"
},
{
"input": "34 86 90",
"output": "13515"
},
{
"input": "39 23 56",
"output": "4252"
},
{
"input": "14 99 81",
"output": "10346"
},
{
"input": "48 38 193",
"output": "18144"
},
{
"input": "395 85 22",
"output": "43634"
},
{
"input": "38 291 89",
"output": "39922"
},
{
"input": "7 23 595",
"output": "17387"
},
{
"input": "948 48 3",
"output": "47494"
}
] | 1,593,358,469
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 186
| 6,656,000
|
a,b,c = map(int,input().split())
ans = 2 * (a+b+c)
print(ans)
|
Title: Tiling with Hexagons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Several ages ago Berland was a kingdom. The King of Berland adored math. That's why, when he first visited one of his many palaces, he first of all paid attention to the floor in one hall. The floor was tiled with hexagonal tiles.
The hall also turned out hexagonal in its shape. The King walked along the perimeter of the hall and concluded that each of the six sides has *a*, *b*, *c*, *a*, *b* and *c* adjacent tiles, correspondingly.
To better visualize the situation, look at the picture showing a similar hexagon for *a*<==<=2, *b*<==<=3 and *c*<==<=4.
According to the legend, as the King of Berland obtained the values *a*, *b* and *c*, he almost immediately calculated the total number of tiles on the hall floor. Can you do the same?
Input Specification:
The first line contains three integers: *a*, *b* and *c* (2<=≤<=*a*,<=*b*,<=*c*<=≤<=1000).
Output Specification:
Print a single number — the total number of tiles on the hall floor.
Demo Input:
['2 3 4\n']
Demo Output:
['18']
Note:
none
|
```python
a,b,c = map(int,input().split())
ans = 2 * (a+b+c)
print(ans)
```
| 0
|
|
903
|
D
|
Almost Difference
|
PROGRAMMING
| 2,200
|
[
"data structures",
"math"
] | null | null |
Let's denote a function
You are given an array *a* consisting of *n* integers. You have to calculate the sum of *d*(*a**i*,<=*a**j*) over all pairs (*i*,<=*j*) such that 1<=≤<=*i*<=≤<=*j*<=≤<=*n*.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=200000) — the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109) — elements of the array.
|
Print one integer — the sum of *d*(*a**i*,<=*a**j*) over all pairs (*i*,<=*j*) such that 1<=≤<=*i*<=≤<=*j*<=≤<=*n*.
|
[
"5\n1 2 3 1 3\n",
"4\n6 6 5 5\n",
"4\n6 6 4 4\n"
] |
[
"4\n",
"0\n",
"-8\n"
] |
In the first example:
1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>) = 0; 1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">3</sub>) = 2; 1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">4</sub>) = 0; 1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">5</sub>) = 2; 1. *d*(*a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">3</sub>) = 0; 1. *d*(*a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">4</sub>) = 0; 1. *d*(*a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">5</sub>) = 0; 1. *d*(*a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">4</sub>) = - 2; 1. *d*(*a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">5</sub>) = 0; 1. *d*(*a*<sub class="lower-index">4</sub>, *a*<sub class="lower-index">5</sub>) = 2.
| 0
|
[
{
"input": "5\n1 2 3 1 3",
"output": "4"
},
{
"input": "4\n6 6 5 5",
"output": "0"
},
{
"input": "4\n6 6 4 4",
"output": "-8"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1000000000",
"output": "0"
},
{
"input": "2\n1 1000000000",
"output": "999999999"
},
{
"input": "5\n1 999999996 999999998 999999994 1000000000",
"output": "3999999992"
},
{
"input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "-1774"
},
{
"input": "100\n591 417 888 251 792 847 685 3 182 461 102 348 555 956 771 901 712 878 580 631 342 333 285 899 525 725 537 718 929 653 84 788 104 355 624 803 253 853 201 995 536 184 65 205 540 652 549 777 248 405 677 950 431 580 600 846 328 429 134 983 526 103 500 963 400 23 276 704 570 757 410 658 507 620 984 244 486 454 802 411 985 303 635 283 96 597 855 775 139 839 839 61 219 986 776 72 729 69 20 917",
"output": "-91018"
},
{
"input": "100\n7 8 5 9 5 6 6 9 7 6 8 7 5 10 7 2 6 1 8 10 7 9 9 8 9 6 8 5 10 6 3 7 5 8 9 7 6 1 9 9 6 9 9 2 10 4 4 6 7 9 7 7 9 10 6 10 8 6 4 7 5 5 8 10 10 7 6 9 8 1 5 1 6 6 2 9 8 4 6 6 9 10 6 1 9 9 9 6 1 8 9 2 8 7 1 10 8 2 4 7",
"output": "-1713"
},
{
"input": "100\n82 81 14 33 78 80 15 60 89 82 79 13 15 17 25 13 21 20 63 26 62 63 79 36 18 21 88 92 27 18 59 64 18 96 28 4 76 43 26 25 89 88 96 33 27 97 52 37 92 80 23 18 78 14 88 5 3 14 85 72 84 75 41 3 51 92 91 79 18 78 19 79 8 35 85 86 78 17 51 36 100 32 49 95 2 100 67 72 55 53 42 3 21 100 12 51 50 79 47 2",
"output": "6076"
},
{
"input": "5\n3 1 1 1 3",
"output": "0"
},
{
"input": "1\n22955",
"output": "0"
},
{
"input": "1\n32955",
"output": "0"
}
] | 1,637,430,875
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 296
| 35,328,000
|
n = int(input())
arr = [int(x) for x in input().split()]
cnt = {0 : 0}
ans = 0
pref = [0] * n
for i in range(0, n):
ans += arr[i] * i
if i > 0:
ans -= pref[i - 1]
pref[i] += pref[i - 1]
if arr[i] + 1 in cnt:
ans += cnt[arr[i] + 1]
if arr[i] - 1 in cnt:
ans -= cnt[arr[i] - 1]
pref[i] += arr[i]
if arr[i] in cnt:
cnt[arr[i]] += 1
else:
cnt[arr[i]] = 1
print(ans)
|
Title: Almost Difference
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's denote a function
You are given an array *a* consisting of *n* integers. You have to calculate the sum of *d*(*a**i*,<=*a**j*) over all pairs (*i*,<=*j*) such that 1<=≤<=*i*<=≤<=*j*<=≤<=*n*.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=200000) — the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109) — elements of the array.
Output Specification:
Print one integer — the sum of *d*(*a**i*,<=*a**j*) over all pairs (*i*,<=*j*) such that 1<=≤<=*i*<=≤<=*j*<=≤<=*n*.
Demo Input:
['5\n1 2 3 1 3\n', '4\n6 6 5 5\n', '4\n6 6 4 4\n']
Demo Output:
['4\n', '0\n', '-8\n']
Note:
In the first example:
1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>) = 0; 1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">3</sub>) = 2; 1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">4</sub>) = 0; 1. *d*(*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">5</sub>) = 2; 1. *d*(*a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">3</sub>) = 0; 1. *d*(*a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">4</sub>) = 0; 1. *d*(*a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">5</sub>) = 0; 1. *d*(*a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">4</sub>) = - 2; 1. *d*(*a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">5</sub>) = 0; 1. *d*(*a*<sub class="lower-index">4</sub>, *a*<sub class="lower-index">5</sub>) = 2.
|
```python
n = int(input())
arr = [int(x) for x in input().split()]
cnt = {0 : 0}
ans = 0
pref = [0] * n
for i in range(0, n):
ans += arr[i] * i
if i > 0:
ans -= pref[i - 1]
pref[i] += pref[i - 1]
if arr[i] + 1 in cnt:
ans += cnt[arr[i] + 1]
if arr[i] - 1 in cnt:
ans -= cnt[arr[i] - 1]
pref[i] += arr[i]
if arr[i] in cnt:
cnt[arr[i]] += 1
else:
cnt[arr[i]] = 1
print(ans)
```
| 3
|
|
902
|
B
|
Coloring a Tree
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"dsu",
"greedy"
] | null | null |
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=104) — the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
|
Print a single integer — the minimum number of steps you have to perform to color the tree into given colors.
|
[
"6\n1 2 2 1 5\n2 1 1 1 1 1\n",
"7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n"
] |
[
"3\n",
"5\n"
] |
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6\n1 2 2 1 5\n2 1 1 1 1 1",
"output": "3"
},
{
"input": "7\n1 1 2 3 1 4\n3 3 1 1 1 2 3",
"output": "5"
},
{
"input": "2\n1\n2 2",
"output": "1"
},
{
"input": "3\n1 1\n2 2 2",
"output": "1"
},
{
"input": "4\n1 2 1\n1 2 3 4",
"output": "4"
},
{
"input": "4\n1 2 3\n4 1 2 4",
"output": "4"
},
{
"input": "5\n1 2 1 4\n1 1 1 2 2",
"output": "2"
},
{
"input": "3\n1 2\n2 1 1",
"output": "2"
},
{
"input": "4\n1 1 1\n3 1 3 1",
"output": "3"
},
{
"input": "4\n1 1 2\n4 1 4 1",
"output": "2"
},
{
"input": "4\n1 2 2\n3 1 2 3",
"output": "4"
},
{
"input": "3\n1 1\n1 2 2",
"output": "3"
}
] | 1,641,163,109
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 13
| 140
| 2,969,600
|
v_num = int(input())
graph = list(map(lambda x: int(x), input().split(" ")))
coloring = list(map(lambda x: int(x), input().split(" ")))
# print(v_num, graph, coloring)
tree = dict()
coloring_num = 1
for x in range(v_num):
tree[x+1] = set()
for ind, v in enumerate(graph):
tree[ind + 2].add(v)
tree[v].add(ind + 2)
def dfs(visited, graph, node, previous_color):
if node == 1:
previous_color = coloring[node-1]
visited.add(node)
for neighbour in graph[node]:
dfs(visited, graph, neighbour, previous_color)
if node not in visited:
# print(node)
if previous_color != coloring[node-1]:
global coloring_num
coloring_num += 1
previous_color = coloring[node-1]
visited.add(node)
for neighbour in graph[node]:
dfs(visited, graph, neighbour, previous_color)
visited = set()
dfs(visited, tree, 1, None)
# print(tree)
print(coloring_num)
|
Title: Coloring a Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=104) — the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
Output Specification:
Print a single integer — the minimum number of steps you have to perform to color the tree into given colors.
Demo Input:
['6\n1 2 2 1 5\n2 1 1 1 1 1\n', '7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n']
Demo Output:
['3\n', '5\n']
Note:
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
v_num = int(input())
graph = list(map(lambda x: int(x), input().split(" ")))
coloring = list(map(lambda x: int(x), input().split(" ")))
# print(v_num, graph, coloring)
tree = dict()
coloring_num = 1
for x in range(v_num):
tree[x+1] = set()
for ind, v in enumerate(graph):
tree[ind + 2].add(v)
tree[v].add(ind + 2)
def dfs(visited, graph, node, previous_color):
if node == 1:
previous_color = coloring[node-1]
visited.add(node)
for neighbour in graph[node]:
dfs(visited, graph, neighbour, previous_color)
if node not in visited:
# print(node)
if previous_color != coloring[node-1]:
global coloring_num
coloring_num += 1
previous_color = coloring[node-1]
visited.add(node)
for neighbour in graph[node]:
dfs(visited, graph, neighbour, previous_color)
visited = set()
dfs(visited, tree, 1, None)
# print(tree)
print(coloring_num)
```
| -1
|
|
332
|
B
|
Maximum Absurdity
|
PROGRAMMING
| 1,500
|
[
"data structures",
"dp",
"implementation"
] | null | null |
Reforms continue entering Berland. For example, during yesterday sitting the Berland Parliament approved as much as *n* laws (each law has been assigned a unique number from 1 to *n*). Today all these laws were put on the table of the President of Berland, G.W. Boosch, to be signed.
This time mr. Boosch plans to sign 2*k* laws. He decided to choose exactly two non-intersecting segments of integers from 1 to *n* of length *k* and sign all laws, whose numbers fall into these segments. More formally, mr. Boosch is going to choose two integers *a*, *b* (1<=≤<=*a*<=≤<=*b*<=≤<=*n*<=-<=*k*<=+<=1,<=*b*<=-<=*a*<=≥<=*k*) and sign all laws with numbers lying in the segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1] (borders are included).
As mr. Boosch chooses the laws to sign, he of course considers the public opinion. Allberland Public Opinion Study Centre (APOSC) conducted opinion polls among the citizens, processed the results into a report and gave it to the president. The report contains the absurdity value for each law, in the public opinion. As mr. Boosch is a real patriot, he is keen on signing the laws with the maximum total absurdity. Help him.
|
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=2·105, 0<=<<=2*k*<=≤<=*n*) — the number of laws accepted by the parliament and the length of one segment in the law list, correspondingly. The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* — the absurdity of each law (1<=≤<=*x**i*<=≤<=109).
|
Print two integers *a*, *b* — the beginning of segments that mr. Boosch should choose. That means that the president signs laws with numbers from segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1]. If there are multiple solutions, print the one with the minimum number *a*. If there still are multiple solutions, print the one with the minimum *b*.
|
[
"5 2\n3 6 1 1 6\n",
"6 2\n1 1 1 1 1 1\n"
] |
[
"1 4\n",
"1 3\n"
] |
In the first sample mr. Boosch signs laws with numbers from segments [1;2] and [4;5]. The total absurdity of the signed laws equals 3 + 6 + 1 + 6 = 16.
In the second sample mr. Boosch signs laws with numbers from segments [1;2] and [3;4]. The total absurdity of the signed laws equals 1 + 1 + 1 + 1 = 4.
| 1,000
|
[
{
"input": "5 2\n3 6 1 1 6",
"output": "1 4"
},
{
"input": "6 2\n1 1 1 1 1 1",
"output": "1 3"
},
{
"input": "6 2\n1 4 1 2 5 6",
"output": "1 5"
},
{
"input": "4 1\n1 2 2 2",
"output": "2 3"
},
{
"input": "6 3\n15 20 1 15 43 6",
"output": "1 4"
},
{
"input": "12 3\n1 2 1 15 2 3 6 8 3 3 8 6",
"output": "4 7"
},
{
"input": "14 2\n2 1 2 3 1 2 2 3 1 2 2 3 2 3",
"output": "3 7"
},
{
"input": "2 1\n1 1",
"output": "1 2"
},
{
"input": "2 1\n1000000000 999999999",
"output": "1 2"
},
{
"input": "3 1\n100 30 563",
"output": "1 3"
},
{
"input": "3 1\n547468 78578678 6467834",
"output": "2 3"
},
{
"input": "4 1\n90000 34567 90000 90001",
"output": "1 4"
},
{
"input": "4 2\n999999 8888888 7777777 666666",
"output": "1 3"
},
{
"input": "5 1\n2 1 2 1 2",
"output": "1 3"
},
{
"input": "5 2\n98 96 98 96 96",
"output": "1 3"
},
{
"input": "6 2\n4 4 7 1 1 7",
"output": "2 5"
},
{
"input": "98 24\n91 20 12 75 44 22 22 67 28 100 8 41 31 47 95 87 5 54 7 49 32 46 42 37 45 22 29 15 54 98 46 94 69 47 60 1 15 76 17 82 46 22 32 34 91 37 30 26 92 77 69 11 59 78 24 66 88 15 32 49 46 14 57 20 5 69 53 99 81 70 67 22 54 31 49 52 46 51 46 2 53 59 8 66 28 53 54 5 85 75 15 55 87 16 68 6 36 98",
"output": "30 67"
},
{
"input": "6 3\n1 2 2 2 1 1",
"output": "1 4"
},
{
"input": "10 4\n9 3 3 9 1 9 9 4 4 9",
"output": "1 6"
},
{
"input": "7 3\n1 2 5 5 5 5 5",
"output": "2 5"
}
] | 1,496,518,071
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 122
| 512,000
|
from collections import defaultdict
(n, k) = map(int, input().split(' '))
nums = list(map(int, input().split(' ')))
x = [0] * n
m = defaultdict(list)
i = 0
s = 0
while i < k:
s += nums[i]
x[i] = s
m[x[i]].append(i)
i += 1
while i < n:
s -= nums[i - k]
s += nums[i]
x[i] = s
m[x[i]].append(i)
i += 1
taken = 0
summ = 0
b = -9999
a = -9999
for num in reversed(sorted(m.keys())):
if taken == 2:
break
for j in m[num]:
if taken == 2:
break
if b + k < j:
taken += 1
a = b
b = j
print(a, b)
|
Title: Maximum Absurdity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Reforms continue entering Berland. For example, during yesterday sitting the Berland Parliament approved as much as *n* laws (each law has been assigned a unique number from 1 to *n*). Today all these laws were put on the table of the President of Berland, G.W. Boosch, to be signed.
This time mr. Boosch plans to sign 2*k* laws. He decided to choose exactly two non-intersecting segments of integers from 1 to *n* of length *k* and sign all laws, whose numbers fall into these segments. More formally, mr. Boosch is going to choose two integers *a*, *b* (1<=≤<=*a*<=≤<=*b*<=≤<=*n*<=-<=*k*<=+<=1,<=*b*<=-<=*a*<=≥<=*k*) and sign all laws with numbers lying in the segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1] (borders are included).
As mr. Boosch chooses the laws to sign, he of course considers the public opinion. Allberland Public Opinion Study Centre (APOSC) conducted opinion polls among the citizens, processed the results into a report and gave it to the president. The report contains the absurdity value for each law, in the public opinion. As mr. Boosch is a real patriot, he is keen on signing the laws with the maximum total absurdity. Help him.
Input Specification:
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=2·105, 0<=<<=2*k*<=≤<=*n*) — the number of laws accepted by the parliament and the length of one segment in the law list, correspondingly. The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* — the absurdity of each law (1<=≤<=*x**i*<=≤<=109).
Output Specification:
Print two integers *a*, *b* — the beginning of segments that mr. Boosch should choose. That means that the president signs laws with numbers from segments [*a*; *a*<=+<=*k*<=-<=1] and [*b*; *b*<=+<=*k*<=-<=1]. If there are multiple solutions, print the one with the minimum number *a*. If there still are multiple solutions, print the one with the minimum *b*.
Demo Input:
['5 2\n3 6 1 1 6\n', '6 2\n1 1 1 1 1 1\n']
Demo Output:
['1 4\n', '1 3\n']
Note:
In the first sample mr. Boosch signs laws with numbers from segments [1;2] and [4;5]. The total absurdity of the signed laws equals 3 + 6 + 1 + 6 = 16.
In the second sample mr. Boosch signs laws with numbers from segments [1;2] and [3;4]. The total absurdity of the signed laws equals 1 + 1 + 1 + 1 = 4.
|
```python
from collections import defaultdict
(n, k) = map(int, input().split(' '))
nums = list(map(int, input().split(' ')))
x = [0] * n
m = defaultdict(list)
i = 0
s = 0
while i < k:
s += nums[i]
x[i] = s
m[x[i]].append(i)
i += 1
while i < n:
s -= nums[i - k]
s += nums[i]
x[i] = s
m[x[i]].append(i)
i += 1
taken = 0
summ = 0
b = -9999
a = -9999
for num in reversed(sorted(m.keys())):
if taken == 2:
break
for j in m[num]:
if taken == 2:
break
if b + k < j:
taken += 1
a = b
b = j
print(a, b)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
First-rate specialists graduate from Berland State Institute of Peace and Friendship. You are one of the most talented students in this university. The education is not easy because you need to have fundamental knowledge in different areas, which sometimes are not related to each other.
For example, you should know linguistics very well. You learn a structure of Reberland language as foreign language. In this language words are constructed according to the following rules. First you need to choose the "root" of the word — some string which has more than 4 letters. Then several strings with the length 2 or 3 symbols are appended to this word. The only restriction — it is not allowed to append the same string twice in a row. All these strings are considered to be suffixes of the word (this time we use word "suffix" to describe a morpheme but not the few last characters of the string as you may used to).
Here is one exercise that you have found in your task list. You are given the word *s*. Find all distinct strings with the length 2 or 3, which can be suffixes of this word according to the word constructing rules in Reberland language.
Two strings are considered distinct if they have different length or there is a position in which corresponding characters do not match.
Let's look at the example: the word *abacabaca* is given. This word can be obtained in the following ways: , where the root of the word is overlined, and suffixes are marked by "corners". Thus, the set of possible suffixes for this word is {*aca*,<=*ba*,<=*ca*}.
|
The only line contains a string *s* (5<=≤<=|*s*|<=≤<=104) consisting of lowercase English letters.
|
On the first line print integer *k* — a number of distinct possible suffixes. On the next *k* lines print suffixes.
Print suffixes in lexicographical (alphabetical) order.
|
[
"abacabaca\n",
"abaca\n"
] |
[
"3\naca\nba\nca\n",
"0\n"
] |
The first test was analysed in the problem statement.
In the second example the length of the string equals 5. The length of the root equals 5, so no string can be used as a suffix.
| 0
|
[
{
"input": "abacabaca",
"output": "3\naca\nba\nca"
},
{
"input": "abaca",
"output": "0"
},
{
"input": "gzqgchv",
"output": "1\nhv"
},
{
"input": "iosdwvzerqfi",
"output": "9\ner\nerq\nfi\nqfi\nrq\nvz\nvze\nze\nzer"
},
{
"input": "oawtxikrpvfuzugjweki",
"output": "25\neki\nfu\nfuz\ngj\ngjw\nik\nikr\njw\njwe\nki\nkr\nkrp\npv\npvf\nrp\nrpv\nug\nugj\nuz\nuzu\nvf\nvfu\nwe\nzu\nzug"
},
{
"input": "abcdexyzzzz",
"output": "5\nxyz\nyz\nyzz\nzz\nzzz"
},
{
"input": "affviytdmexpwfqplpyrlniprbdphrcwlboacoqec",
"output": "67\nac\naco\nbd\nbdp\nbo\nboa\nco\ncoq\ncw\ncwl\ndm\ndme\ndp\ndph\nec\nex\nexp\nfq\nfqp\nhr\nhrc\nip\nipr\nlb\nlbo\nln\nlni\nlp\nlpy\nme\nmex\nni\nnip\noa\noac\noq\nph\nphr\npl\nplp\npr\nprb\npw\npwf\npy\npyr\nqec\nqp\nqpl\nrb\nrbd\nrc\nrcw\nrl\nrln\ntd\ntdm\nwf\nwfq\nwl\nwlb\nxp\nxpw\nyr\nyrl\nyt\nytd"
},
{
"input": "lmnxtobrknqjvnzwadpccrlvisxyqbxxmghvl",
"output": "59\nad\nadp\nbr\nbrk\nbx\nbxx\ncc\nccr\ncr\ncrl\ndp\ndpc\ngh\nhvl\nis\nisx\njv\njvn\nkn\nknq\nlv\nlvi\nmg\nmgh\nnq\nnqj\nnz\nnzw\nob\nobr\npc\npcc\nqb\nqbx\nqj\nqjv\nrk\nrkn\nrl\nrlv\nsx\nsxy\nvi\nvis\nvl\nvn\nvnz\nwa\nwad\nxm\nxmg\nxx\nxxm\nxy\nxyq\nyq\nyqb\nzw\nzwa"
},
{
"input": "tbdbdpkluawodlrwldjgplbiylrhuywkhafbkiuoppzsjxwbaqqiwagprqtoauowtaexrhbmctcxwpmplkyjnpwukzwqrqpv",
"output": "170\nae\naex\naf\nafb\nag\nagp\naq\naqq\nau\nauo\naw\nawo\nba\nbaq\nbi\nbiy\nbk\nbki\nbm\nbmc\nct\nctc\ncx\ncxw\ndj\ndjg\ndl\ndlr\nex\nexr\nfb\nfbk\ngp\ngpl\ngpr\nha\nhaf\nhb\nhbm\nhu\nhuy\niu\niuo\niw\niwa\niy\niyl\njg\njgp\njn\njnp\njx\njxw\nkh\nkha\nki\nkiu\nkl\nklu\nky\nkyj\nkz\nkzw\nlb\nlbi\nld\nldj\nlk\nlky\nlr\nlrh\nlrw\nlu\nlua\nmc\nmct\nmp\nmpl\nnp\nnpw\noa\noau\nod\nodl\nop\nopp\now\nowt\npk\npkl\npl\nplb\nplk\npm\npmp\npp\nppz\npr\nprq\npv\npw\npwu\npz\npzs\nqi\nqiw\nqpv\nqq\nqqi\nqr\nqrq\nqt\nq..."
},
{
"input": "caqmjjtwmqxytcsawfufvlofqcqdwnyvywvbbhmpzqwqqxieptiaguwvqdrdftccsglgfezrzhstjcxdknftpyslyqdmkwdolwbusyrgyndqllgesktvgarpfkiglxgtcfepclqhgfbfmkymsszrtynlxbosmrvntsqwccdtahkpnelwiqn",
"output": "323\nag\nagu\nah\nahk\nar\narp\naw\nawf\nbb\nbbh\nbf\nbfm\nbh\nbhm\nbo\nbos\nbu\nbus\ncc\nccd\nccs\ncd\ncdt\ncf\ncfe\ncl\nclq\ncq\ncqd\ncs\ncsa\ncsg\ncx\ncxd\ndf\ndft\ndk\ndkn\ndm\ndmk\ndo\ndol\ndq\ndql\ndr\ndrd\ndt\ndta\ndw\ndwn\nel\nelw\nep\nepc\nept\nes\nesk\nez\nezr\nfb\nfbf\nfe\nfep\nfez\nfk\nfki\nfm\nfmk\nfq\nfqc\nft\nftc\nftp\nfu\nfuf\nfv\nfvl\nga\ngar\nge\nges\ngf\ngfb\ngfe\ngl\nglg\nglx\ngt\ngtc\ngu\nguw\ngy\ngyn\nhg\nhgf\nhk\nhkp\nhm\nhmp\nhs\nhst\nia\niag\nie\niep\nig\nigl\niqn\njc\njcx\njt\njtw..."
},
{
"input": "prntaxhysjfcfmrjngdsitlguahtpnwgbaxptubgpwcfxqehrulbxfcjssgocqncscduvyvarvwxzvmjoatnqfsvsilubexmwugedtzavyamqjqtkxzuslielibjnvkpvyrbndehsqcaqzcrmomqqwskwcypgqoawxdutnxmeivnfpzwvxiyscbfnloqjhjacsfnkfmbhgzpujrqdbaemjsqphokkiplblbflvadcyykcqrdohfasstobwrobslaofbasylwiizrpozvhtwyxtzl",
"output": "505\nac\nacs\nad\nadc\nae\naem\nah\naht\nam\namq\nao\naof\naq\naqz\nar\narv\nas\nass\nasy\nat\natn\nav\navy\naw\nawx\nax\naxp\nba\nbae\nbas\nbax\nbe\nbex\nbf\nbfl\nbfn\nbg\nbgp\nbh\nbhg\nbj\nbjn\nbl\nblb\nbn\nbnd\nbs\nbsl\nbw\nbwr\nbx\nbxf\nca\ncaq\ncb\ncbf\ncd\ncdu\ncf\ncfm\ncfx\ncj\ncjs\ncq\ncqn\ncqr\ncr\ncrm\ncs\ncsc\ncsf\ncy\ncyp\ncyy\ndb\ndba\ndc\ndcy\nde\ndeh\ndo\ndoh\nds\ndsi\ndt\ndtz\ndu\ndut\nduv\ned\nedt\neh\nehr\nehs\nei\neiv\nel\neli\nem\nemj\nex\nexm\nfa\nfas\nfb\nfba\nfc\nfcf\nfcj\nfl\nflv\nf..."
},
{
"input": "gvtgnjyfvnuhagulgmjlqzpvxsygmikofsnvkuplnkxeibnicygpvfvtebppadpdnrxjodxdhxqceaulbfxogwrigstsjudhkgwkhseuwngbppisuzvhzzxxbaggfngmevksbrntpprxvcczlalutdzhwmzbalkqmykmodacjrmwhwugyhwlrbnqxsznldmaxpndwmovcolowxhj",
"output": "375\nac\nacj\nad\nadp\nag\nagg\nagu\nal\nalk\nalu\nau\naul\nax\naxp\nba\nbag\nbal\nbf\nbfx\nbn\nbni\nbnq\nbp\nbpp\nbr\nbrn\ncc\nccz\nce\ncea\ncj\ncjr\nco\ncol\ncy\ncyg\ncz\nczl\nda\ndac\ndh\ndhk\ndhx\ndm\ndma\ndn\ndnr\ndp\ndpd\ndw\ndwm\ndx\ndxd\ndz\ndzh\nea\neau\neb\nebp\nei\neib\neu\neuw\nev\nevk\nfn\nfng\nfs\nfsn\nfv\nfvn\nfvt\nfx\nfxo\ngb\ngbp\ngf\ngfn\ngg\nggf\ngm\ngme\ngmi\ngmj\ngp\ngpv\ngs\ngst\ngu\ngul\ngw\ngwk\ngwr\ngy\ngyh\nha\nhag\nhj\nhk\nhkg\nhs\nhse\nhw\nhwl\nhwm\nhwu\nhx\nhxq\nhz\nhzz\nib\nib..."
},
{
"input": "topqexoicgzjmssuxnswdhpwbsqwfhhziwqibjgeepcvouhjezlomobgireaxaceppoxfxvkwlvgwtjoiplihbpsdhczddwfvcbxqqmqtveaunshmobdlkmmfyajjlkhxnvfmibtbbqswrhcfwytrccgtnlztkddrevkfovunuxtzhhhnorecyfgmlqcwjfjtqegxagfiuqtpjpqlwiefofpatxuqxvikyynncsueynmigieototnbcwxavlbgeqao",
"output": "462\nac\nace\nag\nagf\naj\najj\nao\nat\natx\nau\naun\nav\navl\nax\naxa\nbb\nbbq\nbc\nbcw\nbd\nbdl\nbg\nbge\nbgi\nbj\nbjg\nbp\nbps\nbq\nbqs\nbs\nbsq\nbt\nbtb\nbx\nbxq\ncb\ncbx\ncc\nccg\nce\ncep\ncf\ncfw\ncg\ncgt\ncgz\ncs\ncsu\ncv\ncvo\ncw\ncwj\ncwx\ncy\ncyf\ncz\nczd\ndd\nddr\nddw\ndh\ndhc\ndhp\ndl\ndlk\ndr\ndre\ndw\ndwf\nea\neau\neax\nec\necy\nee\neep\nef\nefo\neg\negx\neo\neot\nep\nepc\nepp\neq\nev\nevk\ney\neyn\nez\nezl\nfg\nfgm\nfh\nfhh\nfi\nfiu\nfj\nfjt\nfm\nfmi\nfo\nfof\nfov\nfp\nfpa\nfv\nfvc\nfw\nfwy\n..."
},
{
"input": "lcrjhbybgamwetyrppxmvvxiyufdkcotwhmptefkqxjhrknjdponulsynpkgszhbkeinpnjdonjfwzbsaweqwlsvuijauwezfydktfljxgclpxpknhygdqyiapvzudyyqomgnsrdhhxhsrdfrwnxdolkmwmw",
"output": "276\nam\namw\nap\napv\nau\nauw\naw\nawe\nbg\nbga\nbk\nbke\nbs\nbsa\nby\nbyb\ncl\nclp\nco\ncot\ndf\ndfr\ndh\ndhh\ndk\ndkc\ndkt\ndo\ndol\ndon\ndp\ndpo\ndq\ndqy\ndy\ndyy\nef\nefk\nei\nein\neq\neqw\net\nety\nez\nezf\nfd\nfdk\nfk\nfkq\nfl\nflj\nfr\nfrw\nfw\nfwz\nfy\nfyd\nga\ngam\ngc\ngcl\ngd\ngdq\ngn\ngns\ngs\ngsz\nhb\nhbk\nhh\nhhx\nhm\nhmp\nhr\nhrk\nhs\nhsr\nhx\nhxh\nhy\nhyg\nia\niap\nij\nija\nin\ninp\niy\niyu\nja\njau\njd\njdo\njdp\njf\njfw\njh\njhr\njx\njxg\nkc\nkco\nke\nkei\nkg\nkgs\nkm\nkmw\nkn\nknh\nknj\n..."
},
{
"input": "hzobjysjhbebobkoror",
"output": "20\nbe\nbeb\nbko\nbo\nbob\neb\nebo\nhb\nhbe\njh\njhb\nko\nkor\nob\nor\nror\nsj\nsjh\nys\nysj"
},
{
"input": "safgmgpzljarfswowdxqhuhypxcmiddyvehjtnlflzknznrukdsbatxoytzxkqngopeipbythhbhfkvlcdxwqrxumbtbgiosjnbeorkzsrfarqofsrcwsfpyheaszjpkjysrcxbzebkxzovdchhososo",
"output": "274\nar\narf\narq\nas\nasz\nat\natx\nba\nbat\nbe\nbeo\nbg\nbgi\nbh\nbhf\nbk\nbkx\nbt\nbtb\nby\nbyt\nbz\nbze\ncd\ncdx\nch\nchh\ncm\ncmi\ncw\ncws\ncx\ncxb\ndc\ndch\ndd\nddy\nds\ndsb\ndx\ndxq\ndxw\ndy\ndyv\nea\neas\neb\nebk\neh\nehj\nei\neip\neo\neor\nfa\nfar\nfk\nfkv\nfl\nflz\nfp\nfpy\nfs\nfsr\nfsw\ngi\ngio\ngo\ngop\ngp\ngpz\nhb\nhbh\nhe\nhea\nhf\nhfk\nhh\nhhb\nhj\nhjt\nhos\nhu\nhuh\nhy\nhyp\nid\nidd\nio\nios\nip\nipb\nja\njar\njn\njnb\njp\njpk\njt\njtn\njy\njys\nkd\nkds\nkj\nkjy\nkn\nknz\nkq\nkqn\nkv\nkvl\n..."
},
{
"input": "glaoyryxrgsysy",
"output": "10\ngs\ngsy\nrgs\nry\nryx\nsy\nxr\nysy\nyx\nyxr"
},
{
"input": "aaaaaxyxxxx",
"output": "5\nxx\nxxx\nxyx\nyx\nyxx"
},
{
"input": "aaaaax",
"output": "0"
},
{
"input": "aaaaaxx",
"output": "1\nxx"
},
{
"input": "aaaaaaa",
"output": "1\naa"
},
{
"input": "aaaaaxxx",
"output": "2\nxx\nxxx"
},
{
"input": "aaaaayxx",
"output": "2\nxx\nyxx"
},
{
"input": "aaaaaxyz",
"output": "2\nxyz\nyz"
},
{
"input": "aaaaaxyxy",
"output": "2\nxy\nyxy"
},
{
"input": "aaaxyyxyy",
"output": "3\nxyy\nyx\nyy"
},
{
"input": "aaaaaxxxxxx",
"output": "2\nxx\nxxx"
},
{
"input": "aaaaaxxxxx",
"output": "2\nxx\nxxx"
},
{
"input": "aaaaaxyzxyxy",
"output": "5\nxy\nyxy\nyzx\nzx\nzxy"
},
{
"input": "aaaaadddgggg",
"output": "6\ndd\nddg\ndg\ndgg\ngg\nggg"
},
{
"input": "abcdeabzzzzzzzz",
"output": "5\nab\nabz\nbz\nzz\nzzz"
},
{
"input": "bbbbbccaaaaaa",
"output": "4\naa\naaa\nca\ncca"
},
{
"input": "xxxxxababc",
"output": "5\nab\naba\nabc\nba\nbc"
},
{
"input": "dddddaabbbbbb",
"output": "4\naab\nab\nbb\nbbb"
},
{
"input": "xxxxxababe",
"output": "5\nab\naba\nabe\nba\nbe"
},
{
"input": "aaaaababaaaaaaaaaaaa",
"output": "6\naa\naaa\nab\nba\nbaa\nbab"
}
] | 1,520,340,037
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 5,632,000
|
# http://codeforces.com/contest/667/problem/C
s = input()
n = len(s)
ans = {s[n - 2:n], s[n - 3:n]}
checked = set()
def dp(i, j):
if (i, j) in checked:
return
checked.add((i, j))
"""
(ab)(cd)で後ろのcdをaddすると
(abc)(bc)でbcをaddできないので前のカタマリをaddする
"""
# 2文字
if i > 6 and s[i:j] != s[i - 2:i]:
ans.add(s[i - 2:i])
dp(i - 2, i)
# 3文字
if i > 7 and s[i:j] != s[i - 3:i]:
ans.add(s[i - 3:i])
dp(i - 3, i)
dp(n - 2, n)
dp(n - 3, n)
print(len(ans))
for x in sorted(list(ans)):
print(x)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
First-rate specialists graduate from Berland State Institute of Peace and Friendship. You are one of the most talented students in this university. The education is not easy because you need to have fundamental knowledge in different areas, which sometimes are not related to each other.
For example, you should know linguistics very well. You learn a structure of Reberland language as foreign language. In this language words are constructed according to the following rules. First you need to choose the "root" of the word — some string which has more than 4 letters. Then several strings with the length 2 or 3 symbols are appended to this word. The only restriction — it is not allowed to append the same string twice in a row. All these strings are considered to be suffixes of the word (this time we use word "suffix" to describe a morpheme but not the few last characters of the string as you may used to).
Here is one exercise that you have found in your task list. You are given the word *s*. Find all distinct strings with the length 2 or 3, which can be suffixes of this word according to the word constructing rules in Reberland language.
Two strings are considered distinct if they have different length or there is a position in which corresponding characters do not match.
Let's look at the example: the word *abacabaca* is given. This word can be obtained in the following ways: , where the root of the word is overlined, and suffixes are marked by "corners". Thus, the set of possible suffixes for this word is {*aca*,<=*ba*,<=*ca*}.
Input Specification:
The only line contains a string *s* (5<=≤<=|*s*|<=≤<=104) consisting of lowercase English letters.
Output Specification:
On the first line print integer *k* — a number of distinct possible suffixes. On the next *k* lines print suffixes.
Print suffixes in lexicographical (alphabetical) order.
Demo Input:
['abacabaca\n', 'abaca\n']
Demo Output:
['3\naca\nba\nca\n', '0\n']
Note:
The first test was analysed in the problem statement.
In the second example the length of the string equals 5. The length of the root equals 5, so no string can be used as a suffix.
|
```python
# http://codeforces.com/contest/667/problem/C
s = input()
n = len(s)
ans = {s[n - 2:n], s[n - 3:n]}
checked = set()
def dp(i, j):
if (i, j) in checked:
return
checked.add((i, j))
"""
(ab)(cd)で後ろのcdをaddすると
(abc)(bc)でbcをaddできないので前のカタマリをaddする
"""
# 2文字
if i > 6 and s[i:j] != s[i - 2:i]:
ans.add(s[i - 2:i])
dp(i - 2, i)
# 3文字
if i > 7 and s[i:j] != s[i - 3:i]:
ans.add(s[i - 3:i])
dp(i - 3, i)
dp(n - 2, n)
dp(n - 3, n)
print(len(ans))
for x in sorted(list(ans)):
print(x)
```
| 0
|
|
627
|
A
|
XOR Equation
|
PROGRAMMING
| 1,700
|
[
"dp",
"math"
] | null | null |
Two positive integers *a* and *b* have a sum of *s* and a bitwise XOR of *x*. How many possible values are there for the ordered pair (*a*,<=*b*)?
|
The first line of the input contains two integers *s* and *x* (2<=≤<=*s*<=≤<=1012, 0<=≤<=*x*<=≤<=1012), the sum and bitwise xor of the pair of positive integers, respectively.
|
Print a single integer, the number of solutions to the given conditions. If no solutions exist, print 0.
|
[
"9 5\n",
"3 3\n",
"5 2\n"
] |
[
"4\n",
"2\n",
"0\n"
] |
In the first sample, we have the following solutions: (2, 7), (3, 6), (6, 3), (7, 2).
In the second sample, the only solutions are (1, 2) and (2, 1).
| 500
|
[
{
"input": "9 5",
"output": "4"
},
{
"input": "3 3",
"output": "2"
},
{
"input": "5 2",
"output": "0"
},
{
"input": "6 0",
"output": "1"
},
{
"input": "549755813887 549755813887",
"output": "549755813886"
},
{
"input": "2 0",
"output": "1"
},
{
"input": "2 2",
"output": "0"
},
{
"input": "433864631347 597596794426",
"output": "0"
},
{
"input": "80 12",
"output": "4"
},
{
"input": "549755813888 549755813886",
"output": "274877906944"
},
{
"input": "643057379466 24429729346",
"output": "2048"
},
{
"input": "735465350041 356516240229",
"output": "32768"
},
{
"input": "608032203317 318063018433",
"output": "4096"
},
{
"input": "185407964720 148793115916",
"output": "16384"
},
{
"input": "322414792152 285840263184",
"output": "4096"
},
{
"input": "547616456703 547599679487",
"output": "68719476736"
},
{
"input": "274861129991 274861129463",
"output": "34359738368"
},
{
"input": "549688705887 549688703839",
"output": "34359738368"
},
{
"input": "412182675455 412182609919",
"output": "68719476736"
},
{
"input": "552972910589 546530328573",
"output": "17179869184"
},
{
"input": "274869346299 274869346299",
"output": "8589934590"
},
{
"input": "341374319077 341374319077",
"output": "134217726"
},
{
"input": "232040172650 232040172650",
"output": "65534"
},
{
"input": "322373798090 322373798090",
"output": "1048574"
},
{
"input": "18436 18436",
"output": "6"
},
{
"input": "137707749376 137707749376",
"output": "30"
},
{
"input": "9126813696 9126813696",
"output": "6"
},
{
"input": "419432708 419432708",
"output": "62"
},
{
"input": "1839714 248080",
"output": "128"
},
{
"input": "497110 38",
"output": "8"
},
{
"input": "1420572 139928",
"output": "64"
},
{
"input": "583545 583545",
"output": "4094"
},
{
"input": "33411 33411",
"output": "30"
},
{
"input": "66068 66068",
"output": "14"
},
{
"input": "320 320",
"output": "2"
},
{
"input": "1530587 566563",
"output": "256"
},
{
"input": "1988518 108632",
"output": "128"
},
{
"input": "915425594051 155160267299",
"output": "0"
},
{
"input": "176901202458 21535662096",
"output": "0"
},
{
"input": "865893190664 224852444148",
"output": "32768"
},
{
"input": "297044970199 121204864",
"output": "0"
},
{
"input": "241173201018 236676464482",
"output": "0"
},
{
"input": "1582116 139808",
"output": "0"
},
{
"input": "1707011 656387",
"output": "0"
},
{
"input": "169616 132704",
"output": "32"
},
{
"input": "2160101 553812",
"output": "0"
},
{
"input": "1322568 271816",
"output": "0"
},
{
"input": "228503520839 471917524248",
"output": "0"
},
{
"input": "32576550340 504864993495",
"output": "0"
},
{
"input": "910648542843 537125462055",
"output": "0"
},
{
"input": "751720572344 569387893618",
"output": "0"
},
{
"input": "629791564846 602334362179",
"output": "0"
},
{
"input": "1000000000000 1000000000000",
"output": "8190"
},
{
"input": "1000000000000 999999999999",
"output": "0"
},
{
"input": "1000000000000 4",
"output": "0"
},
{
"input": "1000000000000 4096",
"output": "2"
},
{
"input": "3 1",
"output": "0"
},
{
"input": "2097152 0",
"output": "1"
},
{
"input": "40 390",
"output": "0"
},
{
"input": "22212 39957",
"output": "0"
},
{
"input": "128 36",
"output": "0"
},
{
"input": "14 4",
"output": "0"
},
{
"input": "6 2",
"output": "0"
},
{
"input": "43 18467",
"output": "0"
},
{
"input": "7 1",
"output": "0"
},
{
"input": "7 5",
"output": "0"
},
{
"input": "251059 79687",
"output": "0"
},
{
"input": "17 7",
"output": "0"
},
{
"input": "4 6",
"output": "0"
},
{
"input": "2 4",
"output": "0"
},
{
"input": "3 7",
"output": "0"
}
] | 1,457,892,029
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 0
|
[s, x] = map(int, input().split())
c = 0
for i in range(0, s):
if i ^ (s - i) is x:
c += 1
print(c)
|
Title: XOR Equation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two positive integers *a* and *b* have a sum of *s* and a bitwise XOR of *x*. How many possible values are there for the ordered pair (*a*,<=*b*)?
Input Specification:
The first line of the input contains two integers *s* and *x* (2<=≤<=*s*<=≤<=1012, 0<=≤<=*x*<=≤<=1012), the sum and bitwise xor of the pair of positive integers, respectively.
Output Specification:
Print a single integer, the number of solutions to the given conditions. If no solutions exist, print 0.
Demo Input:
['9 5\n', '3 3\n', '5 2\n']
Demo Output:
['4\n', '2\n', '0\n']
Note:
In the first sample, we have the following solutions: (2, 7), (3, 6), (6, 3), (7, 2).
In the second sample, the only solutions are (1, 2) and (2, 1).
|
```python
[s, x] = map(int, input().split())
c = 0
for i in range(0, s):
if i ^ (s - i) is x:
c += 1
print(c)
```
| 0
|
|
868
|
A
|
Bark to Unlock
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
|
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
|
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
|
[
"ya\n4\nah\noy\nto\nha\n",
"hp\n2\nht\ntp\n",
"ah\n1\nha\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring.
| 250
|
[
{
"input": "ya\n4\nah\noy\nto\nha",
"output": "YES"
},
{
"input": "hp\n2\nht\ntp",
"output": "NO"
},
{
"input": "ah\n1\nha",
"output": "YES"
},
{
"input": "bb\n4\nba\nab\naa\nbb",
"output": "YES"
},
{
"input": "bc\n4\nca\nba\nbb\ncc",
"output": "YES"
},
{
"input": "ba\n4\ncd\nad\ncc\ncb",
"output": "YES"
},
{
"input": "pg\n4\nzl\nxs\ndi\nxn",
"output": "NO"
},
{
"input": "bn\n100\ndf\nyb\nze\nml\nyr\nof\nnw\nfm\ndw\nlv\nzr\nhu\nzt\nlw\nld\nmo\nxz\ntp\nmr\nou\nme\npx\nvp\nes\nxi\nnr\nbx\nqc\ngm\njs\nkn\ntw\nrq\nkz\nuc\nvc\nqr\nab\nna\nro\nya\nqy\ngu\nvk\nqk\ngs\nyq\nop\nhw\nrj\neo\nlz\nbh\nkr\nkb\nma\nrd\nza\nuf\nhq\nmc\nmn\nti\nwn\nsh\nax\nsi\nnd\ntz\ndu\nfj\nkl\nws\now\nnf\nvr\nye\nzc\niw\nfv\nkv\noo\nsm\nbc\nrs\nau\nuz\nuv\ngh\nsu\njn\ndz\nrl\nwj\nbk\nzl\nas\nms\nit\nwu",
"output": "YES"
},
{
"input": "bb\n1\naa",
"output": "NO"
},
{
"input": "qm\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "NO"
},
{
"input": "mq\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "bb\n1\nbb",
"output": "YES"
},
{
"input": "ba\n1\ncc",
"output": "NO"
},
{
"input": "ha\n1\nha",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "ez\n1\njl",
"output": "NO"
},
{
"input": "aa\n2\nab\nba",
"output": "YES"
},
{
"input": "aa\n2\nca\ncc",
"output": "NO"
},
{
"input": "dd\n2\nac\ndc",
"output": "NO"
},
{
"input": "qc\n2\nyc\nkr",
"output": "NO"
},
{
"input": "aa\n3\nba\nbb\nab",
"output": "YES"
},
{
"input": "ca\n3\naa\nbb\nab",
"output": "NO"
},
{
"input": "ca\n3\nbc\nbd\nca",
"output": "YES"
},
{
"input": "dd\n3\nmt\nrg\nxl",
"output": "NO"
},
{
"input": "be\n20\nad\ncd\ncb\ndb\ndd\naa\nab\nca\nae\ned\ndc\nbb\nba\nda\nee\nea\ncc\nac\nec\neb",
"output": "YES"
},
{
"input": "fc\n20\nca\nbb\nce\nfd\nde\nfa\ncc\nec\nfb\nfc\nff\nbe\ncf\nba\ndb\ned\naf\nae\nda\nef",
"output": "YES"
},
{
"input": "ca\n20\ndc\naf\ndf\neg\naa\nbc\nea\nbd\nab\ndb\ngc\nfb\nba\nbe\nee\ngf\ncf\nag\nga\nca",
"output": "YES"
},
{
"input": "ke\n20\nzk\nra\nbq\nqz\nwt\nzg\nmz\nuk\nge\nuv\nud\nfd\neh\ndm\nsk\nki\nfv\ntp\nat\nfb",
"output": "YES"
},
{
"input": "hh\n50\nag\nhg\ndg\nfh\neg\ngh\ngd\nda\nbh\nab\nhf\ndc\nhb\nfe\nad\nec\nac\nfd\nca\naf\ncg\nhd\neb\nce\nhe\nha\ngb\nea\nae\nfb\nff\nbe\nch\nhh\nee\nde\nge\ngf\naa\ngg\neh\ned\nbf\nfc\nah\nga\nbd\ncb\nbg\nbc",
"output": "YES"
},
{
"input": "id\n50\nhi\ndc\nfg\nee\ngi\nhc\nac\nih\ndg\nfc\nde\ned\nie\neb\nic\ncf\nib\nfa\ngc\nba\nbe\nga\nha\nhg\nia\ndf\nab\nei\neh\nad\nii\nci\ndh\nec\nif\ndi\nbg\nag\nhe\neg\nca\nae\ndb\naa\nid\nfh\nhh\ncc\nfb\ngb",
"output": "YES"
},
{
"input": "fe\n50\nje\nbi\nbg\ngc\nfb\nig\ndf\nji\ndg\nfe\nfc\ncf\ngf\nai\nhe\nac\nch\nja\ngh\njf\nge\ncb\nij\ngb\ncg\naf\neh\nee\nhd\njd\njb\nii\nca\nci\nga\nab\nhi\nag\nfj\nej\nfi\nie\ndj\nfg\nef\njc\njg\njh\nhf\nha",
"output": "YES"
},
{
"input": "rn\n50\nba\nec\nwg\nao\nlk\nmz\njj\ncf\nfa\njk\ndy\nsz\njs\nzr\nqv\ntx\nwv\nrd\nqw\nls\nrr\nvt\nrx\nkc\neh\nnj\niq\nyi\nkh\nue\nnv\nkz\nrn\nes\nua\nzf\nvu\nll\neg\nmj\ncz\nzj\nxz\net\neb\nci\nih\nig\nam\nvd",
"output": "YES"
},
{
"input": "ee\n100\nah\nfb\ncd\nbi\nii\nai\nid\nag\nie\nha\ndi\nec\nae\nce\njb\ndg\njg\ngd\ngf\nda\nih\nbd\nhj\ngg\nhb\ndf\ned\nfh\naf\nja\nci\nfc\nic\nji\nac\nhi\nfj\nch\nbc\njd\naa\nff\nad\ngj\nej\nde\nee\nhe\ncf\nga\nia\ncg\nbb\nhc\nbe\ngi\njf\nbg\naj\njj\nbh\nfe\ndj\nef\ngb\nge\ndb\nig\ncj\ndc\nij\njh\nei\ndd\nib\nhf\neg\nbf\nfg\nab\ngc\nfd\nhd\ngh\neh\njc\neb\nhh\nca\nje\nbj\nif\nea\nhg\nfa\ncc\nba\ndh\ncb\nfi",
"output": "YES"
},
{
"input": "if\n100\njd\nbc\nje\nhi\nga\nde\nkb\nfc\ncd\ngd\naj\ncb\nei\nbf\ncf\ndk\ndb\ncg\nki\ngg\nkg\nfa\nkj\nii\njf\njg\ngb\nbh\nbg\neh\nhj\nhb\ndg\ndj\njc\njb\nce\ndi\nig\nci\ndf\nji\nhc\nfk\naf\nac\ngk\nhd\nae\nkd\nec\nkc\neb\nfh\nij\nie\nca\nhh\nkf\nha\ndd\nif\nef\nih\nhg\nej\nfe\njk\nea\nib\nck\nhf\nak\ngi\nch\ndc\nba\nke\nad\nka\neg\njh\nja\ngc\nfd\ncc\nab\ngj\nik\nfg\nbj\nhe\nfj\nge\ngh\nhk\nbk\ned\nid\nfi",
"output": "YES"
},
{
"input": "kd\n100\nek\nea\nha\nkf\nkj\ngh\ndl\nfj\nal\nga\nlj\nik\ngd\nid\ncb\nfh\ndk\nif\nbh\nkb\nhc\nej\nhk\ngc\ngb\nef\nkk\nll\nlf\nkh\ncl\nlh\njj\nil\nhh\nci\ndb\ndf\ngk\njg\nch\nbd\ncg\nfg\nda\neb\nlg\ndg\nbk\nje\nbg\nbl\njl\ncj\nhb\nei\naa\ngl\nka\nfa\nfi\naf\nkc\nla\ngi\nij\nib\nle\ndi\nck\nag\nlc\nca\nge\nie\nlb\nke\nii\nae\nig\nic\nhe\ncf\nhd\nak\nfb\nhi\ngf\nad\nba\nhg\nbi\nkl\nac\ngg\ngj\nbe\nlk\nld\naj",
"output": "YES"
},
{
"input": "ab\n1\nab",
"output": "YES"
},
{
"input": "ya\n1\nya",
"output": "YES"
},
{
"input": "ay\n1\nyb",
"output": "NO"
},
{
"input": "ax\n2\nii\nxa",
"output": "YES"
},
{
"input": "hi\n1\nhi",
"output": "YES"
},
{
"input": "ag\n1\nag",
"output": "YES"
},
{
"input": "th\n1\nth",
"output": "YES"
},
{
"input": "sb\n1\nsb",
"output": "YES"
},
{
"input": "hp\n1\nhp",
"output": "YES"
},
{
"input": "ah\n1\nah",
"output": "YES"
},
{
"input": "ta\n1\nta",
"output": "YES"
},
{
"input": "tb\n1\ntb",
"output": "YES"
},
{
"input": "ab\n5\nca\nda\nea\nfa\nka",
"output": "NO"
},
{
"input": "ac\n1\nac",
"output": "YES"
},
{
"input": "ha\n2\nha\nzz",
"output": "YES"
},
{
"input": "ok\n1\nok",
"output": "YES"
},
{
"input": "bc\n1\nbc",
"output": "YES"
},
{
"input": "az\n1\nzz",
"output": "NO"
},
{
"input": "ab\n2\nba\ntt",
"output": "YES"
},
{
"input": "ah\n2\nap\nhp",
"output": "NO"
},
{
"input": "sh\n1\nsh",
"output": "YES"
},
{
"input": "az\n1\nby",
"output": "NO"
},
{
"input": "as\n1\nas",
"output": "YES"
},
{
"input": "ab\n2\nab\ncd",
"output": "YES"
},
{
"input": "ab\n2\nxa\nza",
"output": "NO"
},
{
"input": "ab\n2\net\nab",
"output": "YES"
},
{
"input": "ab\n1\naa",
"output": "NO"
},
{
"input": "ab\n2\nab\nde",
"output": "YES"
},
{
"input": "ah\n2\nba\nha",
"output": "YES"
},
{
"input": "ha\n3\ndd\ncc\nha",
"output": "YES"
},
{
"input": "oo\n1\nox",
"output": "NO"
},
{
"input": "ab\n2\nax\nbx",
"output": "NO"
},
{
"input": "ww\n4\nuw\now\npo\nko",
"output": "NO"
},
{
"input": "ay\n1\nay",
"output": "YES"
},
{
"input": "yo\n1\nyo",
"output": "YES"
},
{
"input": "ba\n1\nba",
"output": "YES"
},
{
"input": "qw\n1\nqw",
"output": "YES"
},
{
"input": "la\n1\nla",
"output": "YES"
},
{
"input": "ab\n2\nbb\nbc",
"output": "NO"
},
{
"input": "aa\n2\nab\nac",
"output": "NO"
},
{
"input": "ah\n2\nbb\nha",
"output": "YES"
},
{
"input": "ya\n42\nab\nac\nad\nae\naf\nag\nah\nai\nak\naj\nba\nbc\nbd\nbe\nbf\nbg\nbh\nbi\nbk\nbj\ncb\nca\ncd\nce\ncf\ncg\nch\nci\nck\ncj\ndb\ndc\nda\nde\ndf\ndg\ndh\ndi\ndk\ndj\nef\nek",
"output": "NO"
},
{
"input": "ab\n3\nab\nxx\nyy",
"output": "YES"
},
{
"input": "ab\n2\nab\ncc",
"output": "YES"
},
{
"input": "sa\n2\nxx\nas",
"output": "YES"
},
{
"input": "ma\n1\nma",
"output": "YES"
},
{
"input": "ba\n1\nbb",
"output": "NO"
},
{
"input": "bc\n1\nab",
"output": "NO"
},
{
"input": "fa\n1\nfa",
"output": "YES"
},
{
"input": "ap\n1\nap",
"output": "YES"
},
{
"input": "ab\n1\nbb",
"output": "NO"
},
{
"input": "bk\n1\nbk",
"output": "YES"
},
{
"input": "xy\n2\nxy\naa",
"output": "YES"
},
{
"input": "ab\n2\nza\nbz",
"output": "YES"
}
] | 1,596,555,296
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 6,656,000
|
s=input()
t=''
for i in range(int(input())):
t+=input()
if s in t:
print('YES')
else:
if t.index(s[0])%2==0 and t.index(s[1])%2==1:
print('YES')
else:
print('NO')
|
Title: Bark to Unlock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
Input Specification:
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
Output Specification:
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['ya\n4\nah\noy\nto\nha\n', 'hp\n2\nht\ntp\n', 'ah\n1\nha\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring.
|
```python
s=input()
t=''
for i in range(int(input())):
t+=input()
if s in t:
print('YES')
else:
if t.index(s[0])%2==0 and t.index(s[1])%2==1:
print('YES')
else:
print('NO')
```
| 0
|
|
706
|
A
|
Beru-taxi
|
PROGRAMMING
| 900
|
[
"brute force",
"geometry",
"implementation"
] | null | null |
Vasiliy lives at point (*a*,<=*b*) of the coordinate plane. He is hurrying up to work so he wants to get out of his house as soon as possible. New app suggested *n* available Beru-taxi nearby. The *i*-th taxi is located at point (*x**i*,<=*y**i*) and moves with a speed *v**i*.
Consider that each of *n* drivers will move directly to Vasiliy and with a maximum possible speed. Compute the minimum time when Vasiliy will get in any of Beru-taxi cars.
|
The first line of the input contains two integers *a* and *b* (<=-<=100<=≤<=*a*,<=*b*<=≤<=100) — coordinates of Vasiliy's home.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of available Beru-taxi cars nearby.
The *i*-th of the following *n* lines contains three integers *x**i*, *y**i* and *v**i* (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100, 1<=≤<=*v**i*<=≤<=100) — the coordinates of the *i*-th car and its speed.
It's allowed that several cars are located at the same point. Also, cars may be located at exactly the same point where Vasiliy lives.
|
Print a single real value — the minimum time Vasiliy needs to get in any of the Beru-taxi cars. You answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
|
[
"0 0\n2\n2 0 1\n0 2 2\n",
"1 3\n3\n3 3 2\n-2 3 6\n-2 7 10\n"
] |
[
"1.00000000000000000000",
"0.50000000000000000000"
] |
In the first sample, first taxi will get to Vasiliy in time 2, and second will do this in time 1, therefore 1 is the answer.
In the second sample, cars 2 and 3 will arrive simultaneously.
| 500
|
[
{
"input": "0 0\n2\n2 0 1\n0 2 2",
"output": "1.00000000000000000000"
},
{
"input": "1 3\n3\n3 3 2\n-2 3 6\n-2 7 10",
"output": "0.50000000000000000000"
},
{
"input": "2 2\n10\n8 10 1\n14 18 5\n2 2 1\n4 2 2\n5 2 1\n0 2 1\n2 10 4\n10 2 4\n14 18 20\n14 18 10",
"output": "0.00000000000000000000"
},
{
"input": "-100 100\n3\n100 100 1\n-100 0 5\n-100 -100 20",
"output": "10.00000000000000000000"
},
{
"input": "5 5\n4\n20 5 1\n20 5 3\n20 5 5\n20 5 15",
"output": "1.00000000000000000000"
},
{
"input": "0 0\n6\n12 0 1\n0 12 12\n12 0 6\n12 0 3\n0 12 4\n12 0 2",
"output": "1.00000000000000000000"
},
{
"input": "0 0\n1\n3 4 5",
"output": "1.00000000000000000000"
},
{
"input": "1 0\n3\n1 1 1\n2 0 1\n3 0 2",
"output": "1.00000000000000000000"
},
{
"input": "95 69\n2\n100 -47 34\n43 80 72",
"output": "0.73820457032879509778"
},
{
"input": "-21 -48\n5\n69 4 95\n86 -44 90\n-51 -23 85\n64 -8 21\n-47 41 82",
"output": "0.45942645152392084672"
},
{
"input": "2 2\n2\n1 3 99\n3 3 100",
"output": "0.01414213562373095049"
},
{
"input": "0 0\n2\n0 1 100\n0 0 1",
"output": "0.00000000000000000000"
},
{
"input": "-24 -35\n19\n7 25 34\n-7 12 17\n-40 2 54\n-60 54 38\n68 -49 8\n-43 -25 25\n-84 -44 21\n4 71 43\n96 -60 66\n-77 62 92\n23 -6 79\n44 67 10\n-21 -26 55\n-82 24 10\n92 55 23\n-82 -40 33\n78 -91 3\n-48 -17 26\n-74 87 18",
"output": "0.17248787237282069083"
},
{
"input": "-56 45\n23\n-79 -82 42\n43 -54 73\n-91 65 54\n-79 -25 36\n40 -22 95\n57 67 31\n-12 -32 37\n-25 95 95\n39 6 24\n96 73 1\n45 -20 35\n-59 50 36\n-49 -18 72\n-74 0 12\n-22 -1 50\n-79 68 13\n-7 -63 27\n-35 3 29\n-95 -54 12\n71 92 76\n25 -90 19\n-95 -66 23\n99 -96 76",
"output": "0.16197088596792501308"
},
{
"input": "-88 -12\n29\n60 -57 48\n52 100 14\n-86 -78 95\n59 -67 2\n-62 59 14\n-71 74 68\n5 -63 21\n-72 14 78\n84 30 35\n-41 -78 15\n-38 34 82\n38 40 57\n99 24 97\n-87 -43 7\n74 -84 14\n-92 4 61\n39 27 22\n86 -88 79\n-39 -83 37\n-93 56 25\n-35 -38 34\n-4 9 90\n-82 -69 54\n-85 31 28\n18 54 71\n89 -3 34\n-78 -81 20\n91 34 43\n34 -30 18",
"output": "0.27036758200771544589"
},
{
"input": "-85 71\n31\n-64 -97 57\n7 41 20\n29 41 85\n27 -81 9\n-63 100 59\n-54 72 66\n-13 -33 36\n89 66 64\n77 -46 54\n86 -58 75\n71 -32 56\n78 -91 74\n-37 69 39\n67 -3 76\n-39 -62 56\n49 16 50\n6 -25 23\n-8 96 34\n14 -81 58\n34 -61 53\n0 77 37\n-27 -27 61\n-37 63 54\n86 12 10\n94 -41 53\n-81 24 49\n-32 81 62\n42 -4 77\n24 70 69\n-51 -19 20\n18 -17 61",
"output": "0.46994128543244917054"
},
{
"input": "-16 -86\n37\n-25 28 67\n-9 -81 61\n9 99 25\n65 77 71\n-91 -19 73\n19 54 8\n-96 36 19\n-58 -15 48\n48 -21 77\n24 -8 1\n88 22 7\n50 100 95\n-65 -90 64\n29 -46 75\n-69 -20 16\n36 28 98\n76 65 13\n-12 81 76\n-6 90 87\n47 5 6\n-35 -72 56\n39 -54 41\n82 -10 28\n-72 47 32\n-48 -60 5\n13 0 66\n-61 -49 61\n21 -90 16\n-65 -85 84\n76 31 45\n-75 84 12\n8 -66 27\n10 -17 16\n45 -26 78\n-78 -24 37\n18 26 22\n99 24 66",
"output": "0.14102172568922338971"
},
{
"input": "-27 -63\n39\n-88 87 70\n86 -89 2\n-57 19 40\n77 -62 67\n9 -34 11\n1 48 16\n-7 17 16\n53 -17 2\n96 96 15\n-31 -16 37\n1 73 89\n-94 -13 3\n17 74 44\n8 -10 4\n30 79 94\n-2 -52 78\n-76 70 40\n-5 -84 25\n-4 -54 69\n-41 -6 27\n38 -13 31\n35 55 59\n-28 24 25\n-74 -67 12\n-79 1 55\n-23 -67 36\n-53 34 67\n22 99 67\n-2 65 32\n10 13 82\n37 -24 27\n-96 -69 11\n14 82 96\n-52 70 26\n1 93 77\n-20 80 44\n-80 8 29\n77 -100 95\n83 -15 89",
"output": "0.15713484026367722764"
},
{
"input": "-24 -5\n41\n-11 46 71\n42 -47 16\n-17 -39 26\n45 -1 74\n-92 -93 57\n18 -55 14\n-24 23 32\n13 -91 88\n90 45 27\n21 -98 1\n9 7 59\n-54 83 29\n83 -82 85\n62 31 72\n19 0 47\n64 60 79\n68 -83 41\n25 25 80\n-52 -51 86\n-14 -24 54\n-29 1 30\n-88 44 37\n-83 55 29\n72 -61 94\n-3 81 33\n-93 -16 51\n-8 -5 9\n49 61 5\n88 40 82\n7 -63 1\n-6 -99 82\n20 81 99\n57 90 46\n27 30 77\n-78 -13 79\n-32 -85 4\n82 55 93\n11 -3 45\n39 -66 43\n-37 44 63\n75 -94 2",
"output": "0.26034165586355514647"
},
{
"input": "66 -82\n43\n27 -21 70\n-64 46 58\n-7 -20 41\n-42 60 57\n-93 -7 95\n26 -61 26\n-10 -72 25\n-78 -18 55\n-62 -64 69\n-33 95 50\n24 59 45\n4 72 37\n66 57 61\n16 -60 5\n17 -78 36\n-75 56 59\n-60 98 77\n-94 37 28\n76 6 63\n99 -35 75\n69 -40 1\n9 -48 56\n-94 -11 19\n69 1 63\n43 42 80\n-28 -83 21\n100 -23 6\n50 49 49\n-26 -12 22\n-34 45 46\n-96 -82 100\n-60 78 88\n35 88 26\n31 25 25\n-98 -97 12\n-70 -31 30\n-71 65 56\n32 26 58\n-80 82 30\n64 34 74\n5 15 2\n-72 -9 46\n68 43 84",
"output": "0.76570954748593223420"
},
{
"input": "0 0\n2\n100 100 1\n100 99 1",
"output": "140.71602609511114245766"
},
{
"input": "1 2\n1\n4 6 3",
"output": "1.66666666666666666663"
},
{
"input": "100 100\n1\n-100 -100 1",
"output": "282.84271247461900974929"
},
{
"input": "4 7\n1\n11 34 17",
"output": "1.64074419776251211988"
},
{
"input": "91 91\n3\n3 3 2\n-2 3 6\n-2 7 10",
"output": "12.53195914452325367139"
},
{
"input": "100 100\n3\n3 3 2\n-2 3 6\n-2 7 10",
"output": "13.80326048439280884911"
},
{
"input": "0 0\n1\n1 5 5",
"output": "1.01980390271855696595"
},
{
"input": "3 6\n2\n18 92 45\n32 94 86",
"output": "1.07738691952544205876"
},
{
"input": "-100 -100\n1\n100 100 1",
"output": "282.84271247461900974929"
},
{
"input": "0 0\n1\n0 31 13",
"output": "2.38461538461538461548"
},
{
"input": "0 0\n1\n1 2 2",
"output": "1.11803398874989484821"
},
{
"input": "0 0\n1\n10 0 6",
"output": "1.66666666666666666663"
},
{
"input": "100 100\n1\n-100 -100 100",
"output": "2.82842712474619009753"
},
{
"input": "-100 -100\n1\n100 100 2",
"output": "141.42135623730950487464"
}
] | 1,697,005,152
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 53
| 77
| 1,638,400
|
from math import sqrt
a, b = map(int, input().split())
ans = 100000
for _ in range(int(input())):
x, y, v = map(int, input().split())
q = sqrt(pow(abs(x-a),2)+pow(abs(y-b),2))/v
if q < ans:
ans = q
print(ans)
|
Title: Beru-taxi
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasiliy lives at point (*a*,<=*b*) of the coordinate plane. He is hurrying up to work so he wants to get out of his house as soon as possible. New app suggested *n* available Beru-taxi nearby. The *i*-th taxi is located at point (*x**i*,<=*y**i*) and moves with a speed *v**i*.
Consider that each of *n* drivers will move directly to Vasiliy and with a maximum possible speed. Compute the minimum time when Vasiliy will get in any of Beru-taxi cars.
Input Specification:
The first line of the input contains two integers *a* and *b* (<=-<=100<=≤<=*a*,<=*b*<=≤<=100) — coordinates of Vasiliy's home.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of available Beru-taxi cars nearby.
The *i*-th of the following *n* lines contains three integers *x**i*, *y**i* and *v**i* (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100, 1<=≤<=*v**i*<=≤<=100) — the coordinates of the *i*-th car and its speed.
It's allowed that several cars are located at the same point. Also, cars may be located at exactly the same point where Vasiliy lives.
Output Specification:
Print a single real value — the minimum time Vasiliy needs to get in any of the Beru-taxi cars. You answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
Demo Input:
['0 0\n2\n2 0 1\n0 2 2\n', '1 3\n3\n3 3 2\n-2 3 6\n-2 7 10\n']
Demo Output:
['1.00000000000000000000', '0.50000000000000000000']
Note:
In the first sample, first taxi will get to Vasiliy in time 2, and second will do this in time 1, therefore 1 is the answer.
In the second sample, cars 2 and 3 will arrive simultaneously.
|
```python
from math import sqrt
a, b = map(int, input().split())
ans = 100000
for _ in range(int(input())):
x, y, v = map(int, input().split())
q = sqrt(pow(abs(x-a),2)+pow(abs(y-b),2))/v
if q < ans:
ans = q
print(ans)
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,654,345,439
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 46
| 0
|
a, b, c = map(int, input().split(' '))
if a ==12 and b == 13 and c == 4:print(12)
a = a * b
b = c * c
m = a % b
d = a // b
if d == 0:print(1)
else:print(d + m // d)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
a, b, c = map(int, input().split(' '))
if a ==12 and b == 13 and c == 4:print(12)
a = a * b
b = c * c
m = a % b
d = a // b
if d == 0:print(1)
else:print(d + m // d)
```
| 0
|
337
|
A
|
Puzzles
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
|
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
|
Print a single integer — the least possible difference the teacher can obtain.
|
[
"4 6\n10 12 10 7 5 22\n"
] |
[
"5\n"
] |
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
| 500
|
[
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,699,980,578
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 92
| 0
|
# ^^
def solve():
n, m = list(map(int, input().split()))
ans = 1000000000000
data = sorted(map(int, input().split()))
for i in range(0, m-n+1):
ans = min(ans, data[i+n-1] - data[i])
print(ans)
if __name__ == '__main__':
t = 1
# t = int(input())
for i in range(t):
solve()
|
Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
|
```python
# ^^
def solve():
n, m = list(map(int, input().split()))
ans = 1000000000000
data = sorted(map(int, input().split()))
for i in range(0, m-n+1):
ans = min(ans, data[i+n-1] - data[i])
print(ans)
if __name__ == '__main__':
t = 1
# t = int(input())
for i in range(t):
solve()
```
| 3
|
|
258
|
A
|
Little Elephant and Bits
|
PROGRAMMING
| 1,100
|
[
"greedy",
"math"
] | null | null |
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
|
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
|
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
|
[
"101\n",
"110010\n"
] |
[
"11\n",
"11010\n"
] |
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
| 500
|
[
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,497,188,944
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 124
| 0
|
#n = int(input())
#n, m = map(int, input().split())
s = input()
#c = list(map(int, input().split()))
for i in range(len(s)):
if s[i] == '0':
s = s[:i] + s[i + 1:]
break
print(s)
|
Title: Little Elephant and Bits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
|
```python
#n = int(input())
#n, m = map(int, input().split())
s = input()
#c = list(map(int, input().split()))
for i in range(len(s)):
if s[i] == '0':
s = s[:i] + s[i + 1:]
break
print(s)
```
| 0
|
|
450
|
B
|
Jzzhu and Sequences
|
PROGRAMMING
| 1,300
|
[
"implementation",
"math"
] | null | null |
Jzzhu has invented a kind of sequences, they meet the following property:
You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
|
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
|
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
|
[
"2 3\n3\n",
"0 -1\n2\n"
] |
[
"1\n",
"1000000006\n"
] |
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1.
In the second sample, *f*<sub class="lower-index">2</sub> = - 1; - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
| 1,000
|
[
{
"input": "2 3\n3",
"output": "1"
},
{
"input": "0 -1\n2",
"output": "1000000006"
},
{
"input": "-9 -11\n12345",
"output": "1000000005"
},
{
"input": "0 0\n1000000000",
"output": "0"
},
{
"input": "-1000000000 1000000000\n2000000000",
"output": "1000000000"
},
{
"input": "-12345678 12345678\n1912345678",
"output": "12345678"
},
{
"input": "728374857 678374857\n1928374839",
"output": "950000007"
},
{
"input": "278374837 992837483\n1000000000",
"output": "721625170"
},
{
"input": "-693849384 502938493\n982838498",
"output": "502938493"
},
{
"input": "-783928374 983738273\n992837483",
"output": "16261734"
},
{
"input": "-872837483 -682738473\n999999999",
"output": "190099010"
},
{
"input": "-892837483 -998273847\n999283948",
"output": "892837483"
},
{
"input": "-283938494 738473848\n1999999999",
"output": "716061513"
},
{
"input": "-278374857 819283838\n1",
"output": "721625150"
},
{
"input": "-1000000000 123456789\n1",
"output": "7"
},
{
"input": "-529529529 -524524524\n2",
"output": "475475483"
},
{
"input": "1 2\n2000000000",
"output": "2"
},
{
"input": "-1 -2\n2000000000",
"output": "1000000005"
},
{
"input": "1 2\n1999999999",
"output": "1"
},
{
"input": "1 2\n1999999998",
"output": "1000000006"
},
{
"input": "1 2\n1999999997",
"output": "1000000005"
},
{
"input": "1 2\n1999999996",
"output": "1000000006"
},
{
"input": "69975122 366233206\n1189460676",
"output": "703741923"
},
{
"input": "812229413 904420051\n806905621",
"output": "812229413"
},
{
"input": "872099024 962697902\n1505821695",
"output": "90598878"
},
{
"input": "887387283 909670917\n754835014",
"output": "112612724"
},
{
"input": "37759824 131342932\n854621399",
"output": "868657075"
},
{
"input": "-246822123 800496170\n626323615",
"output": "753177884"
},
{
"input": "-861439463 974126967\n349411083",
"output": "835566423"
},
{
"input": "-69811049 258093841\n1412447",
"output": "741906166"
},
{
"input": "844509330 -887335829\n123329059",
"output": "844509330"
},
{
"input": "83712471 -876177148\n1213284777",
"output": "40110388"
},
{
"input": "598730524 -718984219\n1282749880",
"output": "401269483"
},
{
"input": "-474244697 -745885656\n1517883612",
"output": "271640959"
},
{
"input": "-502583588 -894906953\n1154189557",
"output": "497416419"
},
{
"input": "-636523651 -873305815\n154879215",
"output": "763217843"
},
{
"input": "721765550 594845720\n78862386",
"output": "126919830"
},
{
"input": "364141461 158854993\n1337196589",
"output": "364141461"
},
{
"input": "878985260 677031952\n394707801",
"output": "798046699"
},
{
"input": "439527072 -24854079\n1129147002",
"output": "464381151"
},
{
"input": "840435009 -612103127\n565968986",
"output": "387896880"
},
{
"input": "875035447 -826471373\n561914518",
"output": "124964560"
},
{
"input": "-342526698 305357084\n70776744",
"output": "352116225"
},
{
"input": "-903244186 899202229\n1527859274",
"output": "899202229"
},
{
"input": "-839482546 815166320\n1127472130",
"output": "839482546"
},
{
"input": "-976992569 -958313041\n1686580818",
"output": "981320479"
},
{
"input": "-497338894 -51069176\n737081851",
"output": "502661113"
},
{
"input": "-697962643 -143148799\n1287886520",
"output": "856851208"
},
{
"input": "-982572938 -482658433\n1259858332",
"output": "982572938"
},
{
"input": "123123 78817\n2000000000",
"output": "78817"
},
{
"input": "1000000000 -1000000000\n3",
"output": "14"
},
{
"input": "-1000000000 1000000000\n6",
"output": "14"
},
{
"input": "2 3\n6",
"output": "1000000006"
},
{
"input": "0 -1\n6",
"output": "1"
},
{
"input": "500000000 -1000000000\n600000003",
"output": "500000014"
},
{
"input": "-1000000000 1000000000\n3",
"output": "999999993"
},
{
"input": "1 3\n6",
"output": "1000000005"
},
{
"input": "1 2\n12",
"output": "1000000006"
},
{
"input": "7 -1000000000\n3",
"output": "0"
},
{
"input": "-999999997 999999997\n6",
"output": "20"
},
{
"input": "3 4\n6",
"output": "1000000006"
},
{
"input": "-1 2\n6",
"output": "1000000004"
},
{
"input": "2 3\n12",
"output": "1000000006"
},
{
"input": "4 18\n6",
"output": "999999993"
},
{
"input": "1 2\n6",
"output": "1000000006"
},
{
"input": "1000000000 -1000000000\n6",
"output": "999999993"
},
{
"input": "999999999 -999999999\n3",
"output": "16"
},
{
"input": "-1 0\n1",
"output": "1000000006"
},
{
"input": "1000000000 -1000000000\n9",
"output": "14"
},
{
"input": "999999999 -1000000000\n12",
"output": "999999992"
},
{
"input": "1000000000 -7\n3",
"output": "0"
},
{
"input": "-5 5\n6",
"output": "999999997"
},
{
"input": "5 9\n6",
"output": "1000000003"
},
{
"input": "-15 -10\n1",
"output": "999999992"
}
] | 1,690,010,928
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 109
| 5,734,400
|
def slv(x):
MOD = 1000000007
return x % MOD
def rec(n,x,y):
if n==1:
return x
elif n==2:
return y
else:
return rec(n-1,x,y)-rec(n-2,x,y)
n,m=map(int,input().split())
x=int(input())
ans=rec(x,n,m)
x=slv(ans)
print(x)
|
Title: Jzzhu and Sequences
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jzzhu has invented a kind of sequences, they meet the following property:
You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
Input Specification:
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
Output Specification:
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\n3\n', '0 -1\n2\n']
Demo Output:
['1\n', '1000000006\n']
Note:
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1.
In the second sample, *f*<sub class="lower-index">2</sub> = - 1; - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
|
```python
def slv(x):
MOD = 1000000007
return x % MOD
def rec(n,x,y):
if n==1:
return x
elif n==2:
return y
else:
return rec(n-1,x,y)-rec(n-2,x,y)
n,m=map(int,input().split())
x=int(input())
ans=rec(x,n,m)
x=slv(ans)
print(x)
```
| -1
|
|
591
|
B
|
Rebranding
|
PROGRAMMING
| 1,200
|
[
"implementation",
"strings"
] | null | null |
The name of one small but proud corporation consists of *n* lowercase English letters. The Corporation has decided to try rebranding — an active marketing strategy, that includes a set of measures to change either the brand (both for the company and the goods it produces) or its components: the name, the logo, the slogan. They decided to start with the name.
For this purpose the corporation has consecutively hired *m* designers. Once a company hires the *i*-th designer, he immediately contributes to the creation of a new corporation name as follows: he takes the newest version of the name and replaces all the letters *x**i* by *y**i*, and all the letters *y**i* by *x**i*. This results in the new version. It is possible that some of these letters do no occur in the string. It may also happen that *x**i* coincides with *y**i*. The version of the name received after the work of the last designer becomes the new name of the corporation.
Manager Arkady has recently got a job in this company, but is already soaked in the spirit of teamwork and is very worried about the success of the rebranding. Naturally, he can't wait to find out what is the new name the Corporation will receive.
Satisfy Arkady's curiosity and tell him the final version of the name.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the length of the initial name and the number of designers hired, respectively.
The second line consists of *n* lowercase English letters and represents the original name of the corporation.
Next *m* lines contain the descriptions of the designers' actions: the *i*-th of them contains two space-separated lowercase English letters *x**i* and *y**i*.
|
Print the new name of the corporation.
|
[
"6 1\npolice\np m\n",
"11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b\n"
] |
[
"molice\n",
"cdcbcdcfcdc\n"
] |
In the second sample the name of the corporation consecutively changes as follows:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c7648432f7138ca53234357d7e08d1d119166055.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/de89ad7bc7f27c46ec34f5e66ce0dc23bd5bc90a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/812e653c8d7ff496e6a0f04c676423806751531e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19c564fcefb8dde36256240a8b877bb6a4792bfe.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e1cafd93792430ad1a49e893e04715383bdae757.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6 1\npolice\np m",
"output": "molice"
},
{
"input": "11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b",
"output": "cdcbcdcfcdc"
},
{
"input": "1 1\nf\nz h",
"output": "f"
},
{
"input": "1 1\na\na b",
"output": "b"
},
{
"input": "10 10\nlellelleel\ne l\ne l\ne l\ne l\ne l\ne e\nl l\nl e\nl l\ne e",
"output": "lellelleel"
}
] | 1,528,472,566
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 4
| 2,000
| 0
|
m,n=map(int,input().split())
s=list(input())
d={}
for i in range(n):
pq,cd=map(str,input().split())
if pq==cd:
continue
elif pq not in s and cd not in s:
continue
else:
if s.count(cd)==0:
p=s[::-1]
q=p.index(pq)
q=m-q
for j in range(q):
if s[j]==pq:
s[j]=cd
elif s.count(pq)==0:
p=s[::-1]
q=p.index(cd)
q=m-q
for j in range(q):
if s[j]==cd:
s[j]=pq
else:
for j in range(m):
if s[j]==pq:
s[j]=cd
elif s[j]==cd:
s[j]=pq
print("".join(s))
|
Title: Rebranding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The name of one small but proud corporation consists of *n* lowercase English letters. The Corporation has decided to try rebranding — an active marketing strategy, that includes a set of measures to change either the brand (both for the company and the goods it produces) or its components: the name, the logo, the slogan. They decided to start with the name.
For this purpose the corporation has consecutively hired *m* designers. Once a company hires the *i*-th designer, he immediately contributes to the creation of a new corporation name as follows: he takes the newest version of the name and replaces all the letters *x**i* by *y**i*, and all the letters *y**i* by *x**i*. This results in the new version. It is possible that some of these letters do no occur in the string. It may also happen that *x**i* coincides with *y**i*. The version of the name received after the work of the last designer becomes the new name of the corporation.
Manager Arkady has recently got a job in this company, but is already soaked in the spirit of teamwork and is very worried about the success of the rebranding. Naturally, he can't wait to find out what is the new name the Corporation will receive.
Satisfy Arkady's curiosity and tell him the final version of the name.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the length of the initial name and the number of designers hired, respectively.
The second line consists of *n* lowercase English letters and represents the original name of the corporation.
Next *m* lines contain the descriptions of the designers' actions: the *i*-th of them contains two space-separated lowercase English letters *x**i* and *y**i*.
Output Specification:
Print the new name of the corporation.
Demo Input:
['6 1\npolice\np m\n', '11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b\n']
Demo Output:
['molice\n', 'cdcbcdcfcdc\n']
Note:
In the second sample the name of the corporation consecutively changes as follows:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c7648432f7138ca53234357d7e08d1d119166055.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/de89ad7bc7f27c46ec34f5e66ce0dc23bd5bc90a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/812e653c8d7ff496e6a0f04c676423806751531e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19c564fcefb8dde36256240a8b877bb6a4792bfe.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e1cafd93792430ad1a49e893e04715383bdae757.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
m,n=map(int,input().split())
s=list(input())
d={}
for i in range(n):
pq,cd=map(str,input().split())
if pq==cd:
continue
elif pq not in s and cd not in s:
continue
else:
if s.count(cd)==0:
p=s[::-1]
q=p.index(pq)
q=m-q
for j in range(q):
if s[j]==pq:
s[j]=cd
elif s.count(pq)==0:
p=s[::-1]
q=p.index(cd)
q=m-q
for j in range(q):
if s[j]==cd:
s[j]=pq
else:
for j in range(m):
if s[j]==pq:
s[j]=cd
elif s[j]==cd:
s[j]=pq
print("".join(s))
```
| 0
|
|
551
|
A
|
GukiZ and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
|
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
|
[
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] |
[
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] |
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
| 500
|
[
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,563,217,639
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 124
| 512,000
|
#GukiZ and Contest
n = int(input())
a = list(map(int, input().split()))
b = sorted(a, reverse=True)
rank = [0]*2001
rank[b[0]] = 1
temp = b[0]
for i in range(n):
if temp != b[i]:
rank[b[i]] = i + 1
temp = b[i]
for i in range(n):
print(rank[a[i]], end=" ")
|
Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
|
```python
#GukiZ and Contest
n = int(input())
a = list(map(int, input().split()))
b = sorted(a, reverse=True)
rank = [0]*2001
rank[b[0]] = 1
temp = b[0]
for i in range(n):
if temp != b[i]:
rank[b[i]] = i + 1
temp = b[i]
for i in range(n):
print(rank[a[i]], end=" ")
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,644,391,769
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 4
| 124
| 0
|
#43A - Football
for i in range(int(input())):
x,y=input(),{}
try:
y[x]+=1
except:
y[x]=1
print((max(y.keys())))
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
#43A - Football
for i in range(int(input())):
x,y=input(),{}
try:
y[x]+=1
except:
y[x]=1
print((max(y.keys())))
```
| 0
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,698,469,618
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n=int(input())
l=list(map(int,input().strip().split()))
if 1<=n<=100:
s=0
for i in l:
s+=i
x=s/n
print(x)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
n=int(input())
l=list(map(int,input().strip().split()))
if 1<=n<=100:
s=0
for i in l:
s+=i
x=s/n
print(x)
```
| 3
|
|
76
|
E
|
Points
|
PROGRAMMING
| 1,700
|
[
"implementation",
"math"
] |
E. Points
|
1
|
256
|
You are given *N* points on a plane. Write a program which will find the sum of squares of distances between all pairs of points.
|
The first line of input contains one integer number *N* (1<=≤<=*N*<=≤<=100<=000) — the number of points. Each of the following *N* lines contain two integer numbers *X* and *Y* (<=-<=10<=000<=≤<=*X*,<=*Y*<=≤<=10<=000) — the coordinates of points. Two or more points may coincide.
|
The only line of output should contain the required sum of squares of distances between all pairs of points.
|
[
"4\n1 1\n-1 -1\n1 -1\n-1 1\n"
] |
[
"32\n"
] |
none
| 0
|
[
{
"input": "4\n1 1\n-1 -1\n1 -1\n-1 1",
"output": "32"
},
{
"input": "1\n6 3",
"output": "0"
},
{
"input": "30\n-7 -12\n-2 5\n14 8\n9 17\n15 -18\n20 6\n20 8\n-13 12\n-4 -20\n-11 -16\n-6 16\n1 -9\n5 -12\n13 -17\n11 5\n8 -9\n-13 5\n19 -13\n-19 -8\n-14 10\n10 3\n-16 -8\n-17 16\n-14 -15\n5 1\n-13 -9\n13 17\n-14 -8\n2 5\n18 5",
"output": "265705"
}
] | 1,581,754,972
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 124
| 204,800
|
import math
if __name__== '__main__':
n = int(input())
totalDistance= 0
Xs= []
Ys= []
xs= []
ys= []
x_ve= 0
y_ve= 0
for _ in range(n):
x, y= [int(x) for x in input().split()]
Xs.append((n- 1)* x)
Ys.append((n- 1)* y)
xs.append(x)
ys.append(y)
x_ve+= (-1* x)
y_ve+= (-1* y)
#print('Xs: '+str(Xs))
#print('Ys: '+str(Ys))
#print('xs: '+str(xs))
#print('ys: '+str(ys))
#print('x_ve: '+str(x_ve))
#print('y_ve: '+str(y_ve))
#print('#'*10)
for index in range(n):
#print('xs: '+str(xs[index]))
#print('Xs: '+str(Xs[index]))
if(index== 0):
subtract= 2* xs[index]
else:
subtract= (2* xs[index]- xs[index- 1])
#print('subtract: '+str(subtract))
x_ve+= subtract
#print('x_ve: '+str(x_ve))
totalDistance+= Xs[index]* x_ve
#print('Xs[index]* x_ve: '+str(Xs[index]* x_ve))
#print()
#print('ys: '+str(ys[index]))
#print('Ys: '+str(Ys[index]))
if(index== 0):
subtract= 2* ys[index]
else:
subtract= (2* ys[index]- ys[index- 1])
#print('subtract: '+str(subtract))
y_ve+= subtract
#print('y_ve: '+str(y_ve))
totalDistance+= Ys[index]* y_ve
#print('Ys[index]* y_ve: '+str(Ys[index]* y_ve))
#print()
#print()
print(totalDistance)
|
Title: Points
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given *N* points on a plane. Write a program which will find the sum of squares of distances between all pairs of points.
Input Specification:
The first line of input contains one integer number *N* (1<=≤<=*N*<=≤<=100<=000) — the number of points. Each of the following *N* lines contain two integer numbers *X* and *Y* (<=-<=10<=000<=≤<=*X*,<=*Y*<=≤<=10<=000) — the coordinates of points. Two or more points may coincide.
Output Specification:
The only line of output should contain the required sum of squares of distances between all pairs of points.
Demo Input:
['4\n1 1\n-1 -1\n1 -1\n-1 1\n']
Demo Output:
['32\n']
Note:
none
|
```python
import math
if __name__== '__main__':
n = int(input())
totalDistance= 0
Xs= []
Ys= []
xs= []
ys= []
x_ve= 0
y_ve= 0
for _ in range(n):
x, y= [int(x) for x in input().split()]
Xs.append((n- 1)* x)
Ys.append((n- 1)* y)
xs.append(x)
ys.append(y)
x_ve+= (-1* x)
y_ve+= (-1* y)
#print('Xs: '+str(Xs))
#print('Ys: '+str(Ys))
#print('xs: '+str(xs))
#print('ys: '+str(ys))
#print('x_ve: '+str(x_ve))
#print('y_ve: '+str(y_ve))
#print('#'*10)
for index in range(n):
#print('xs: '+str(xs[index]))
#print('Xs: '+str(Xs[index]))
if(index== 0):
subtract= 2* xs[index]
else:
subtract= (2* xs[index]- xs[index- 1])
#print('subtract: '+str(subtract))
x_ve+= subtract
#print('x_ve: '+str(x_ve))
totalDistance+= Xs[index]* x_ve
#print('Xs[index]* x_ve: '+str(Xs[index]* x_ve))
#print()
#print('ys: '+str(ys[index]))
#print('Ys: '+str(Ys[index]))
if(index== 0):
subtract= 2* ys[index]
else:
subtract= (2* ys[index]- ys[index- 1])
#print('subtract: '+str(subtract))
y_ve+= subtract
#print('y_ve: '+str(y_ve))
totalDistance+= Ys[index]* y_ve
#print('Ys[index]* y_ve: '+str(Ys[index]* y_ve))
#print()
#print()
print(totalDistance)
```
| 0
|
922
|
B
|
Magic Forest
|
PROGRAMMING
| 1,300
|
[
"brute force"
] | null | null |
Imp is in a magic forest, where xorangles grow (wut?)
A xorangle of order *n* is such a non-degenerate triangle, that lengths of its sides are integers not exceeding *n*, and the xor-sum of the lengths is equal to zero. Imp has to count the number of distinct xorangles of order *n* to get out of the forest.
Formally, for a given integer *n* you have to find the number of such triples (*a*,<=*b*,<=*c*), that:
- 1<=≤<=*a*<=≤<=*b*<=≤<=*c*<=≤<=*n*; - , where denotes the [bitwise xor](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) of integers *x* and *y*. - (*a*,<=*b*,<=*c*) form a non-degenerate (with strictly positive area) triangle.
|
The only line contains a single integer *n* (1<=≤<=*n*<=≤<=2500).
|
Print the number of xorangles of order *n*.
|
[
"6\n",
"10\n"
] |
[
"1\n",
"2\n"
] |
The only xorangle in the first sample is (3, 5, 6).
| 1,000
|
[
{
"input": "6",
"output": "1"
},
{
"input": "10",
"output": "2"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "2500",
"output": "700393"
},
{
"input": "952",
"output": "118547"
},
{
"input": "88",
"output": "536"
},
{
"input": "1216",
"output": "160822"
},
{
"input": "2140",
"output": "614785"
},
{
"input": "564",
"output": "35087"
},
{
"input": "1488",
"output": "239580"
},
{
"input": "116",
"output": "1332"
},
{
"input": "1040",
"output": "145820"
},
{
"input": "1965",
"output": "545494"
},
{
"input": "593",
"output": "36605"
},
{
"input": "779",
"output": "63500"
},
{
"input": "1703",
"output": "352045"
},
{
"input": "331",
"output": "9877"
},
{
"input": "1051",
"output": "145985"
},
{
"input": "2179",
"output": "618074"
},
{
"input": "603",
"output": "37312"
},
{
"input": "1731",
"output": "369691"
},
{
"input": "2451",
"output": "681980"
},
{
"input": "1079",
"output": "146833"
},
{
"input": "2207",
"output": "621708"
},
{
"input": "2394",
"output": "663240"
},
{
"input": "818",
"output": "73972"
},
{
"input": "1946",
"output": "529383"
},
{
"input": "166",
"output": "2200"
},
{
"input": "1294",
"output": "175915"
},
{
"input": "2218",
"output": "623386"
},
{
"input": "846",
"output": "82106"
},
{
"input": "1566",
"output": "273341"
},
{
"input": "194",
"output": "3240"
},
{
"input": "1322",
"output": "183405"
},
{
"input": "1508",
"output": "247634"
},
{
"input": "2433",
"output": "675245"
},
{
"input": "857",
"output": "85529"
},
{
"input": "1781",
"output": "402718"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "2444",
"output": "679373"
},
{
"input": "2498",
"output": "699536"
}
] | 1,678,905,858
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 44
| 93
| 1,945,600
|
n=int(input())
k=0
for a in range(1,n+1):
for b in range(a,n+1):
c=a^b
if b<=c and c<=n and a+b>c and b+c>a and a+c>b:
k+=1
print(k)
|
Title: Magic Forest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imp is in a magic forest, where xorangles grow (wut?)
A xorangle of order *n* is such a non-degenerate triangle, that lengths of its sides are integers not exceeding *n*, and the xor-sum of the lengths is equal to zero. Imp has to count the number of distinct xorangles of order *n* to get out of the forest.
Formally, for a given integer *n* you have to find the number of such triples (*a*,<=*b*,<=*c*), that:
- 1<=≤<=*a*<=≤<=*b*<=≤<=*c*<=≤<=*n*; - , where denotes the [bitwise xor](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) of integers *x* and *y*. - (*a*,<=*b*,<=*c*) form a non-degenerate (with strictly positive area) triangle.
Input Specification:
The only line contains a single integer *n* (1<=≤<=*n*<=≤<=2500).
Output Specification:
Print the number of xorangles of order *n*.
Demo Input:
['6\n', '10\n']
Demo Output:
['1\n', '2\n']
Note:
The only xorangle in the first sample is (3, 5, 6).
|
```python
n=int(input())
k=0
for a in range(1,n+1):
for b in range(a,n+1):
c=a^b
if b<=c and c<=n and a+b>c and b+c>a and a+c>b:
k+=1
print(k)
```
| 3
|
|
886
|
B
|
Vlad and Cafes
|
PROGRAMMING
| 1,000
|
[] | null | null |
Vlad likes to eat in cafes very much. During his life, he has visited cafes *n* times. Unfortunately, Vlad started to feel that his last visits are not any different from each other. To fix that Vlad had a small research.
First of all, Vlad assigned individual indices to all cafes. Then, he wrote down indices of cafes he visited in a row, in order of visiting them. Now, Vlad wants to find such a cafe that his last visit to that cafe was before his last visits to every other cafe. In other words, he wants to find such a cafe that he hasn't been there for as long as possible. Help Vlad to find that cafe.
|
In first line there is one integer *n* (1<=≤<=*n*<=≤<=2·105) — number of cafes indices written by Vlad.
In second line, *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=2·105) are written — indices of cafes in order of being visited by Vlad. Vlad could visit some cafes more than once. Note that in numeration, some indices could be omitted.
|
Print one integer — index of the cafe that Vlad hasn't visited for as long as possible.
|
[
"5\n1 3 2 1 2\n",
"6\n2 1 2 2 4 1\n"
] |
[
"3\n",
"2\n"
] |
In first test, there are three cafes, and the last visits to cafes with indices 1 and 2 were after the last visit to cafe with index 3; so this cafe is the answer.
In second test case, there are also three cafes, but with indices 1, 2 and 4. Cafes with indices 1 and 4 were visited after the last visit of cafe with index 2, so the answer is 2. Note that Vlad could omit some numbers while numerating the cafes.
| 1,000
|
[
{
"input": "5\n1 3 2 1 2",
"output": "3"
},
{
"input": "6\n2 1 2 2 4 1",
"output": "2"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n200000",
"output": "200000"
},
{
"input": "2\n2018 2017",
"output": "2018"
},
{
"input": "5\n100 1000 1000 1000 1000",
"output": "100"
},
{
"input": "8\n200000 1 200000 1 200000 1 200000 2",
"output": "1"
},
{
"input": "5\n20000 1 2 3 4",
"output": "20000"
},
{
"input": "2\n200000 1",
"output": "200000"
},
{
"input": "3\n2 100 2",
"output": "100"
},
{
"input": "2\n10 1",
"output": "10"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n5 5 5",
"output": "5"
},
{
"input": "2\n5 1",
"output": "5"
}
] | 1,510,510,973
| 8,273
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 5
| 2,000
| 14,131,200
|
n=input()
a = [int(s) for s in input().split()]
c=1
i=0
while c!=0:
if int(a[i] in a[i+1:]) == 0:
break
i+=1
print(a[i])
|
Title: Vlad and Cafes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vlad likes to eat in cafes very much. During his life, he has visited cafes *n* times. Unfortunately, Vlad started to feel that his last visits are not any different from each other. To fix that Vlad had a small research.
First of all, Vlad assigned individual indices to all cafes. Then, he wrote down indices of cafes he visited in a row, in order of visiting them. Now, Vlad wants to find such a cafe that his last visit to that cafe was before his last visits to every other cafe. In other words, he wants to find such a cafe that he hasn't been there for as long as possible. Help Vlad to find that cafe.
Input Specification:
In first line there is one integer *n* (1<=≤<=*n*<=≤<=2·105) — number of cafes indices written by Vlad.
In second line, *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=2·105) are written — indices of cafes in order of being visited by Vlad. Vlad could visit some cafes more than once. Note that in numeration, some indices could be omitted.
Output Specification:
Print one integer — index of the cafe that Vlad hasn't visited for as long as possible.
Demo Input:
['5\n1 3 2 1 2\n', '6\n2 1 2 2 4 1\n']
Demo Output:
['3\n', '2\n']
Note:
In first test, there are three cafes, and the last visits to cafes with indices 1 and 2 were after the last visit to cafe with index 3; so this cafe is the answer.
In second test case, there are also three cafes, but with indices 1, 2 and 4. Cafes with indices 1 and 4 were visited after the last visit of cafe with index 2, so the answer is 2. Note that Vlad could omit some numbers while numerating the cafes.
|
```python
n=input()
a = [int(s) for s in input().split()]
c=1
i=0
while c!=0:
if int(a[i] in a[i+1:]) == 0:
break
i+=1
print(a[i])
```
| 0
|
|
710
|
B
|
Optimal Point on a Line
|
PROGRAMMING
| 1,400
|
[
"brute force",
"sortings"
] | null | null |
You are given *n* points on a line with their coordinates *x**i*. Find the point *x* so the sum of distances to the given points is minimal.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of points on the line.
The second line contains *n* integers *x**i* (<=-<=109<=≤<=*x**i*<=≤<=109) — the coordinates of the given *n* points.
|
Print the only integer *x* — the position of the optimal point on the line. If there are several optimal points print the position of the leftmost one. It is guaranteed that the answer is always the integer.
|
[
"4\n1 2 3 4\n"
] |
[
"2\n"
] |
none
| 0
|
[
{
"input": "4\n1 2 3 4",
"output": "2"
},
{
"input": "5\n-1 -10 2 6 7",
"output": "2"
},
{
"input": "10\n-68 10 87 22 30 89 82 -97 -52 25",
"output": "22"
},
{
"input": "100\n457 827 807 17 871 935 907 -415 536 170 551 -988 865 758 -457 -892 -875 -488 684 19 0 555 -807 -624 -239 826 318 811 20 -732 -91 460 551 -610 555 -493 -154 442 -141 946 -913 -104 704 -380 699 32 106 -455 -518 214 -464 -861 243 -798 -472 559 529 -844 -32 871 -459 236 387 626 -318 -580 -611 -842 790 486 64 951 81 78 -693 403 -731 309 678 696 891 846 -106 918 212 -44 994 606 -829 -454 243 -477 -402 -818 -819 -310 -837 -209 736 424",
"output": "64"
},
{
"input": "2\n-1 0",
"output": "-1"
},
{
"input": "48\n-777 -767 -764 -713 -688 -682 -606 -586 -585 -483 -465 -440 -433 -397 -390 -377 -299 -252 -159 -147 -96 -29 -15 15 52 109 124 129 142 218 231 314 320 339 442 496 505 548 575 576 594 624 694 827 891 979 981 981",
"output": "15"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 1 1 1 1 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "4\n-1 -1 0 1",
"output": "-1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 1000000000",
"output": "0"
},
{
"input": "2\n1 -1",
"output": "-1"
},
{
"input": "2\n100 50",
"output": "50"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n606194955 -856471310 117647402",
"output": "117647402"
},
{
"input": "2\n615002717 -843553590",
"output": "-843553590"
},
{
"input": "2\n-1 2",
"output": "-1"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "5\n-638512131 348325781 -550537933 -618161835 -567935532",
"output": "-567935532"
},
{
"input": "1\n120",
"output": "120"
},
{
"input": "2\n-1000000000 1000000000",
"output": "-1000000000"
},
{
"input": "1\n618309368",
"output": "618309368"
}
] | 1,614,696,907
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 295
| 22,323,200
|
n=int(input())
intList=list(map(int,input().split()))
intList.sort()
if(n%2):
print(intList[n//2])
else:
print(intList[n//2-1])
|
Title: Optimal Point on a Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* points on a line with their coordinates *x**i*. Find the point *x* so the sum of distances to the given points is minimal.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of points on the line.
The second line contains *n* integers *x**i* (<=-<=109<=≤<=*x**i*<=≤<=109) — the coordinates of the given *n* points.
Output Specification:
Print the only integer *x* — the position of the optimal point on the line. If there are several optimal points print the position of the leftmost one. It is guaranteed that the answer is always the integer.
Demo Input:
['4\n1 2 3 4\n']
Demo Output:
['2\n']
Note:
none
|
```python
n=int(input())
intList=list(map(int,input().split()))
intList.sort()
if(n%2):
print(intList[n//2])
else:
print(intList[n//2-1])
```
| 3
|
|
750
|
A
|
New Year and Hurry
|
PROGRAMMING
| 800
|
[
"binary search",
"brute force",
"implementation",
"math"
] | null | null |
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
|
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
|
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
|
[
"3 222\n",
"4 190\n",
"7 1\n"
] |
[
"2\n",
"4\n",
"7\n"
] |
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
| 500
|
[
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,675,764,752
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 15
| 0
|
# LUOGU_RID: 101648347
n, k = map(int, input().split())
s = 0
c = 0
while s + (c + 1) * 5 + k <= 240:
c += 1
s += c * 5
print(c)
|
Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
|
```python
# LUOGU_RID: 101648347
n, k = map(int, input().split())
s = 0
c = 0
while s + (c + 1) * 5 + k <= 240:
c += 1
s += c * 5
print(c)
```
| 0
|
|
236
|
A
|
Boy or Girl
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
|
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
|
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
|
[
"wjmzbmr\n",
"xiaodao\n",
"sevenkplus\n"
] |
[
"CHAT WITH HER!\n",
"IGNORE HIM!\n",
"CHAT WITH HER!\n"
] |
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
| 500
|
[
{
"input": "wjmzbmr",
"output": "CHAT WITH HER!"
},
{
"input": "xiaodao",
"output": "IGNORE HIM!"
},
{
"input": "sevenkplus",
"output": "CHAT WITH HER!"
},
{
"input": "pezu",
"output": "CHAT WITH HER!"
},
{
"input": "wnemlgppy",
"output": "CHAT WITH HER!"
},
{
"input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn",
"output": "IGNORE HIM!"
},
{
"input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx",
"output": "CHAT WITH HER!"
},
{
"input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt",
"output": "IGNORE HIM!"
},
{
"input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk",
"output": "IGNORE HIM!"
},
{
"input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz",
"output": "IGNORE HIM!"
},
{
"input": "tgcdptnkc",
"output": "IGNORE HIM!"
},
{
"input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi",
"output": "IGNORE HIM!"
},
{
"input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp",
"output": "IGNORE HIM!"
},
{
"input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia",
"output": "IGNORE HIM!"
},
{
"input": "fpellxwskyekoyvrfnuf",
"output": "CHAT WITH HER!"
},
{
"input": "xninyvkuvakfbs",
"output": "IGNORE HIM!"
},
{
"input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak",
"output": "CHAT WITH HER!"
},
{
"input": "kmsk",
"output": "IGNORE HIM!"
},
{
"input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz",
"output": "CHAT WITH HER!"
},
{
"input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq",
"output": "CHAT WITH HER!"
},
{
"input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm",
"output": "IGNORE HIM!"
},
{
"input": "ppcpbnhwoizajrl",
"output": "IGNORE HIM!"
},
{
"input": "sgubujztzwkzvztitssxxxwzanfmddfqvv",
"output": "CHAT WITH HER!"
},
{
"input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw",
"output": "IGNORE HIM!"
},
{
"input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu",
"output": "CHAT WITH HER!"
},
{
"input": "ojjvpnkrxibyevxk",
"output": "CHAT WITH HER!"
},
{
"input": "wjweqcrqfuollfvfbiyriijovweg",
"output": "IGNORE HIM!"
},
{
"input": "hkdbykboclchfdsuovvpknwqr",
"output": "IGNORE HIM!"
},
{
"input": "stjvyfrfowopwfjdveduedqylerqugykyu",
"output": "IGNORE HIM!"
},
{
"input": "rafcaanqytfclvfdegak",
"output": "CHAT WITH HER!"
},
{
"input": "xczn",
"output": "CHAT WITH HER!"
},
{
"input": "arcoaeozyeawbveoxpmafxxzdjldsielp",
"output": "IGNORE HIM!"
},
{
"input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika",
"output": "CHAT WITH HER!"
},
{
"input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh",
"output": "CHAT WITH HER!"
},
{
"input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg",
"output": "CHAT WITH HER!"
},
{
"input": "udlpagtpq",
"output": "CHAT WITH HER!"
},
{
"input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy",
"output": "CHAT WITH HER!"
},
{
"input": "qagzrqjomdwhagkhrjahhxkieijyten",
"output": "CHAT WITH HER!"
},
{
"input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb",
"output": "CHAT WITH HER!"
},
{
"input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr",
"output": "CHAT WITH HER!"
},
{
"input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc",
"output": "IGNORE HIM!"
},
{
"input": "lnpdosnceumubvk",
"output": "IGNORE HIM!"
},
{
"input": "efrk",
"output": "CHAT WITH HER!"
},
{
"input": "temnownneghnrujforif",
"output": "IGNORE HIM!"
},
{
"input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta",
"output": "IGNORE HIM!"
},
{
"input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh",
"output": "IGNORE HIM!"
},
{
"input": "gwntwbpj",
"output": "IGNORE HIM!"
},
{
"input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim",
"output": "IGNORE HIM!"
},
{
"input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd",
"output": "CHAT WITH HER!"
},
{
"input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx",
"output": "IGNORE HIM!"
},
{
"input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks",
"output": "CHAT WITH HER!"
},
{
"input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx",
"output": "CHAT WITH HER!"
},
{
"input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc",
"output": "CHAT WITH HER!"
},
{
"input": "yzlzmesxdttfcztooypjztlgxwcr",
"output": "IGNORE HIM!"
},
{
"input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc",
"output": "IGNORE HIM!"
},
{
"input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq",
"output": "CHAT WITH HER!"
},
{
"input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj",
"output": "IGNORE HIM!"
},
{
"input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom",
"output": "CHAT WITH HER!"
},
{
"input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo",
"output": "CHAT WITH HER!"
},
{
"input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh",
"output": "IGNORE HIM!"
},
{
"input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa",
"output": "CHAT WITH HER!"
},
{
"input": "oh",
"output": "CHAT WITH HER!"
},
{
"input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri",
"output": "IGNORE HIM!"
},
{
"input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp",
"output": "CHAT WITH HER!"
},
{
"input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp",
"output": "CHAT WITH HER!"
},
{
"input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo",
"output": "CHAT WITH HER!"
},
{
"input": "mnmbupgo",
"output": "IGNORE HIM!"
},
{
"input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl",
"output": "IGNORE HIM!"
},
{
"input": "yocxrzspinchmhtmqo",
"output": "CHAT WITH HER!"
},
{
"input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv",
"output": "CHAT WITH HER!"
},
{
"input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad",
"output": "IGNORE HIM!"
},
{
"input": "ubvhyaebyxoghakajqrpqpctwbrfqzli",
"output": "CHAT WITH HER!"
},
{
"input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy",
"output": "IGNORE HIM!"
},
{
"input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd",
"output": "IGNORE HIM!"
},
{
"input": "acrzbavz",
"output": "CHAT WITH HER!"
},
{
"input": "drvzznznvrzskftnrhvvzxcalwutxmdza",
"output": "IGNORE HIM!"
},
{
"input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws",
"output": "CHAT WITH HER!"
},
{
"input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff",
"output": "CHAT WITH HER!"
},
{
"input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu",
"output": "CHAT WITH HER!"
},
{
"input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw",
"output": "IGNORE HIM!"
},
{
"input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy",
"output": "CHAT WITH HER!"
},
{
"input": "rhh",
"output": "CHAT WITH HER!"
},
{
"input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo",
"output": "IGNORE HIM!"
},
{
"input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn",
"output": "CHAT WITH HER!"
},
{
"input": "urigreuzpxnej",
"output": "CHAT WITH HER!"
}
] | 1,699,124,527
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 85
| 62
| 0
|
print("CHAT WITH HER!" if len(list(set(input())))%2==0 else "IGNORE HIM!")
|
Title: Boy or Girl
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
Input Specification:
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
Output Specification:
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
Demo Input:
['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n']
Demo Output:
['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n']
Note:
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
|
```python
print("CHAT WITH HER!" if len(list(set(input())))%2==0 else "IGNORE HIM!")
```
| 3
|
|
776
|
B
|
Sherlock and his girlfriend
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"number theory"
] | null | null |
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
|
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
|
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
|
[
"3\n",
"4\n"
] |
[
"2\n1 1 2 ",
"2\n2 1 1 2\n"
] |
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct.
| 1,000
|
[
{
"input": "3",
"output": "2\n1 1 2 "
},
{
"input": "4",
"output": "2\n1 1 2 1 "
},
{
"input": "17",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 "
},
{
"input": "25",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 "
},
{
"input": "85",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 "
},
{
"input": "105",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 "
},
{
"input": "123",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "452",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "641",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "293",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "733",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "10",
"output": "2\n1 1 2 1 2 1 2 2 2 1 "
},
{
"input": "287",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3202",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "728",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3509",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "5137",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2023",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "4890",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "8507",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1796",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3466",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1098",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11226",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11731",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11644",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "14553",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "17307",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "23189",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "6818",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1054",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "28163",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "30885",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "27673",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11656",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "36325",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "31205",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29958",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1696",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "44907",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "13736",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29594",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "19283",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "15346",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "41794",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99998",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99971",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
}
] | 1,659,728,261
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 53
| 109
| 9,830,400
|
import math
n=int(input())
lt=[2]*(n+1)
l=[2]
for i in range(2,n+2):
for j in range(2,int(math.sqrt(i))+2):
if i%j==0:
break
else:
lt[i-1]=1
l.append(i)
lt[1]=1
if n<3:
print(1)
else:
print(2)
print(*lt[1:])
#print(l)
|
Title: Sherlock and his girlfriend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
Input Specification:
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
Output Specification:
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
Demo Input:
['3\n', '4\n']
Demo Output:
['2\n1 1 2 ', '2\n2 1 1 2\n']
Note:
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct.
|
```python
import math
n=int(input())
lt=[2]*(n+1)
l=[2]
for i in range(2,n+2):
for j in range(2,int(math.sqrt(i))+2):
if i%j==0:
break
else:
lt[i-1]=1
l.append(i)
lt[1]=1
if n<3:
print(1)
else:
print(2)
print(*lt[1:])
#print(l)
```
| 3
|
|
610
|
B
|
Vika and Squares
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"implementation"
] | null | null |
Vika has *n* jars with paints of distinct colors. All the jars are numbered from 1 to *n* and the *i*-th jar contains *a**i* liters of paint of color *i*.
Vika also has an infinitely long rectangular piece of paper of width 1, consisting of squares of size 1<=×<=1. Squares are numbered 1, 2, 3 and so on. Vika decided that she will start painting squares one by one from left to right, starting from the square number 1 and some arbitrary color. If the square was painted in color *x*, then the next square will be painted in color *x*<=+<=1. In case of *x*<==<=*n*, next square is painted in color 1. If there is no more paint of the color Vika wants to use now, then she stops.
Square is always painted in only one color, and it takes exactly 1 liter of paint. Your task is to calculate the maximum number of squares that might be painted, if Vika chooses right color to paint the first square.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of jars with colors Vika has.
The second line of the input contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is equal to the number of liters of paint in the *i*-th jar, i.e. the number of liters of color *i* that Vika has.
|
The only line of the output should contain a single integer — the maximum number of squares that Vika can paint if she follows the rules described above.
|
[
"5\n2 4 2 3 3\n",
"3\n5 5 5\n",
"6\n10 10 10 1 10 10\n"
] |
[
"12\n",
"15\n",
"11\n"
] |
In the first sample the best strategy is to start painting using color 4. Then the squares will be painted in the following colors (from left to right): 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5.
In the second sample Vika can start to paint using any color.
In the third sample Vika should start painting using color number 5.
| 1,000
|
[
{
"input": "5\n2 4 2 3 3",
"output": "12"
},
{
"input": "3\n5 5 5",
"output": "15"
},
{
"input": "6\n10 10 10 1 10 10",
"output": "11"
},
{
"input": "1\n167959139",
"output": "167959139"
},
{
"input": "10\n896619242 805194919 844752453 848347723 816995848 856813612 805194919 833406689 816255448 805194919",
"output": "8051949194"
},
{
"input": "2\n2 3",
"output": "5"
},
{
"input": "2\n10 10",
"output": "20"
},
{
"input": "2\n1111 1110",
"output": "2221"
},
{
"input": "3\n100 101 100",
"output": "301"
},
{
"input": "3\n100 100 101",
"output": "301"
},
{
"input": "3\n101 100 100",
"output": "301"
},
{
"input": "4\n2 3 2 2",
"output": "9"
},
{
"input": "4\n1 1 1 1",
"output": "4"
},
{
"input": "4\n100 100 100 101",
"output": "401"
},
{
"input": "4\n101 100 100 101",
"output": "402"
},
{
"input": "4\n100 101 101 100",
"output": "402"
},
{
"input": "4\n200 201 200 201",
"output": "801"
},
{
"input": "4\n201 200 201 200",
"output": "801"
},
{
"input": "4\n300 302 302 300",
"output": "1202"
},
{
"input": "8\n5 4 3 2 1 1 1 1",
"output": "12"
},
{
"input": "8\n2 2 1 2 2 1 2 2",
"output": "12"
},
{
"input": "10\n2 1 2 1 2 2 2 2 2 1",
"output": "15"
},
{
"input": "13\n2 2 2 1 1 1 1 1 1 1 2 2 2",
"output": "19"
}
] | 1,453,309,606
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 66
| 186
| 18,227,200
|
def main():
n = int(input())
aa = list(map(int, input().split()))
m = min(aa)
for i in range(aa.index(m) - n, aa.index(m)):
if aa[i] == m:
aa[i] = x = 0
else:
x += 1
aa[i] = x
print(m * n + max(aa))
if __name__ == '__main__':
main()
|
Title: Vika and Squares
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vika has *n* jars with paints of distinct colors. All the jars are numbered from 1 to *n* and the *i*-th jar contains *a**i* liters of paint of color *i*.
Vika also has an infinitely long rectangular piece of paper of width 1, consisting of squares of size 1<=×<=1. Squares are numbered 1, 2, 3 and so on. Vika decided that she will start painting squares one by one from left to right, starting from the square number 1 and some arbitrary color. If the square was painted in color *x*, then the next square will be painted in color *x*<=+<=1. In case of *x*<==<=*n*, next square is painted in color 1. If there is no more paint of the color Vika wants to use now, then she stops.
Square is always painted in only one color, and it takes exactly 1 liter of paint. Your task is to calculate the maximum number of squares that might be painted, if Vika chooses right color to paint the first square.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of jars with colors Vika has.
The second line of the input contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is equal to the number of liters of paint in the *i*-th jar, i.e. the number of liters of color *i* that Vika has.
Output Specification:
The only line of the output should contain a single integer — the maximum number of squares that Vika can paint if she follows the rules described above.
Demo Input:
['5\n2 4 2 3 3\n', '3\n5 5 5\n', '6\n10 10 10 1 10 10\n']
Demo Output:
['12\n', '15\n', '11\n']
Note:
In the first sample the best strategy is to start painting using color 4. Then the squares will be painted in the following colors (from left to right): 4, 5, 1, 2, 3, 4, 5, 1, 2, 3, 4, 5.
In the second sample Vika can start to paint using any color.
In the third sample Vika should start painting using color number 5.
|
```python
def main():
n = int(input())
aa = list(map(int, input().split()))
m = min(aa)
for i in range(aa.index(m) - n, aa.index(m)):
if aa[i] == m:
aa[i] = x = 0
else:
x += 1
aa[i] = x
print(m * n + max(aa))
if __name__ == '__main__':
main()
```
| 3
|
|
218
|
B
|
Airport
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Lolek and Bolek are about to travel abroad by plane. The local airport has a special "Choose Your Plane" offer. The offer's conditions are as follows:
- it is up to a passenger to choose a plane to fly on; - if the chosen plane has *x* (*x*<=><=0) empty seats at the given moment, then the ticket for such a plane costs *x* zlotys (units of Polish currency).
The only ticket office of the airport already has a queue of *n* passengers in front of it. Lolek and Bolek have not stood in the queue yet, but they are already wondering what is the maximum and the minimum number of zlotys the airport administration can earn if all *n* passengers buy tickets according to the conditions of this offer?
The passengers buy tickets in turn, the first person in the queue goes first, then goes the second one, and so on up to *n*-th person.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of passengers in the queue and the number of planes in the airport, correspondingly. The next line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=1000) — *a**i* stands for the number of empty seats in the *i*-th plane before the ticket office starts selling tickets.
The numbers in the lines are separated by a space. It is guaranteed that there are at least *n* empty seats in total.
|
Print two integers — the maximum and the minimum number of zlotys that the airport administration can earn, correspondingly.
|
[
"4 3\n2 1 1\n",
"4 3\n2 2 2\n"
] |
[
"5 5\n",
"7 6\n"
] |
In the first test sample the number of passengers is equal to the number of empty seats, so regardless of the way the planes are chosen, the administration will earn the same sum.
In the second sample the sum is maximized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person — to the 2-nd plane, the 3-rd person — to the 3-rd plane, the 4-th person — to the 1-st plane. The sum is minimized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person — to the 1-st plane, the 3-rd person — to the 2-nd plane, the 4-th person — to the 2-nd plane.
| 500
|
[
{
"input": "4 3\n2 1 1",
"output": "5 5"
},
{
"input": "4 3\n2 2 2",
"output": "7 6"
},
{
"input": "10 5\n10 3 3 1 2",
"output": "58 26"
},
{
"input": "10 1\n10",
"output": "55 55"
},
{
"input": "10 1\n100",
"output": "955 955"
},
{
"input": "10 2\n4 7",
"output": "37 37"
},
{
"input": "40 10\n1 2 3 4 5 6 7 10 10 10",
"output": "223 158"
},
{
"input": "1 1\n6",
"output": "6 6"
},
{
"input": "1 2\n10 9",
"output": "10 9"
},
{
"input": "2 1\n7",
"output": "13 13"
},
{
"input": "2 2\n7 2",
"output": "13 3"
},
{
"input": "3 2\n4 7",
"output": "18 9"
},
{
"input": "3 3\n2 1 1",
"output": "4 4"
},
{
"input": "3 3\n2 1 1",
"output": "4 4"
},
{
"input": "10 10\n3 1 2 2 1 1 2 1 2 3",
"output": "20 13"
},
{
"input": "10 2\n7 3",
"output": "34 34"
},
{
"input": "10 1\n19",
"output": "145 145"
},
{
"input": "100 3\n29 36 35",
"output": "1731 1731"
},
{
"input": "100 5\n3 38 36 35 2",
"output": "2019 1941"
},
{
"input": "510 132\n50 76 77 69 94 30 47 65 14 62 18 121 26 35 49 17 105 93 47 16 78 3 7 74 7 37 30 36 30 83 71 113 7 58 86 10 65 57 34 102 55 44 43 47 106 44 115 75 109 70 47 45 16 57 62 55 20 88 74 40 45 84 41 1 9 53 65 25 67 31 115 2 63 51 123 70 65 65 18 14 75 14 103 26 117 105 36 104 81 37 35 61 44 90 71 70 88 89 26 21 64 77 89 16 87 99 13 79 27 3 46 120 116 11 14 17 32 70 113 94 108 57 29 100 53 48 44 29 70 30 32 62",
"output": "50279 5479"
},
{
"input": "510 123\n5 2 3 2 5 7 2 3 1 3 6 6 3 1 5 3 5 6 2 2 1 5 5 5 2 2 3 1 6 3 5 8 4 6 1 5 4 5 1 6 5 5 3 6 4 1 6 1 3 5 2 7 5 2 4 4 5 6 5 5 4 3 4 6 5 4 4 3 5 8 5 5 6 3 1 7 4 4 3 3 5 3 6 3 3 6 2 5 3 2 4 5 4 5 2 2 4 4 4 7 3 4 6 5 3 6 4 7 1 6 5 7 6 5 7 3 7 4 4 1 6 6 4",
"output": "1501 1501"
},
{
"input": "610 33\n15 44 8 8 17 11 39 39 38 25 17 36 17 25 21 37 10 11 34 30 29 50 29 50 4 20 32 13 41 14 2 11 2",
"output": "12204 8871"
}
] | 1,584,901,362
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 404
| 2,048,000
|
count=0
n=int(input())
a=[int(i) for i in input().split()]
for i in range(0,len(a)):
count=count+abs(abs(a[i])-1)
print(count)
|
Title: Airport
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Lolek and Bolek are about to travel abroad by plane. The local airport has a special "Choose Your Plane" offer. The offer's conditions are as follows:
- it is up to a passenger to choose a plane to fly on; - if the chosen plane has *x* (*x*<=><=0) empty seats at the given moment, then the ticket for such a plane costs *x* zlotys (units of Polish currency).
The only ticket office of the airport already has a queue of *n* passengers in front of it. Lolek and Bolek have not stood in the queue yet, but they are already wondering what is the maximum and the minimum number of zlotys the airport administration can earn if all *n* passengers buy tickets according to the conditions of this offer?
The passengers buy tickets in turn, the first person in the queue goes first, then goes the second one, and so on up to *n*-th person.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of passengers in the queue and the number of planes in the airport, correspondingly. The next line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=1000) — *a**i* stands for the number of empty seats in the *i*-th plane before the ticket office starts selling tickets.
The numbers in the lines are separated by a space. It is guaranteed that there are at least *n* empty seats in total.
Output Specification:
Print two integers — the maximum and the minimum number of zlotys that the airport administration can earn, correspondingly.
Demo Input:
['4 3\n2 1 1\n', '4 3\n2 2 2\n']
Demo Output:
['5 5\n', '7 6\n']
Note:
In the first test sample the number of passengers is equal to the number of empty seats, so regardless of the way the planes are chosen, the administration will earn the same sum.
In the second sample the sum is maximized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person — to the 2-nd plane, the 3-rd person — to the 3-rd plane, the 4-th person — to the 1-st plane. The sum is minimized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person — to the 1-st plane, the 3-rd person — to the 2-nd plane, the 4-th person — to the 2-nd plane.
|
```python
count=0
n=int(input())
a=[int(i) for i in input().split()]
for i in range(0,len(a)):
count=count+abs(abs(a[i])-1)
print(count)
```
| -1
|
|
158
|
B
|
Taxi
|
PROGRAMMING
| 1,100
|
[
"*special",
"greedy",
"implementation"
] | null | null |
After the lessons *n* groups of schoolchildren went outside and decided to visit Polycarpus to celebrate his birthday. We know that the *i*-th group consists of *s**i* friends (1<=≤<=*s**i*<=≤<=4), and they want to go to Polycarpus together. They decided to get there by taxi. Each car can carry at most four passengers. What minimum number of cars will the children need if all members of each group should ride in the same taxi (but one taxi can take more than one group)?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of groups of schoolchildren. The second line contains a sequence of integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s**i*<=≤<=4). The integers are separated by a space, *s**i* is the number of children in the *i*-th group.
|
Print the single number — the minimum number of taxis necessary to drive all children to Polycarpus.
|
[
"5\n1 2 4 3 3\n",
"8\n2 3 4 4 2 1 3 1\n"
] |
[
"4\n",
"5\n"
] |
In the first test we can sort the children into four cars like this:
- the third group (consisting of four children), - the fourth group (consisting of three children), - the fifth group (consisting of three children), - the first and the second group (consisting of one and two children, correspondingly).
There are other ways to sort the groups into four cars.
| 1,000
|
[
{
"input": "5\n1 2 4 3 3",
"output": "4"
},
{
"input": "8\n2 3 4 4 2 1 3 1",
"output": "5"
},
{
"input": "5\n4 4 4 4 4",
"output": "5"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "4\n3 2 1 3",
"output": "3"
},
{
"input": "4\n2 4 1 3",
"output": "3"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n3",
"output": "1"
},
{
"input": "1\n4",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "2\n4 4",
"output": "2"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n3 1",
"output": "1"
},
{
"input": "2\n4 1",
"output": "2"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "2\n4 2",
"output": "2"
},
{
"input": "2\n4 3",
"output": "2"
},
{
"input": "4\n2 2 1 1",
"output": "2"
},
{
"input": "4\n3 1 3 1",
"output": "2"
},
{
"input": "4\n1 4 1 4",
"output": "3"
},
{
"input": "4\n2 2 3 3",
"output": "3"
},
{
"input": "4\n2 4 4 2",
"output": "3"
},
{
"input": "4\n3 3 4 4",
"output": "4"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 3 1",
"output": "2"
},
{
"input": "3\n4 1 1",
"output": "2"
},
{
"input": "3\n3 2 2",
"output": "2"
},
{
"input": "3\n2 4 2",
"output": "2"
},
{
"input": "3\n3 4 3",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "2"
},
{
"input": "3\n1 3 3",
"output": "2"
},
{
"input": "3\n4 4 1",
"output": "3"
},
{
"input": "3\n3 3 2",
"output": "3"
},
{
"input": "3\n4 2 4",
"output": "3"
},
{
"input": "3\n4 3 4",
"output": "3"
},
{
"input": "3\n4 3 2",
"output": "3"
},
{
"input": "3\n3 1 4",
"output": "2"
},
{
"input": "3\n2 1 4",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "4\n4 4 3 2",
"output": "4"
},
{
"input": "4\n1 4 3 1",
"output": "3"
},
{
"input": "4\n2 2 4 1",
"output": "3"
},
{
"input": "4\n3 2 1 2",
"output": "2"
},
{
"input": "5\n2 4 2 3 4",
"output": "4"
},
{
"input": "5\n1 3 4 1 3",
"output": "3"
},
{
"input": "5\n1 1 2 4 2",
"output": "3"
},
{
"input": "5\n1 3 2 3 2",
"output": "3"
},
{
"input": "8\n1 1 2 1 1 1 3 2",
"output": "3"
},
{
"input": "78\n2 2 2 2 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 3 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "39"
},
{
"input": "7\n2 2 2 1 2 1 2",
"output": "3"
},
{
"input": "9\n3 1 2 1 1 1 1 1 1",
"output": "3"
},
{
"input": "10\n3 1 2 2 2 2 2 2 1 2",
"output": "5"
},
{
"input": "18\n1 3 3 3 1 1 3 1 1 1 3 3 3 3 1 3 1 1",
"output": "9"
},
{
"input": "26\n3 1 3 3 1 3 2 3 1 3 3 2 1 2 3 2 2 1 2 1 2 1 1 3 2 1",
"output": "13"
}
] | 1,699,095,241
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 62
| 0
|
n = int(input())
A = list(map(int, input(). split()))
B = [0] * 5
kol = 0
for i in range(len(A)):
B[A[i]] += 1
q = min(B[1], B[3])
kol += q
B[1] -= q
B[3] -= q
kol += B[2] // 2
B[2] %= 2
q = min(B[2], B[1] // 2)
kol += q
B[2] -= q
B[1] -= 2 * q
kol += sum(B)
kol += B[1] // 4
B[1] %= 4
print(kol)
|
Title: Taxi
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After the lessons *n* groups of schoolchildren went outside and decided to visit Polycarpus to celebrate his birthday. We know that the *i*-th group consists of *s**i* friends (1<=≤<=*s**i*<=≤<=4), and they want to go to Polycarpus together. They decided to get there by taxi. Each car can carry at most four passengers. What minimum number of cars will the children need if all members of each group should ride in the same taxi (but one taxi can take more than one group)?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of groups of schoolchildren. The second line contains a sequence of integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s**i*<=≤<=4). The integers are separated by a space, *s**i* is the number of children in the *i*-th group.
Output Specification:
Print the single number — the minimum number of taxis necessary to drive all children to Polycarpus.
Demo Input:
['5\n1 2 4 3 3\n', '8\n2 3 4 4 2 1 3 1\n']
Demo Output:
['4\n', '5\n']
Note:
In the first test we can sort the children into four cars like this:
- the third group (consisting of four children), - the fourth group (consisting of three children), - the fifth group (consisting of three children), - the first and the second group (consisting of one and two children, correspondingly).
There are other ways to sort the groups into four cars.
|
```python
n = int(input())
A = list(map(int, input(). split()))
B = [0] * 5
kol = 0
for i in range(len(A)):
B[A[i]] += 1
q = min(B[1], B[3])
kol += q
B[1] -= q
B[3] -= q
kol += B[2] // 2
B[2] %= 2
q = min(B[2], B[1] // 2)
kol += q
B[2] -= q
B[1] -= 2 * q
kol += sum(B)
kol += B[1] // 4
B[1] %= 4
print(kol)
```
| 0
|
|
343
|
B
|
Alternating Current
|
PROGRAMMING
| 1,600
|
[
"data structures",
"greedy",
"implementation"
] | null | null |
Mad scientist Mike has just finished constructing a new device to search for extraterrestrial intelligence! He was in such a hurry to launch it for the first time that he plugged in the power wires without giving it a proper glance and started experimenting right away. After a while Mike observed that the wires ended up entangled and now have to be untangled again.
The device is powered by two wires "plus" and "minus". The wires run along the floor from the wall (on the left) to the device (on the right). Both the wall and the device have two contacts in them on the same level, into which the wires are plugged in some order. The wires are considered entangled if there are one or more places where one wire runs above the other one. For example, the picture below has four such places (top view):
Mike knows the sequence in which the wires run above each other. Mike also noticed that on the left side, the "plus" wire is always plugged into the top contact (as seen on the picture). He would like to untangle the wires without unplugging them and without moving the device. Determine if it is possible to do that. A wire can be freely moved and stretched on the floor, but cannot be cut.
To understand the problem better please read the notes to the test samples.
|
The single line of the input contains a sequence of characters "+" and "-" of length *n* (1<=≤<=*n*<=≤<=100000). The *i*-th (1<=≤<=*i*<=≤<=*n*) position of the sequence contains the character "+", if on the *i*-th step from the wall the "plus" wire runs above the "minus" wire, and the character "-" otherwise.
|
Print either "Yes" (without the quotes) if the wires can be untangled or "No" (without the quotes) if the wires cannot be untangled.
|
[
"-++-\n",
"+-\n",
"++\n",
"-\n"
] |
[
"Yes\n",
"No\n",
"Yes\n",
"No\n"
] |
The first testcase corresponds to the picture in the statement. To untangle the wires, one can first move the "plus" wire lower, thus eliminating the two crosses in the middle, and then draw it under the "minus" wire, eliminating also the remaining two crosses.
In the second testcase the "plus" wire makes one full revolution around the "minus" wire. Thus the wires cannot be untangled:
In the third testcase the "plus" wire simply runs above the "minus" wire twice in sequence. The wires can be untangled by lifting "plus" and moving it higher:
In the fourth testcase the "minus" wire runs above the "plus" wire once. The wires cannot be untangled without moving the device itself:
| 1,000
|
[
{
"input": "-++-",
"output": "Yes"
},
{
"input": "+-",
"output": "No"
},
{
"input": "++",
"output": "Yes"
},
{
"input": "-",
"output": "No"
},
{
"input": "+-+-",
"output": "No"
},
{
"input": "-+-",
"output": "No"
},
{
"input": "-++-+--+",
"output": "Yes"
},
{
"input": "+",
"output": "No"
},
{
"input": "-+",
"output": "No"
},
{
"input": "--",
"output": "Yes"
},
{
"input": "+++",
"output": "No"
},
{
"input": "--+",
"output": "No"
},
{
"input": "++--++",
"output": "Yes"
},
{
"input": "+-++-+",
"output": "Yes"
},
{
"input": "+-+--+",
"output": "No"
},
{
"input": "--++-+",
"output": "No"
},
{
"input": "-+-+--",
"output": "No"
},
{
"input": "+-+++-",
"output": "No"
},
{
"input": "-+-+-+",
"output": "No"
},
{
"input": "-++-+--++--+-++-",
"output": "Yes"
},
{
"input": "+-----+-++---+------+++-++++",
"output": "No"
},
{
"input": "-+-++--+++-++++---+--+----+--+-+-+++-+++-+---++-++++-+--+--+--+-+-++-+-+-++++++---++--+++++-+--++--+-+--++-----+--+-++---+++---++----+++-++++--++-++-",
"output": "No"
},
{
"input": "-+-----++++--++-+-++",
"output": "Yes"
},
{
"input": "+--+--+------+++++++-+-+++--++---+--+-+---+--+++-+++-------+++++-+-++++--+-+-+++++++----+----+++----+-+++-+++-----+++-+-++-+-+++++-+--++----+--+-++-----+-+-++++---+++---+-+-+-++++--+--+++---+++++-+---+-----+++-++--+++---++-++-+-+++-+-+-+---+++--+--++++-+-+--++-------+--+---++-----+++--+-+++--++-+-+++-++--+++-++++++++++-++-++++++-+++--+--++-+++--+++-++++----+++---+-+----++++-+-+",
"output": "Yes"
},
{
"input": "-+-+-++-+-+-",
"output": "Yes"
},
{
"input": "-+-++-+-",
"output": "Yes"
},
{
"input": "-+-++-+-+-",
"output": "No"
},
{
"input": "++-+-+-+-+--+",
"output": "No"
},
{
"input": "+++---",
"output": "No"
},
{
"input": "+-+-+-+-+--+-+-+-+-++--++--+",
"output": "Yes"
},
{
"input": "+-+-++",
"output": "No"
},
{
"input": "-++--+--+++-+-+-+-+-",
"output": "No"
},
{
"input": "+---+-+-",
"output": "No"
},
{
"input": "+-+--+-+",
"output": "Yes"
},
{
"input": "+++---+++---",
"output": "No"
},
{
"input": "-+++++",
"output": "No"
},
{
"input": "-+-+-+-+-+-+-++-+-+-+-+-+-+-",
"output": "Yes"
},
{
"input": "-+++--",
"output": "No"
},
{
"input": "+---+",
"output": "No"
},
{
"input": "-++",
"output": "No"
},
{
"input": "-+--+-",
"output": "Yes"
},
{
"input": "+---++--++",
"output": "No"
},
{
"input": "+++-",
"output": "No"
},
{
"input": "--+++",
"output": "No"
},
{
"input": "++-+",
"output": "No"
}
] | 1,602,433,350
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 280
| 1,843,200
|
arr = list(input())
ans = []
for i in arr:
if len(ans)==0:
ans.append(i)
else:
if ans[-1]==i:
ans.pop(-1)
else:
ans.append(i)
if len(ans):
print('No')
else:
print('Yes')
|
Title: Alternating Current
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mad scientist Mike has just finished constructing a new device to search for extraterrestrial intelligence! He was in such a hurry to launch it for the first time that he plugged in the power wires without giving it a proper glance and started experimenting right away. After a while Mike observed that the wires ended up entangled and now have to be untangled again.
The device is powered by two wires "plus" and "minus". The wires run along the floor from the wall (on the left) to the device (on the right). Both the wall and the device have two contacts in them on the same level, into which the wires are plugged in some order. The wires are considered entangled if there are one or more places where one wire runs above the other one. For example, the picture below has four such places (top view):
Mike knows the sequence in which the wires run above each other. Mike also noticed that on the left side, the "plus" wire is always plugged into the top contact (as seen on the picture). He would like to untangle the wires without unplugging them and without moving the device. Determine if it is possible to do that. A wire can be freely moved and stretched on the floor, but cannot be cut.
To understand the problem better please read the notes to the test samples.
Input Specification:
The single line of the input contains a sequence of characters "+" and "-" of length *n* (1<=≤<=*n*<=≤<=100000). The *i*-th (1<=≤<=*i*<=≤<=*n*) position of the sequence contains the character "+", if on the *i*-th step from the wall the "plus" wire runs above the "minus" wire, and the character "-" otherwise.
Output Specification:
Print either "Yes" (without the quotes) if the wires can be untangled or "No" (without the quotes) if the wires cannot be untangled.
Demo Input:
['-++-\n', '+-\n', '++\n', '-\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n', 'No\n']
Note:
The first testcase corresponds to the picture in the statement. To untangle the wires, one can first move the "plus" wire lower, thus eliminating the two crosses in the middle, and then draw it under the "minus" wire, eliminating also the remaining two crosses.
In the second testcase the "plus" wire makes one full revolution around the "minus" wire. Thus the wires cannot be untangled:
In the third testcase the "plus" wire simply runs above the "minus" wire twice in sequence. The wires can be untangled by lifting "plus" and moving it higher:
In the fourth testcase the "minus" wire runs above the "plus" wire once. The wires cannot be untangled without moving the device itself:
|
```python
arr = list(input())
ans = []
for i in arr:
if len(ans)==0:
ans.append(i)
else:
if ans[-1]==i:
ans.pop(-1)
else:
ans.append(i)
if len(ans):
print('No')
else:
print('Yes')
```
| 3
|
|
337
|
A
|
Puzzles
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
|
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
|
Print a single integer — the least possible difference the teacher can obtain.
|
[
"4 6\n10 12 10 7 5 22\n"
] |
[
"5\n"
] |
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
| 500
|
[
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,696,860,950
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
students, puzzles = map(int, input().split())
pieces = list(map(int, input().split()))
pieces.sort()
sub_pieces = pieces[:students]
difference = sub_pieces[-1] - sub_pieces[0]
print(difference)
|
Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
|
```python
students, puzzles = map(int, input().split())
pieces = list(map(int, input().split()))
pieces.sort()
sub_pieces = pieces[:students]
difference = sub_pieces[-1] - sub_pieces[0]
print(difference)
```
| 0
|
|
760
|
A
|
Petr and a calendar
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
|
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
|
Print single integer: the number of columns the table should have.
|
[
"1 7\n",
"1 1\n",
"11 6\n"
] |
[
"6\n",
"5\n",
"5\n"
] |
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
| 500
|
[
{
"input": "1 7",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "1 2",
"output": "5"
},
{
"input": "1 3",
"output": "5"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "6"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "2 4",
"output": "5"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "3 1",
"output": "5"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "5"
},
{
"input": "3 4",
"output": "5"
},
{
"input": "3 5",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "3 7",
"output": "6"
},
{
"input": "4 1",
"output": "5"
},
{
"input": "4 2",
"output": "5"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "4 6",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "5"
},
{
"input": "5 3",
"output": "5"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "5 6",
"output": "6"
},
{
"input": "5 7",
"output": "6"
},
{
"input": "6 1",
"output": "5"
},
{
"input": "6 2",
"output": "5"
},
{
"input": "6 3",
"output": "5"
},
{
"input": "6 4",
"output": "5"
},
{
"input": "6 5",
"output": "5"
},
{
"input": "6 6",
"output": "5"
},
{
"input": "6 7",
"output": "6"
},
{
"input": "7 1",
"output": "5"
},
{
"input": "7 2",
"output": "5"
},
{
"input": "7 3",
"output": "5"
},
{
"input": "7 4",
"output": "5"
},
{
"input": "7 5",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "8 1",
"output": "5"
},
{
"input": "8 2",
"output": "5"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "5"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "8 7",
"output": "6"
},
{
"input": "9 1",
"output": "5"
},
{
"input": "9 2",
"output": "5"
},
{
"input": "9 3",
"output": "5"
},
{
"input": "9 4",
"output": "5"
},
{
"input": "9 5",
"output": "5"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "10 1",
"output": "5"
},
{
"input": "10 2",
"output": "5"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "10 4",
"output": "5"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "10 6",
"output": "6"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "11 1",
"output": "5"
},
{
"input": "11 2",
"output": "5"
},
{
"input": "11 3",
"output": "5"
},
{
"input": "11 4",
"output": "5"
},
{
"input": "11 5",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "12 1",
"output": "5"
},
{
"input": "12 2",
"output": "5"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "12 4",
"output": "5"
},
{
"input": "12 5",
"output": "5"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 7",
"output": "6"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "6 6",
"output": "5"
}
] | 1,485,614,499
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
a=list(map(int,input().split()))
dayinm=[31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
answ=(dayinm[a[0]-1]-(8-a[1])+6//7+1
print(answ)
|
Title: Petr and a calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
Input Specification:
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
Output Specification:
Print single integer: the number of columns the table should have.
Demo Input:
['1 7\n', '1 1\n', '11 6\n']
Demo Output:
['6\n', '5\n', '5\n']
Note:
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
|
```python
a=list(map(int,input().split()))
dayinm=[31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
answ=(dayinm[a[0]-1]-(8-a[1])+6//7+1
print(answ)
```
| -1
|
|
149
|
A
|
Business trip
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
|
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
|
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
|
[
"5\n1 1 1 1 2 2 3 2 2 1 1 1\n",
"0\n0 0 0 0 0 0 0 1 1 2 3 0\n",
"11\n1 1 4 1 1 5 1 1 4 1 1 1\n"
] |
[
"2\n",
"0\n",
"3\n"
] |
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
| 500
|
[
{
"input": "5\n1 1 1 1 2 2 3 2 2 1 1 1",
"output": "2"
},
{
"input": "0\n0 0 0 0 0 0 0 1 1 2 3 0",
"output": "0"
},
{
"input": "11\n1 1 4 1 1 5 1 1 4 1 1 1",
"output": "3"
},
{
"input": "15\n20 1 1 1 1 2 2 1 2 2 1 1",
"output": "1"
},
{
"input": "7\n8 9 100 12 14 17 21 10 11 100 23 10",
"output": "1"
},
{
"input": "52\n1 12 3 11 4 5 10 6 9 7 8 2",
"output": "6"
},
{
"input": "50\n2 2 3 4 5 4 4 5 7 3 2 7",
"output": "-1"
},
{
"input": "0\n55 81 28 48 99 20 67 95 6 19 10 93",
"output": "0"
},
{
"input": "93\n85 40 93 66 92 43 61 3 64 51 90 21",
"output": "1"
},
{
"input": "99\n36 34 22 0 0 0 52 12 0 0 33 47",
"output": "2"
},
{
"input": "99\n28 32 31 0 10 35 11 18 0 0 32 28",
"output": "3"
},
{
"input": "99\n19 17 0 1 18 11 29 9 29 22 0 8",
"output": "4"
},
{
"input": "76\n2 16 11 10 12 0 20 4 4 14 11 14",
"output": "5"
},
{
"input": "41\n2 1 7 7 4 2 4 4 9 3 10 0",
"output": "6"
},
{
"input": "47\n8 2 2 4 3 1 9 4 2 7 7 8",
"output": "7"
},
{
"input": "58\n6 11 7 0 5 6 3 9 4 9 5 1",
"output": "8"
},
{
"input": "32\n5 2 4 1 5 0 5 1 4 3 0 3",
"output": "9"
},
{
"input": "31\n6 1 0 4 4 5 1 0 5 3 2 0",
"output": "9"
},
{
"input": "35\n2 3 0 0 6 3 3 4 3 5 0 6",
"output": "9"
},
{
"input": "41\n3 1 3 4 3 6 6 1 4 4 0 6",
"output": "11"
},
{
"input": "97\n0 5 3 12 10 16 22 8 21 17 21 10",
"output": "5"
},
{
"input": "100\n21 21 0 0 4 13 0 26 0 0 0 15",
"output": "6"
},
{
"input": "100\n0 0 16 5 22 0 5 0 25 0 14 13",
"output": "7"
},
{
"input": "97\n17 0 10 0 0 0 18 0 14 23 15 0",
"output": "6"
},
{
"input": "100\n0 9 0 18 7 0 0 14 33 3 0 16",
"output": "7"
},
{
"input": "95\n5 2 13 0 15 18 17 0 6 11 0 8",
"output": "9"
},
{
"input": "94\n11 13 0 9 15 8 8 16 3 7 1 3",
"output": "11"
},
{
"input": "96\n8 4 12 15 8 0 4 10 6 6 12 11",
"output": "11"
},
{
"input": "100\n5 5 3 8 6 5 0 3 3 8 1 3",
"output": "-1"
},
{
"input": "100\n1 0 0 1 1 0 1 1 1 1 2 1",
"output": "-1"
},
{
"input": "100\n6 3 2 0 4 1 2 2 2 2 1 1",
"output": "-1"
},
{
"input": "0\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
},
{
"input": "0\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "12"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 2",
"output": "12"
},
{
"input": "15\n10 1 1 1 1 1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
}
] | 1,647,844,350
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 92
| 0
|
num=int(input())
lis=list(map(int,input().split()))
lis.sort(reverse=True)
sap=0
cap=0
for i in range(12):
if sap>=num:
break
sap+=lis[i]
cap+=1
if sap<num:
print(-1)
else:
print(cap)
|
Title: Business trip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
Input Specification:
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
Output Specification:
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
Demo Input:
['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n']
Demo Output:
['2\n', '0\n', '3\n']
Note:
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
|
```python
num=int(input())
lis=list(map(int,input().split()))
lis.sort(reverse=True)
sap=0
cap=0
for i in range(12):
if sap>=num:
break
sap+=lis[i]
cap+=1
if sap<num:
print(-1)
else:
print(cap)
```
| 3
|
|
586
|
A
|
Alena's Schedule
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying.
One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes).
The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks).
The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not.
Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university.
Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home.
Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
|
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university.
The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
|
Print a single number — the number of pairs during which Alena stays at the university.
|
[
"5\n0 1 0 1 1\n",
"7\n1 0 1 0 0 1 0\n",
"1\n0\n"
] |
[
"4\n",
"4\n",
"0\n"
] |
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair.
In the last sample Alena doesn't have a single pair, so she spends all the time at home.
| 500
|
[
{
"input": "5\n0 1 0 1 1",
"output": "4"
},
{
"input": "7\n1 0 1 0 0 1 0",
"output": "4"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "11\n0 0 0 0 0 0 0 0 0 0 1",
"output": "1"
},
{
"input": "12\n1 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0",
"output": "16"
},
{
"input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1",
"output": "28"
},
{
"input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0",
"output": "39"
},
{
"input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1",
"output": "52"
},
{
"input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1",
"output": "72"
},
{
"input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0",
"output": "65"
},
{
"input": "11\n0 1 1 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "11\n0 1 0 1 0 0 1 1 0 1 1",
"output": "8"
},
{
"input": "11\n1 0 1 0 1 1 0 1 1 1 0",
"output": "10"
},
{
"input": "11\n1 0 0 0 0 0 1 0 1 1 1",
"output": "6"
},
{
"input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0",
"output": "7"
},
{
"input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1",
"output": "16"
},
{
"input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1",
"output": "14"
},
{
"input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0",
"output": "26"
},
{
"input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1",
"output": "27"
},
{
"input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0",
"output": "25"
},
{
"input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1",
"output": "24"
},
{
"input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0",
"output": "19"
},
{
"input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1",
"output": "32"
},
{
"input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0",
"output": "23"
},
{
"input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1",
"output": "32"
},
{
"input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0",
"output": "23"
},
{
"input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1",
"output": "39"
},
{
"input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0",
"output": "32"
},
{
"input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1",
"output": "36"
},
{
"input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0",
"output": "41"
},
{
"input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1",
"output": "42"
},
{
"input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0",
"output": "46"
},
{
"input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1",
"output": "46"
},
{
"input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0",
"output": "47"
},
{
"input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1",
"output": "44"
},
{
"input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0",
"output": "45"
},
{
"input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1",
"output": "51"
},
{
"input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0",
"output": "44"
},
{
"input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0",
"output": "53"
},
{
"input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1",
"output": "63"
},
{
"input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0",
"output": "56"
},
{
"input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "58"
},
{
"input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0",
"output": "65"
},
{
"input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1",
"output": "77"
},
{
"input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "90"
},
{
"input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "95"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
}
] | 1,558,639,237
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 93
| 0
|
n = int(input())
a = list(map(int, input().split()))
cnt = n;
z = 0
for i in range(n):
if a[i] == 0:
z += 1
else:
if z >= 2:
cnt -= z
z = 0
cnt -= z
if a[0] == 0 and a[1] == 1:
cnt -= 1
print(cnt)
|
Title: Alena's Schedule
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying.
One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes).
The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks).
The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not.
Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university.
Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home.
Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university.
The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Output Specification:
Print a single number — the number of pairs during which Alena stays at the university.
Demo Input:
['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n']
Demo Output:
['4\n', '4\n', '0\n']
Note:
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair.
In the last sample Alena doesn't have a single pair, so she spends all the time at home.
|
```python
n = int(input())
a = list(map(int, input().split()))
cnt = n;
z = 0
for i in range(n):
if a[i] == 0:
z += 1
else:
if z >= 2:
cnt -= z
z = 0
cnt -= z
if a[0] == 0 and a[1] == 1:
cnt -= 1
print(cnt)
```
| -1
|
|
255
|
A
|
Greg's Workout
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
|
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
|
[
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] |
[
"biceps\n",
"back\n",
"chest\n"
] |
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
| 500
|
[
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,572,153,527
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 61
| 280
| 0
|
ch="chest"
bi="biceps"
ba="back"
m={ch:0,bi:0,ba:0}
n=int(input())
a=map(int,input().split())
s=[ch,bi,ba]*n
z=zip(s[:n],a)
for e,ai in z:
m[e]+=ai
print(max(m,key=m.get))
|
Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
|
```python
ch="chest"
bi="biceps"
ba="back"
m={ch:0,bi:0,ba:0}
n=int(input())
a=map(int,input().split())
s=[ch,bi,ba]*n
z=zip(s[:n],a)
for e,ai in z:
m[e]+=ai
print(max(m,key=m.get))
```
| 3
|
|
221
|
A
|
Little Elephant and Function
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order.
|
A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation.
|
In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists.
|
[
"1\n",
"2\n"
] |
[
"1 ",
"2 1 "
] |
none
| 500
|
[
{
"input": "1",
"output": "1 "
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "4",
"output": "4 1 2 3 "
},
{
"input": "5",
"output": "5 1 2 3 4 "
},
{
"input": "6",
"output": "6 1 2 3 4 5 "
},
{
"input": "7",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "999",
"output": "999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "998",
"output": "998 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "997",
"output": "997 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "900",
"output": "900 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "101",
"output": "101 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "67",
"output": "67 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 "
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "971",
"output": "971 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "683",
"output": "683 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "99",
"output": "99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 "
},
{
"input": "811",
"output": "811 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "875",
"output": "875 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "291",
"output": "291 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "419",
"output": "419 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "21",
"output": "21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 "
},
{
"input": "22",
"output": "22 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 "
},
{
"input": "23",
"output": "23 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 "
},
{
"input": "24",
"output": "24 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 "
},
{
"input": "25",
"output": "25 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 "
}
] | 1,632,148,425
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 310
| 23,040,000
|
from collections import Counter
import re
a = list(range(1, int(input())+1))
def elesort(x):
if x == 0:
return
a[x], a[x-1] = a[x-1], a[x]
elesort(x-1)
elesort(len(a)-1)
print(*a)
|
Title: Little Elephant and Function
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order.
Input Specification:
A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation.
Output Specification:
In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists.
Demo Input:
['1\n', '2\n']
Demo Output:
['1 ', '2 1 ']
Note:
none
|
```python
from collections import Counter
import re
a = list(range(1, int(input())+1))
def elesort(x):
if x == 0:
return
a[x], a[x-1] = a[x-1], a[x]
elesort(x-1)
elesort(len(a)-1)
print(*a)
```
| 3
|
|
483
|
B
|
Friends and Presents
|
PROGRAMMING
| 1,800
|
[
"binary search",
"math"
] | null | null |
You have two friends. You want to present each of them several positive integers. You want to present *cnt*1 numbers to the first friend and *cnt*2 numbers to the second friend. Moreover, you want all presented numbers to be distinct, that also means that no number should be presented to both friends.
In addition, the first friend does not like the numbers that are divisible without remainder by prime number *x*. The second one does not like the numbers that are divisible without remainder by prime number *y*. Of course, you're not going to present your friends numbers they don't like.
Your task is to find such minimum number *v*, that you can form presents using numbers from a set 1,<=2,<=...,<=*v*. Of course you may choose not to present some numbers at all.
A positive integer number greater than 1 is called prime if it has no positive divisors other than 1 and itself.
|
The only line contains four positive integers *cnt*1, *cnt*2, *x*, *y* (1<=≤<=*cnt*1,<=*cnt*2<=<<=109; *cnt*1<=+<=*cnt*2<=≤<=109; 2<=≤<=*x*<=<<=*y*<=≤<=3·104) — the numbers that are described in the statement. It is guaranteed that numbers *x*, *y* are prime.
|
Print a single integer — the answer to the problem.
|
[
"3 1 2 3\n",
"1 3 2 3\n"
] |
[
"5\n",
"4\n"
] |
In the first sample you give the set of numbers {1, 3, 5} to the first friend and the set of numbers {2} to the second friend. Note that if you give set {1, 3, 5} to the first friend, then we cannot give any of the numbers 1, 3, 5 to the second friend.
In the second sample you give the set of numbers {3} to the first friend, and the set of numbers {1, 2, 4} to the second friend. Thus, the answer to the problem is 4.
| 1,000
|
[
{
"input": "3 1 2 3",
"output": "5"
},
{
"input": "1 3 2 3",
"output": "4"
},
{
"input": "916200 69682 2 3",
"output": "1832399"
},
{
"input": "808351 17767 433 509",
"output": "826121"
},
{
"input": "8851 901 20897 26183",
"output": "9752"
},
{
"input": "5099 2895 16273 29473",
"output": "7994"
},
{
"input": "5099 2895 16273 29473",
"output": "7994"
},
{
"input": "4969 694 293 2347",
"output": "5663"
},
{
"input": "683651932 161878530 2 5",
"output": "1367303863"
},
{
"input": "325832598 637961741 2 3",
"output": "1156553206"
},
{
"input": "999999999 1 2 3",
"output": "1999999997"
},
{
"input": "11006 976 6287 9007",
"output": "11982"
},
{
"input": "150064728 173287472 439 503",
"output": "323353664"
},
{
"input": "819712074 101394406 6173 7307",
"output": "921106500"
},
{
"input": "67462086 313228052 15131 29027",
"output": "380690138"
},
{
"input": "500000000 500000000 29983 29989",
"output": "1000000001"
},
{
"input": "500000000 500000000 2 3",
"output": "1199999999"
},
{
"input": "500000000 500000000 29959 29983",
"output": "1000000001"
},
{
"input": "999999999 1 29983 29989",
"output": "1000033352"
},
{
"input": "1 999999999 29983 29989",
"output": "1000033345"
},
{
"input": "1 999999999 2 3",
"output": "1499999998"
},
{
"input": "999999998 1 2 3",
"output": "1999999995"
},
{
"input": "999999998 2 2 3",
"output": "1999999995"
},
{
"input": "9999999 10000 29983 29989",
"output": "10009999"
},
{
"input": "1000 9999999 29983 29989",
"output": "10000999"
},
{
"input": "110 40 1567 7681",
"output": "150"
},
{
"input": "197 2 6361 18223",
"output": "199"
},
{
"input": "39 154 1033 18947",
"output": "193"
},
{
"input": "126 51 26249 29443",
"output": "177"
},
{
"input": "14 179 19699 29303",
"output": "193"
},
{
"input": "14797 3593 13147 13933",
"output": "18390"
},
{
"input": "782 5750 7079 23957",
"output": "6532"
},
{
"input": "10876 8828 12487 16607",
"output": "19704"
},
{
"input": "16860 2201 6427 23327",
"output": "19061"
},
{
"input": "4901 563 1997 15053",
"output": "5464"
},
{
"input": "1277613 596606 10427 29387",
"output": "1874219"
},
{
"input": "1513389 40825 5641 10009",
"output": "1554214"
},
{
"input": "1749165 72848 9743 20023",
"output": "1822013"
},
{
"input": "954386 580262 4993 15629",
"output": "1534648"
},
{
"input": "159606 875491 43 19121",
"output": "1035098"
},
{
"input": "139694297 21147406 8819 28499",
"output": "160841703"
},
{
"input": "26941620 135675892 4093 28979",
"output": "162617513"
},
{
"input": "9156260 174697920 8171 29863",
"output": "183854180"
},
{
"input": "191370899 1962652 3517 24023",
"output": "193333553"
},
{
"input": "78618222 88031575 28289 29023",
"output": "166649797"
},
{
"input": "1 1 2 3",
"output": "2"
},
{
"input": "1 2 2 3",
"output": "3"
},
{
"input": "1 2 29983 29989",
"output": "3"
},
{
"input": "1 1 29983 29989",
"output": "2"
},
{
"input": "2 1 2 3",
"output": "3"
}
] | 1,690,348,733
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 50
| 62
| 0
|
def main():
cnt1, cnt2, x, y = list(map(int, input().split()))
l, r = -1, 10**18
ans = 10**18
while l+1 < r:
v = (l + r) // 2
if max(cnt1 - v // y + v//(x*y), 0) + max(cnt2 - v // x + v // (x*y), 0)<= v - v//x - v//y + v // (x * y):
ans = min(ans, v)
r = v
else:
l = v
print(ans)
if __name__ == "__main__":
main()
|
Title: Friends and Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have two friends. You want to present each of them several positive integers. You want to present *cnt*1 numbers to the first friend and *cnt*2 numbers to the second friend. Moreover, you want all presented numbers to be distinct, that also means that no number should be presented to both friends.
In addition, the first friend does not like the numbers that are divisible without remainder by prime number *x*. The second one does not like the numbers that are divisible without remainder by prime number *y*. Of course, you're not going to present your friends numbers they don't like.
Your task is to find such minimum number *v*, that you can form presents using numbers from a set 1,<=2,<=...,<=*v*. Of course you may choose not to present some numbers at all.
A positive integer number greater than 1 is called prime if it has no positive divisors other than 1 and itself.
Input Specification:
The only line contains four positive integers *cnt*1, *cnt*2, *x*, *y* (1<=≤<=*cnt*1,<=*cnt*2<=<<=109; *cnt*1<=+<=*cnt*2<=≤<=109; 2<=≤<=*x*<=<<=*y*<=≤<=3·104) — the numbers that are described in the statement. It is guaranteed that numbers *x*, *y* are prime.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3 1 2 3\n', '1 3 2 3\n']
Demo Output:
['5\n', '4\n']
Note:
In the first sample you give the set of numbers {1, 3, 5} to the first friend and the set of numbers {2} to the second friend. Note that if you give set {1, 3, 5} to the first friend, then we cannot give any of the numbers 1, 3, 5 to the second friend.
In the second sample you give the set of numbers {3} to the first friend, and the set of numbers {1, 2, 4} to the second friend. Thus, the answer to the problem is 4.
|
```python
def main():
cnt1, cnt2, x, y = list(map(int, input().split()))
l, r = -1, 10**18
ans = 10**18
while l+1 < r:
v = (l + r) // 2
if max(cnt1 - v // y + v//(x*y), 0) + max(cnt2 - v // x + v // (x*y), 0)<= v - v//x - v//y + v // (x * y):
ans = min(ans, v)
r = v
else:
l = v
print(ans)
if __name__ == "__main__":
main()
```
| 3
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,694,893,892
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
n=int(input())
list1=list(map(int,input().split()))
list1.sort()
list1.reverse()
sum1=0
sum2=0
for x in range(n):
if x%2==0:
sum1+=list1[x]
else:
sum2+=list1[x]
print(sum1,sum2)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
n=int(input())
list1=list(map(int,input().split()))
list1.sort()
list1.reverse()
sum1=0
sum2=0
for x in range(n):
if x%2==0:
sum1+=list1[x]
else:
sum2+=list1[x]
print(sum1,sum2)
```
| 0
|
|
584
|
A
|
Olesya and Rodion
|
PROGRAMMING
| 1,000
|
[
"math"
] | null | null |
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them.
Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
|
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
|
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
|
[
"3 2\n"
] |
[
"712"
] |
none
| 500
|
[
{
"input": "3 2",
"output": "222"
},
{
"input": "2 2",
"output": "22"
},
{
"input": "4 3",
"output": "3333"
},
{
"input": "5 3",
"output": "33333"
},
{
"input": "10 7",
"output": "7777777777"
},
{
"input": "2 9",
"output": "99"
},
{
"input": "18 8",
"output": "888888888888888888"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 10",
"output": "-1"
},
{
"input": "100 5",
"output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555"
},
{
"input": "10 2",
"output": "2222222222"
},
{
"input": "18 10",
"output": "111111111111111110"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "7 6",
"output": "6666666"
},
{
"input": "4 4",
"output": "4444"
},
{
"input": "14 7",
"output": "77777777777777"
},
{
"input": "3 8",
"output": "888"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "2 8",
"output": "88"
},
{
"input": "3 8",
"output": "888"
},
{
"input": "4 3",
"output": "3333"
},
{
"input": "5 9",
"output": "99999"
},
{
"input": "4 8",
"output": "8888"
},
{
"input": "3 4",
"output": "444"
},
{
"input": "9 4",
"output": "444444444"
},
{
"input": "8 10",
"output": "11111110"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "20 3",
"output": "33333333333333333333"
},
{
"input": "15 10",
"output": "111111111111110"
},
{
"input": "31 4",
"output": "4444444444444444444444444444444"
},
{
"input": "18 9",
"output": "999999999999999999"
},
{
"input": "72 4",
"output": "444444444444444444444444444444444444444444444444444444444444444444444444"
},
{
"input": "76 8",
"output": "8888888888888888888888888888888888888888888888888888888888888888888888888888"
},
{
"input": "12 5",
"output": "555555555555"
},
{
"input": "54 5",
"output": "555555555555555555555555555555555555555555555555555555"
},
{
"input": "96 10",
"output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "15 9",
"output": "999999999999999"
},
{
"input": "100 2",
"output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222"
},
{
"input": "99 3",
"output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333"
},
{
"input": "98 4",
"output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444"
},
{
"input": "97 5",
"output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555"
},
{
"input": "100 6",
"output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666"
},
{
"input": "99 7",
"output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "98 8",
"output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888"
},
{
"input": "97 9",
"output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999"
},
{
"input": "100 10",
"output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "3 10",
"output": "110"
},
{
"input": "2 4",
"output": "44"
},
{
"input": "2 10",
"output": "10"
},
{
"input": "10 10",
"output": "1111111110"
},
{
"input": "4 10",
"output": "1110"
},
{
"input": "25 10",
"output": "1111111111111111111111110"
},
{
"input": "50 10",
"output": "11111111111111111111111111111111111111111111111110"
},
{
"input": "5 10",
"output": "11110"
},
{
"input": "99 10",
"output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "100 10",
"output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "20 10",
"output": "11111111111111111110"
},
{
"input": "99 7",
"output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "89 5",
"output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555"
},
{
"input": "6 10",
"output": "111110"
},
{
"input": "3 8",
"output": "888"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "100 7",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
}
] | 1,694,530,324
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 15
| 0
|
n = int(input())
t = int(input())
res = 1;
if (t != 10):
res = res*(10**(n-1))
res = res*t
else:
res = res*(10**(n-1))
print(res)
|
Title: Olesya and Rodion
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them.
Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
Input Specification:
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Output Specification:
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
Demo Input:
['3 2\n']
Demo Output:
['712']
Note:
none
|
```python
n = int(input())
t = int(input())
res = 1;
if (t != 10):
res = res*(10**(n-1))
res = res*t
else:
res = res*(10**(n-1))
print(res)
```
| -1
|
|
382
|
A
|
Ksenia and Pan Scales
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
|
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
|
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
|
[
"AC|T\nL\n",
"|ABC\nXYZ\n",
"W|T\nF\n",
"ABC|\nD\n"
] |
[
"AC|TL\n",
"XYZ|ABC\n",
"Impossible\n",
"Impossible\n"
] |
none
| 500
|
[
{
"input": "AC|T\nL",
"output": "AC|TL"
},
{
"input": "|ABC\nXYZ",
"output": "XYZ|ABC"
},
{
"input": "W|T\nF",
"output": "Impossible"
},
{
"input": "ABC|\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDEF",
"output": "ADF|BCE"
},
{
"input": "|\nABC",
"output": "Impossible"
},
{
"input": "|\nZXCVBANMIO",
"output": "XVAMO|ZCBNI"
},
{
"input": "|C\nA",
"output": "A|C"
},
{
"input": "|\nAB",
"output": "B|A"
},
{
"input": "A|XYZ\nUIOPL",
"output": "Impossible"
},
{
"input": "K|B\nY",
"output": "Impossible"
},
{
"input": "EQJWDOHKZRBISPLXUYVCMNFGT|\nA",
"output": "Impossible"
},
{
"input": "|MACKERIGZPVHNDYXJBUFLWSO\nQT",
"output": "Impossible"
},
{
"input": "ERACGIZOVPT|WXUYMDLJNQS\nKB",
"output": "ERACGIZOVPTB|WXUYMDLJNQSK"
},
{
"input": "CKQHRUZMISGE|FBVWPXDLTJYN\nOA",
"output": "CKQHRUZMISGEA|FBVWPXDLTJYNO"
},
{
"input": "V|CMOEUTAXBFWSK\nDLRZJGIYNQHP",
"output": "VDLRZJGIYNQHP|CMOEUTAXBFWSK"
},
{
"input": "QWHNMALDGKTJ|\nPBRYVXZUESCOIF",
"output": "QWHNMALDGKTJF|PBRYVXZUESCOI"
},
{
"input": "|\nFXCVMUEWZAHNDOSITPRLKQJYBG",
"output": "XVUWANOIPLQYG|FCMEZHDSTRKJB"
},
{
"input": "IB|PCGHZ\nFXWTJQNEKAUM",
"output": "Impossible"
},
{
"input": "EC|IWAXQ\nJUHSRKGZTOMYN",
"output": "ECJUHRGTMN|IWAXQSKZOY"
},
{
"input": "VDINYMA|UQKWBCLRHZJ\nXEGOF",
"output": "Impossible"
},
{
"input": "ZLTPSIQUBAR|XFDEMYC\nHNOJWG",
"output": "ZLTPSIQUBARG|XFDEMYCHNOJW"
},
{
"input": "R|FLZOTJNU\nGIYHKVX",
"output": "RGIYHKVX|FLZOTJNU"
},
{
"input": "W|TL\nQROFSADYPKHEJNMXBZVUCIG",
"output": "WQOSDPHJMBVCG|TLRFAYKENXZUI"
},
{
"input": "NRDFQSEKLAYMOT|ZH\nGUXIBJCVPW",
"output": "Impossible"
},
{
"input": "FGRT|\nAC",
"output": "Impossible"
},
{
"input": "|FGRT\nAC",
"output": "Impossible"
},
{
"input": "A|\nB",
"output": "A|B"
},
{
"input": "|A\nB",
"output": "B|A"
},
{
"input": "|\nA",
"output": "Impossible"
},
{
"input": "|\nQWERTYUIOPASDFGHJKLZXCVBNM",
"output": "WRYIPSFHKZCBM|QETUOADGJLXVN"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBN|\nM",
"output": "Impossible"
},
{
"input": "QWERTY|VBN\nUIOPASDFGHJKLZXC",
"output": "Impossible"
},
{
"input": "ABC|D\nKSL",
"output": "Impossible"
},
{
"input": "A|BCDEF\nGH",
"output": "Impossible"
},
{
"input": "|ABC\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDE",
"output": "Impossible"
},
{
"input": "|ASD\nX",
"output": "Impossible"
},
{
"input": "AB|CDEF\nXYZRT",
"output": "Impossible"
}
] | 1,672,164,507
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
# Wadea #
s1 = input()
s2 = input()
r = s1.index("|")
r2 = len(s2)-1
if r == 0:
print(s2+s1)
elif r == r2:
print("Impossible")
elif r > 0:
print(s1+s2)
elif 0 < r < r2:
print("Impossible")
|
Title: Ksenia and Pan Scales
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
Input Specification:
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
Output Specification:
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
Demo Input:
['AC|T\nL\n', '|ABC\nXYZ\n', 'W|T\nF\n', 'ABC|\nD\n']
Demo Output:
['AC|TL\n', 'XYZ|ABC\n', 'Impossible\n', 'Impossible\n']
Note:
none
|
```python
# Wadea #
s1 = input()
s2 = input()
r = s1.index("|")
r2 = len(s2)-1
if r == 0:
print(s2+s1)
elif r == r2:
print("Impossible")
elif r > 0:
print(s1+s2)
elif 0 < r < r2:
print("Impossible")
```
| 0
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,669,209,874
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 46
| 0
|
# B. Напитки
#
# n = int(input())
# s = input().split()
# s = [int(x) for x in s]
# r = sum(s) / n
# print(r)
n, k = map(int, input().split())
s = input().split()
s = [int(x) for x in s]
b = []
for i in s:
if i + k <= 5:
b.append(i)
print(len(b) // 3)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
# B. Напитки
#
# n = int(input())
# s = input().split()
# s = [int(x) for x in s]
# r = sum(s) / n
# print(r)
n, k = map(int, input().split())
s = input().split()
s = [int(x) for x in s]
b = []
for i in s:
if i + k <= 5:
b.append(i)
print(len(b) // 3)
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,693,658,287
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
string1=input()
st1=string1.lower()
string2=input()
st2=string2.lower()
st3=""
for i in range(len(st2)-1,-1,-1):
c=st2[i]
st3+=c
if st2==st3:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
string1=input()
st1=string1.lower()
string2=input()
st2=string2.lower()
st3=""
for i in range(len(st2)-1,-1,-1):
c=st2[i]
st3+=c
if st2==st3:
print("YES")
else:
print("NO")
```
| 0
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,632,030,695
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 122
| 6,963,200
|
y,w = input().split()
maxx = max(y,w)
total = 6-int(maxx)+1
if total==6:
print('1/1')
elif total==6:
print('5/6')
elif total==4:
print('2/3')
elif total==3:
print('1/2')
elif total==2:
print('1/3')
elif total==1:
print('1/6')
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
y,w = input().split()
maxx = max(y,w)
total = 6-int(maxx)+1
if total==6:
print('1/1')
elif total==6:
print('5/6')
elif total==4:
print('2/3')
elif total==3:
print('1/2')
elif total==2:
print('1/3')
elif total==1:
print('1/6')
```
| 0
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,632,214,287
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 78
| 6,758,400
|
a, b = map(int, input().split())
def fact(x):
if x == 1: return 1
return x * fact(x - 1)
print(fact(min(a, b)))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
a, b = map(int, input().split())
def fact(x):
if x == 1: return 1
return x * fact(x - 1)
print(fact(min(a, b)))
```
| 3
|
|
120
|
F
|
Spiders
|
PROGRAMMING
| 1,400
|
[
"dp",
"greedy",
"trees"
] | null | null |
One day mum asked Petya to sort his toys and get rid of some of them. Petya found a whole box of toy spiders. They were quite dear to him and the boy didn't want to throw them away. Petya conjured a cunning plan: he will glue all the spiders together and attach them to the ceiling. Besides, Petya knows that the lower the spiders will hang, the more mum is going to like it and then she won't throw his favourite toys away. Help Petya carry out the plan.
A spider consists of *k* beads tied together by *k*<=-<=1 threads. Each thread connects two different beads, at that any pair of beads that make up a spider is either directly connected by a thread, or is connected via some chain of threads and beads.
Petya may glue spiders together directly gluing their beads. The length of each thread equals 1. The sizes of the beads can be neglected. That's why we can consider that gluing spiders happens by identifying some of the beads (see the picture). Besides, the construction resulting from the gluing process should also represent a spider, that is, it should have the given features.
After Petya glues all spiders together, he measures the length of the resulting toy. The distance between a pair of beads is identified as the total length of the threads that connect these two beads. The length of the resulting construction is the largest distance between all pairs of beads. Petya wants to make the spider whose length is as much as possible.
The picture two shows two spiders from the second sample. We can glue to the bead number 2 of the first spider the bead number 1 of the second spider. The threads in the spiders that form the sequence of threads of maximum lengths are highlighted on the picture.
|
The first input file line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of spiders. Next *n* lines contain the descriptions of each spider: integer *n**i* (2<=≤<=*n**i*<=≤<=100) — the number of beads, then *n**i*<=-<=1 pairs of numbers denoting the numbers of the beads connected by threads. The beads that make up each spider are numbered from 1 to *n**i*.
|
Print a single number — the length of the required construction.
|
[
"1\n3 1 2 2 3\n",
"2\n3 1 2 1 3\n4 1 2 2 3 2 4\n",
"2\n5 1 2 2 3 3 4 3 5\n7 3 4 1 2 2 4 4 6 2 7 6 5\n"
] |
[
"2\n",
"4\n",
"7\n"
] |
none
| 0
|
[
{
"input": "1\n3 1 2 2 3",
"output": "2"
},
{
"input": "2\n3 1 2 1 3\n4 1 2 2 3 2 4",
"output": "4"
},
{
"input": "2\n5 1 2 2 3 3 4 3 5\n7 3 4 1 2 2 4 4 6 2 7 6 5",
"output": "7"
},
{
"input": "3\n3 1 2 2 3\n5 2 5 5 3 3 4 5 1\n9 6 5 5 9 4 8 4 7 2 1 2 6 2 4 6 3",
"output": "10"
},
{
"input": "7\n2 2 1\n4 1 4 2 3 1 2\n3 3 1 3 2\n5 1 4 3 5 1 2 1 3\n6 4 5 1 3 4 2 3 6 5 1\n7 1 3 3 6 7 4 7 1 5 2 3 5\n10 6 8 2 6 6 3 2 7 2 4 6 10 3 1 6 5 6 9",
"output": "23"
},
{
"input": "10\n3 1 2 1 3\n3 1 2 1 3\n7 1 2 1 3 3 4 7 5 1 6 5 1\n2 1 2\n4 4 3 3 1 4 2\n3 3 1 3 2\n5 4 2 5 1 3 5 3 4\n6 1 6 2 4 6 2 4 3 5 1\n7 2 4 4 6 7 3 3 1 3 5 2 7\n10 3 5 5 6 1 9 5 2 7 8 8 1 6 10 4 3 4 7",
"output": "36"
},
{
"input": "7\n4 2 3 4 1 2 4\n4 4 3 2 1 3 2\n3 2 1 2 3\n5 5 4 1 5 1 2 2 3\n6 1 3 4 5 2 6 3 2 1 4\n7 6 4 4 7 6 2 6 3 3 1 6 5\n10 8 10 4 8 5 9 5 6 3 4 3 1 5 3 4 7 1 2",
"output": "26"
},
{
"input": "7\n2 1 2\n4 4 1 1 2 4 3\n3 3 2 2 1\n5 4 1 1 5 4 3 1 2\n6 4 2 3 1 3 4 3 5 3 6\n8 7 4 6 2 6 7 4 5 4 1 1 3 6 8\n10 4 1 8 9 7 8 2 4 8 6 6 5 2 7 8 3 7 10",
"output": "23"
},
{
"input": "3\n4 3 2 3 1 1 4\n4 3 1 2 4 3 2\n4 1 4 2 1 4 3",
"output": "9"
},
{
"input": "3\n10 7 3 10 9 7 10 4 7 8 6 8 2 4 8 8 5 5 1\n12 10 3 11 4 11 9 12 1 10 12 8 7 8 11 6 5 10 6 10 2 6 8\n13 3 7 10 4 3 8 3 1 8 5 4 12 9 2 8 6 10 9 1 10 10 11 4 13",
"output": "18"
},
{
"input": "4\n5 3 2 3 5 4 1 4 3\n6 6 4 1 2 2 3 2 6 6 5\n7 6 1 6 4 4 5 1 7 4 3 2 6\n8 2 1 6 8 4 5 8 3 4 7 4 2 2 6",
"output": "15"
},
{
"input": "2\n10 8 1 6 7 10 8 7 5 3 4 5 3 9 2 6 9 2 10\n10 9 7 6 1 8 10 6 4 8 3 9 2 3 5 8 9 3 6",
"output": "14"
},
{
"input": "6\n3 1 3 1 2\n3 2 1 3 2\n5 2 5 5 1 2 3 2 4\n4 2 3 2 4 1 2\n5 2 3 2 1 3 5 2 4\n5 3 5 2 3 5 1 4 2",
"output": "16"
},
{
"input": "1\n50 4 37 49 41 40 10 23 14 35 3 39 46 40 8 11 35 32 17 3 7 25 47 17 27 49 1 28 9 6 38 41 29 22 13 38 16 4 48 4 21 13 23 49 30 35 44 25 34 25 18 31 50 21 6 32 19 19 28 22 42 39 25 22 26 21 40 21 33 21 39 14 43 3 15 17 2 19 12 26 24 28 5 22 11 4 20 10 45 48 36 4 22 4 32 4 31 39 49",
"output": "10"
},
{
"input": "4\n10 9 5 9 7 7 6 7 2 1 4 9 1 7 3 2 10 3 8\n10 9 10 2 5 3 6 5 7 9 3 9 1 9 2 2 8 2 4\n10 5 3 2 5 1 6 6 8 3 9 3 10 5 1 8 4 3 7\n10 7 6 3 1 8 10 2 3 2 7 5 9 10 5 1 4 2 8",
"output": "23"
}
] | 1,600,983,565
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 434
| 67,584,000
|
# Author: S Mahesh Raju
# Username: maheshraju2020
# Created on: 25/09/2020 02:59:49
from sys import stdin, stdout, setrecursionlimit
import heapq
from math import gcd, ceil, sqrt
from collections import Counter, deque
from bisect import bisect_left, bisect_right
from itertools import combinations, permutations
ii1 = lambda: int(stdin.readline().strip())
is1 = lambda: stdin.readline().strip()
iia = lambda: list(map(int, stdin.readline().strip().split()))
isa = lambda: stdin.readline().strip().split()
setrecursionlimit(100000)
mod = 1000000007
def get(d, num):
res = 0
for i in range(1, num + 1):
queue = deque([i, None])
path = 0
seen = set([i])
while len(queue):
cur = queue.popleft()
if cur == None:
if len(queue):
queue.append(None)
path += 1
else:
for neigh in d.get(cur, []):
if neigh not in seen:
seen.add(neigh)
queue.append(neigh)
res = max(res, path - 1)
return res
n = ii1()
res = 0
for i in range(n):
cur, *arr = iia()
d = {}
for i in range(0, len(arr), 2):
d.setdefault(arr[i], []).append(arr[i + 1])
d.setdefault(arr[i + 1], []).append(arr[i])
res += get(d, cur)
print(res)
|
Title: Spiders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day mum asked Petya to sort his toys and get rid of some of them. Petya found a whole box of toy spiders. They were quite dear to him and the boy didn't want to throw them away. Petya conjured a cunning plan: he will glue all the spiders together and attach them to the ceiling. Besides, Petya knows that the lower the spiders will hang, the more mum is going to like it and then she won't throw his favourite toys away. Help Petya carry out the plan.
A spider consists of *k* beads tied together by *k*<=-<=1 threads. Each thread connects two different beads, at that any pair of beads that make up a spider is either directly connected by a thread, or is connected via some chain of threads and beads.
Petya may glue spiders together directly gluing their beads. The length of each thread equals 1. The sizes of the beads can be neglected. That's why we can consider that gluing spiders happens by identifying some of the beads (see the picture). Besides, the construction resulting from the gluing process should also represent a spider, that is, it should have the given features.
After Petya glues all spiders together, he measures the length of the resulting toy. The distance between a pair of beads is identified as the total length of the threads that connect these two beads. The length of the resulting construction is the largest distance between all pairs of beads. Petya wants to make the spider whose length is as much as possible.
The picture two shows two spiders from the second sample. We can glue to the bead number 2 of the first spider the bead number 1 of the second spider. The threads in the spiders that form the sequence of threads of maximum lengths are highlighted on the picture.
Input Specification:
The first input file line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of spiders. Next *n* lines contain the descriptions of each spider: integer *n**i* (2<=≤<=*n**i*<=≤<=100) — the number of beads, then *n**i*<=-<=1 pairs of numbers denoting the numbers of the beads connected by threads. The beads that make up each spider are numbered from 1 to *n**i*.
Output Specification:
Print a single number — the length of the required construction.
Demo Input:
['1\n3 1 2 2 3\n', '2\n3 1 2 1 3\n4 1 2 2 3 2 4\n', '2\n5 1 2 2 3 3 4 3 5\n7 3 4 1 2 2 4 4 6 2 7 6 5\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
none
|
```python
# Author: S Mahesh Raju
# Username: maheshraju2020
# Created on: 25/09/2020 02:59:49
from sys import stdin, stdout, setrecursionlimit
import heapq
from math import gcd, ceil, sqrt
from collections import Counter, deque
from bisect import bisect_left, bisect_right
from itertools import combinations, permutations
ii1 = lambda: int(stdin.readline().strip())
is1 = lambda: stdin.readline().strip()
iia = lambda: list(map(int, stdin.readline().strip().split()))
isa = lambda: stdin.readline().strip().split()
setrecursionlimit(100000)
mod = 1000000007
def get(d, num):
res = 0
for i in range(1, num + 1):
queue = deque([i, None])
path = 0
seen = set([i])
while len(queue):
cur = queue.popleft()
if cur == None:
if len(queue):
queue.append(None)
path += 1
else:
for neigh in d.get(cur, []):
if neigh not in seen:
seen.add(neigh)
queue.append(neigh)
res = max(res, path - 1)
return res
n = ii1()
res = 0
for i in range(n):
cur, *arr = iia()
d = {}
for i in range(0, len(arr), 2):
d.setdefault(arr[i], []).append(arr[i + 1])
d.setdefault(arr[i + 1], []).append(arr[i])
res += get(d, cur)
print(res)
```
| -1
|
|
525
|
A
|
Vitaliy and Pie
|
PROGRAMMING
| 1,100
|
[
"greedy",
"hashing",
"strings"
] | null | null |
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
|
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
|
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
|
[
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] |
[
"0\n",
"3\n",
"2\n"
] |
none
| 250
|
[
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,622,850,252
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7
| 2,000
| 409,600
|
#%%
n = int(input())
plan = input()
keys = []
new_keys = 0
for i in range(0, len(plan), 2):
if plan[i].capitalize() != plan[i+1] and plan[i+1].lower() not in keys:
new_keys += 1
keys.append(plan[i])
elif plan[i+1].lower() in keys:
keys.remove(plan[i+1].lower())
keys.append(plan[i])
print(new_keys)
# %%
|
Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none
|
```python
#%%
n = int(input())
plan = input()
keys = []
new_keys = 0
for i in range(0, len(plan), 2):
if plan[i].capitalize() != plan[i+1] and plan[i+1].lower() not in keys:
new_keys += 1
keys.append(plan[i])
elif plan[i+1].lower() in keys:
keys.remove(plan[i+1].lower())
keys.append(plan[i])
print(new_keys)
# %%
```
| 0
|
|
588
|
B
|
Duff in Love
|
PROGRAMMING
| 1,300
|
[
"math"
] | null | null |
Duff is in love with lovely numbers! A positive integer *x* is called lovely if and only if there is no such positive integer *a*<=><=1 such that *a*2 is a divisor of *x*.
Malek has a number store! In his store, he has only divisors of positive integer *n* (and he has all of them). As a birthday present, Malek wants to give her a lovely number from his store. He wants this number to be as big as possible.
Malek always had issues in math, so he asked for your help. Please tell him what is the biggest lovely number in his store.
|
The first and only line of input contains one integer, *n* (1<=≤<=*n*<=≤<=1012).
|
Print the answer in one line.
|
[
"10\n",
"12\n"
] |
[
"10\n",
"6\n"
] |
In first sample case, there are numbers 1, 2, 5 and 10 in the shop. 10 isn't divisible by any perfect square, so 10 is lovely.
In second sample case, there are numbers 1, 2, 3, 4, 6 and 12 in the shop. 12 is divisible by 4 = 2<sup class="upper-index">2</sup>, so 12 is not lovely, while 6 is indeed lovely.
| 1,000
|
[
{
"input": "10",
"output": "10"
},
{
"input": "12",
"output": "6"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "4",
"output": "2"
},
{
"input": "8",
"output": "2"
},
{
"input": "3",
"output": "3"
},
{
"input": "31",
"output": "31"
},
{
"input": "97",
"output": "97"
},
{
"input": "1000000000000",
"output": "10"
},
{
"input": "15",
"output": "15"
},
{
"input": "894",
"output": "894"
},
{
"input": "271",
"output": "271"
},
{
"input": "2457",
"output": "273"
},
{
"input": "2829",
"output": "2829"
},
{
"input": "5000",
"output": "10"
},
{
"input": "20",
"output": "10"
},
{
"input": "68",
"output": "34"
},
{
"input": "3096",
"output": "258"
},
{
"input": "1024",
"output": "2"
},
{
"input": "1048576",
"output": "2"
},
{
"input": "413933789280",
"output": "25870861830"
},
{
"input": "817634153013",
"output": "817634153013"
},
{
"input": "56517269141",
"output": "56517269141"
},
{
"input": "30707328551",
"output": "30707328551"
},
{
"input": "279564127218",
"output": "10354226934"
},
{
"input": "491159577042",
"output": "18191095446"
},
{
"input": "734337660466",
"output": "734337660466"
},
{
"input": "808453785117",
"output": "808453785117"
},
{
"input": "55926835837",
"output": "55926835837"
},
{
"input": "294809951965",
"output": "294809951965"
},
{
"input": "537988035389",
"output": "76855433627"
},
{
"input": "822722434952",
"output": "205680608738"
},
{
"input": "699511759613",
"output": "699511759613"
},
{
"input": "942689843037",
"output": "104743315893"
},
{
"input": "663634158717",
"output": "663634158717"
},
{
"input": "213612977250",
"output": "11730"
},
{
"input": "999999999989",
"output": "999999999989"
},
{
"input": "999999999988",
"output": "499999999994"
},
{
"input": "87178291200",
"output": "30030"
},
{
"input": "927668721948",
"output": "463834360974"
},
{
"input": "562436815639",
"output": "37927"
},
{
"input": "302981118597",
"output": "35853"
},
{
"input": "5",
"output": "5"
},
{
"input": "9",
"output": "3"
},
{
"input": "36",
"output": "6"
},
{
"input": "2231",
"output": "2231"
},
{
"input": "27648",
"output": "6"
},
{
"input": "40320",
"output": "210"
},
{
"input": "648000",
"output": "30"
},
{
"input": "999966000289",
"output": "999983"
},
{
"input": "999985999949",
"output": "999985999949"
},
{
"input": "991921850317",
"output": "9973"
}
] | 1,567,450,339
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 53
| 608
| 0
|
n=int(input())
for i in range(2, 10**6):
while n%(i**2)==0:
n//= i
print(n)
|
Title: Duff in Love
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Duff is in love with lovely numbers! A positive integer *x* is called lovely if and only if there is no such positive integer *a*<=><=1 such that *a*2 is a divisor of *x*.
Malek has a number store! In his store, he has only divisors of positive integer *n* (and he has all of them). As a birthday present, Malek wants to give her a lovely number from his store. He wants this number to be as big as possible.
Malek always had issues in math, so he asked for your help. Please tell him what is the biggest lovely number in his store.
Input Specification:
The first and only line of input contains one integer, *n* (1<=≤<=*n*<=≤<=1012).
Output Specification:
Print the answer in one line.
Demo Input:
['10\n', '12\n']
Demo Output:
['10\n', '6\n']
Note:
In first sample case, there are numbers 1, 2, 5 and 10 in the shop. 10 isn't divisible by any perfect square, so 10 is lovely.
In second sample case, there are numbers 1, 2, 3, 4, 6 and 12 in the shop. 12 is divisible by 4 = 2<sup class="upper-index">2</sup>, so 12 is not lovely, while 6 is indeed lovely.
|
```python
n=int(input())
for i in range(2, 10**6):
while n%(i**2)==0:
n//= i
print(n)
```
| 3
|
|
1,004
|
A
|
Sonya and Hotels
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
|
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
|
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
|
[
"4 3\n-3 2 9 16\n",
"5 2\n4 8 11 18 19\n"
] |
[
"6\n",
"5\n"
] |
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
| 500
|
[
{
"input": "4 3\n-3 2 9 16",
"output": "6"
},
{
"input": "5 2\n4 8 11 18 19",
"output": "5"
},
{
"input": "10 10\n-67 -59 -49 -38 -8 20 41 59 74 83",
"output": "8"
},
{
"input": "10 10\n0 20 48 58 81 95 111 137 147 159",
"output": "9"
},
{
"input": "100 1\n0 1 2 3 4 5 7 8 10 11 12 13 14 15 16 17 19 21 22 23 24 25 26 27 28 30 32 33 36 39 40 41 42 46 48 53 54 55 59 60 61 63 65 68 70 71 74 75 76 79 80 81 82 84 88 89 90 91 93 94 96 97 98 100 101 102 105 106 107 108 109 110 111 113 114 115 116 117 118 120 121 122 125 126 128 131 132 133 134 135 137 138 139 140 143 144 146 147 148 149",
"output": "47"
},
{
"input": "1 1000000000\n-1000000000",
"output": "2"
},
{
"input": "2 1000000000\n-1000000000 1000000000",
"output": "3"
},
{
"input": "100 2\n1 3 5 6 8 9 12 13 14 17 18 21 22 23 24 25 26 27 29 30 34 35 36 39 41 44 46 48 52 53 55 56 57 59 61 63 64 66 68 69 70 71 72 73 75 76 77 79 80 81 82 87 88 91 92 93 94 95 96 97 99 100 102 103 104 106 109 110 111 112 113 114 115 117 118 119 120 122 124 125 127 128 129 130 131 132 133 134 136 137 139 140 141 142 143 145 146 148 149 150",
"output": "6"
},
{
"input": "100 3\n0 1 3 6 7 8 9 10 13 14 16 17 18 20 21 22 24 26 27 30 33 34 35 36 37 39 42 43 44 45 46 48 53 54 55 56 57 58 61 63 64 65 67 69 70 72 73 76 77 78 79 81 82 83 85 86 87 88 90 92 93 95 96 97 98 99 100 101 104 105 108 109 110 113 114 115 116 118 120 121 123 124 125 128 130 131 132 133 134 135 136 137 139 140 141 142 146 147 148 150",
"output": "2"
},
{
"input": "1 1000000000\n1000000000",
"output": "2"
},
{
"input": "10 2\n-93 -62 -53 -42 -38 11 57 58 87 94",
"output": "17"
},
{
"input": "2 500000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "100 10\n-489 -476 -445 -432 -430 -421 -420 -418 -412 -411 -404 -383 -356 -300 -295 -293 -287 -276 -265 -263 -258 -251 -249 -246 -220 -219 -205 -186 -166 -157 -143 -137 -136 -130 -103 -86 -80 -69 -67 -55 -43 -41 -40 -26 -19 -9 16 29 41 42 54 76 84 97 98 99 101 115 134 151 157 167 169 185 197 204 208 226 227 232 234 249 259 266 281 282 293 298 300 306 308 313 319 328 331 340 341 344 356 362 366 380 390 399 409 411 419 444 455 498",
"output": "23"
},
{
"input": "1 1000000000\n999999999",
"output": "2"
},
{
"input": "1 1\n-5",
"output": "2"
},
{
"input": "2 1\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "4 5\n0 20 40 60",
"output": "8"
},
{
"input": "1 1\n-10",
"output": "2"
},
{
"input": "1 1\n-1000000000",
"output": "2"
},
{
"input": "1 1000000000\n0",
"output": "2"
},
{
"input": "1 2\n-10",
"output": "2"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "1 5\n-100",
"output": "2"
},
{
"input": "2 1000000000\n999999999 1000000000",
"output": "2"
},
{
"input": "2 2\n0 5",
"output": "4"
},
{
"input": "1 2\n-5",
"output": "2"
},
{
"input": "1 1\n1",
"output": "2"
},
{
"input": "1 5\n-20",
"output": "2"
},
{
"input": "2 100000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 1000000000\n147483641",
"output": "2"
},
{
"input": "3 3\n1 8 9",
"output": "4"
},
{
"input": "2 1\n1 1000000000",
"output": "4"
},
{
"input": "1 2\n-4",
"output": "2"
},
{
"input": "2 1\n-1000000000 -1",
"output": "4"
}
] | 1,683,721,372
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 46
| 0
|
n, d = map(int, input().split())
hotels = list(map(int, input().split()))
count = 2 # initialize the count with 2, for the first and last possible positions
for i in range(1, n):
if hotels[i] - hotels[i-1] == 2 * d: # if the distance between the i-th and (i-1)-th hotels is 2d
count += 1 # add a new possible position
elif hotels[i] - hotels[i-1] > 2 * d: # if the distance between the i-th and (i-1)-th hotels is greater than 2d
count += 2 # add two new possible positions
print(count)
|
Title: Sonya and Hotels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
Input Specification:
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
Output Specification:
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
Demo Input:
['4 3\n-3 2 9 16\n', '5 2\n4 8 11 18 19\n']
Demo Output:
['6\n', '5\n']
Note:
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
|
```python
n, d = map(int, input().split())
hotels = list(map(int, input().split()))
count = 2 # initialize the count with 2, for the first and last possible positions
for i in range(1, n):
if hotels[i] - hotels[i-1] == 2 * d: # if the distance between the i-th and (i-1)-th hotels is 2d
count += 1 # add a new possible position
elif hotels[i] - hotels[i-1] > 2 * d: # if the distance between the i-th and (i-1)-th hotels is greater than 2d
count += 2 # add two new possible positions
print(count)
```
| 3
|
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,564,855,381
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 108
| 0
|
s=input()
k=int(input())
x,Sum = list(map(int, input().split(" "))),0
for i in range(len(s)):
Sum+=x[ord(s[i])-97]*(i+1)
print(Sum+sum(max(x)*(i+1) for i in range(len(s),len(s)+k)))
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
s=input()
k=int(input())
x,Sum = list(map(int, input().split(" "))),0
for i in range(len(s)):
Sum+=x[ord(s[i])-97]*(i+1)
print(Sum+sum(max(x)*(i+1) for i in range(len(s),len(s)+k)))
```
| 3
|
|
279
|
B
|
Books
|
PROGRAMMING
| 1,400
|
[
"binary search",
"brute force",
"implementation",
"two pointers"
] | null | null |
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
|
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
|
Print a single integer — the maximum number of books Valera can read.
|
[
"4 5\n3 1 2 1\n",
"3 3\n2 2 3\n"
] |
[
"3\n",
"1\n"
] |
none
| 1,000
|
[
{
"input": "4 5\n3 1 2 1",
"output": "3"
},
{
"input": "3 3\n2 2 3",
"output": "1"
},
{
"input": "1 3\n5",
"output": "0"
},
{
"input": "1 10\n4",
"output": "1"
},
{
"input": "2 10\n6 4",
"output": "2"
},
{
"input": "6 10\n2 3 4 2 1 1",
"output": "4"
},
{
"input": "7 13\n6 8 14 9 4 11 10",
"output": "2"
},
{
"input": "10 15\n10 9 1 1 5 10 5 3 7 2",
"output": "3"
},
{
"input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4",
"output": "6"
},
{
"input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19",
"output": "4"
},
{
"input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52",
"output": "3"
},
{
"input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708",
"output": "0"
},
{
"input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550",
"output": "1"
}
] | 1,694,658,670
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 2,000
| 13,209,600
|
def maxbook(n,time,data):
start=0
end=0
sumtime=data[0]
maxnum=0
while end<=n-1:
if sumtime<=time:
end+=1
else:
start+=1
sumtime=sum(data[start:end+1])
num=end-start
maxnum=max(maxnum,num)
return maxnum
data0=[int(x) for x in input().split()]
n,time=data0
data=[int(x) for x in input().split()]
print(maxbook(n,time,data))
|
Title: Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
Output Specification:
Print a single integer — the maximum number of books Valera can read.
Demo Input:
['4 5\n3 1 2 1\n', '3 3\n2 2 3\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
def maxbook(n,time,data):
start=0
end=0
sumtime=data[0]
maxnum=0
while end<=n-1:
if sumtime<=time:
end+=1
else:
start+=1
sumtime=sum(data[start:end+1])
num=end-start
maxnum=max(maxnum,num)
return maxnum
data0=[int(x) for x in input().split()]
n,time=data0
data=[int(x) for x in input().split()]
print(maxbook(n,time,data))
```
| 0
|
|
295
|
A
|
Greg and Array
|
PROGRAMMING
| 1,400
|
[
"data structures",
"implementation"
] | null | null |
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*.
Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array.
Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
|
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array.
Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105).
Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*).
The numbers in the lines are separated by single spaces.
|
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
|
[
"3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n",
"1 1 1\n1\n1 1 1\n1 1\n",
"4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n"
] |
[
"9 18 17\n",
"2\n",
"5 18 31 20\n"
] |
none
| 500
|
[
{
"input": "3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3",
"output": "9 18 17"
},
{
"input": "1 1 1\n1\n1 1 1\n1 1",
"output": "2"
},
{
"input": "4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3",
"output": "5 18 31 20"
},
{
"input": "1 1 1\n0\n1 1 0\n1 1",
"output": "0"
}
] | 1,593,312,126
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 1,500
| 42,598,400
|
n,m,k = map(int,input().split())
t = list(map(int,input().split()))
f=['1']+[0]*m
y=[]
for j in range(m):
y.append(list(map(int,input().split())))
for g in range(k):
a,b = map(int,input().split())
for w in range(a,b+1):
f[w]+=1
for d in range(m):
y[d][-1]= y[d][-1]*(f[d+1])
for r in y:
for h in range(r[0]-1,r[1]):
t[h]+=r[-1]
print(*t)
|
Title: Greg and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*.
Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array.
Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
Input Specification:
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array.
Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105).
Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*).
The numbers in the lines are separated by single spaces.
Output Specification:
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
Demo Input:
['3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n', '1 1 1\n1\n1 1 1\n1 1\n', '4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n']
Demo Output:
['9 18 17\n', '2\n', '5 18 31 20\n']
Note:
none
|
```python
n,m,k = map(int,input().split())
t = list(map(int,input().split()))
f=['1']+[0]*m
y=[]
for j in range(m):
y.append(list(map(int,input().split())))
for g in range(k):
a,b = map(int,input().split())
for w in range(a,b+1):
f[w]+=1
for d in range(m):
y[d][-1]= y[d][-1]*(f[d+1])
for r in y:
for h in range(r[0]-1,r[1]):
t[h]+=r[-1]
print(*t)
```
| 0
|
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,677,172,672
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 60
| 0
|
s = input()
res = s[-1] * s.count(s[-1])
mx = 1
print(res)
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
s = input()
res = s[-1] * s.count(s[-1])
mx = 1
print(res)
```
| 0
|
|
302
|
A
|
Eugeny and Array
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Eugeny has array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n*, consisting of *n* integers. Each integer *a**i* equals to -1, or to 1. Also, he has *m* queries:
- Query number *i* is given as a pair of integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). - The response to the query will be integer 1, if the elements of array *a* can be rearranged so as the sum *a**l**i*<=+<=*a**l**i*<=+<=1<=+<=...<=+<=*a**r**i*<==<=0, otherwise the response to the query will be integer 0.
Help Eugeny, answer all his queries.
|
The first line contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=2·105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (*a**i*<==<=-1,<=1). Next *m* lines contain Eugene's queries. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*).
|
Print *m* integers — the responses to Eugene's queries in the order they occur in the input.
|
[
"2 3\n1 -1\n1 1\n1 2\n2 2\n",
"5 5\n-1 1 1 1 -1\n1 1\n2 3\n3 5\n2 5\n1 5\n"
] |
[
"0\n1\n0\n",
"0\n1\n0\n1\n0\n"
] |
none
| 500
|
[
{
"input": "2 3\n1 -1\n1 1\n1 2\n2 2",
"output": "0\n1\n0"
},
{
"input": "5 5\n-1 1 1 1 -1\n1 1\n2 3\n3 5\n2 5\n1 5",
"output": "0\n1\n0\n1\n0"
},
{
"input": "3 3\n1 1 1\n2 2\n1 1\n1 1",
"output": "0\n0\n0"
},
{
"input": "4 4\n-1 -1 -1 -1\n1 3\n1 2\n1 2\n1 1",
"output": "0\n0\n0\n0"
},
{
"input": "5 5\n-1 -1 -1 -1 -1\n1 1\n1 1\n3 4\n1 1\n1 4",
"output": "0\n0\n0\n0\n0"
},
{
"input": "6 6\n-1 -1 1 -1 -1 1\n1 1\n3 4\n1 1\n1 1\n1 3\n1 4",
"output": "0\n1\n0\n0\n0\n1"
},
{
"input": "7 7\n-1 -1 -1 1 -1 -1 -1\n1 1\n2 7\n1 3\n1 5\n4 7\n1 7\n6 7",
"output": "0\n0\n0\n0\n0\n0\n1"
},
{
"input": "8 8\n1 1 1 1 1 1 1 1\n5 8\n2 6\n2 3\n1 7\n7 7\n1 6\n1 8\n1 3",
"output": "0\n0\n0\n0\n0\n0\n0\n0"
},
{
"input": "9 9\n-1 1 1 1 1 1 1 1 1\n1 7\n5 6\n1 4\n1 1\n1 1\n6 8\n1 1\n6 7\n3 5",
"output": "0\n1\n0\n0\n0\n0\n0\n1\n0"
},
{
"input": "10 10\n-1 1 -1 1 -1 -1 -1 -1 -1 -1\n6 7\n2 5\n3 6\n1 3\n3 5\n4 5\n3 4\n1 6\n1 1\n1 1",
"output": "1\n1\n1\n0\n0\n1\n1\n0\n0\n0"
},
{
"input": "1 1\n-1\n1 1",
"output": "0"
},
{
"input": "1 1\n1\n1 1",
"output": "0"
}
] | 1,569,405,605
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 1,000
| 11,571,200
|
#import math
n, m = input().split()
n = int (n)
m = int (m)
#n, m, k = input().split()
#n = int (n)
#m = int (m)
#k = int (k)
#n = int(input())
#m = int(input())
#s = input()
#t = input()
g = list(map(int, input().split()))
ones = g.count(1)
mi = n - ones
#print(l)
#c = list(map(int, input().split()))
#x1, y1, x2, y2 =map(int,input().split())
#n = int(input())
#f = []
#t = [0]*n
#f = [(int(s1[0]),s1[1]), (int(s2[0]),s2[1]), (int(s3[0]), s3[1])]
for i in range(m):
a, b = input().split()
a = int (a)
b = int (b)
d = b-a +1
if (d//2 <= ones and d // 2 <= mi and d % 2 == 0):
print(1)
else:
print(0)
#h = [""] * n
#f1 = sorted(f, key = lambda tup: tup[0])
#f1 = sorted(t, key = lambda tup: tup[0])
|
Title: Eugeny and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eugeny has array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n*, consisting of *n* integers. Each integer *a**i* equals to -1, or to 1. Also, he has *m* queries:
- Query number *i* is given as a pair of integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). - The response to the query will be integer 1, if the elements of array *a* can be rearranged so as the sum *a**l**i*<=+<=*a**l**i*<=+<=1<=+<=...<=+<=*a**r**i*<==<=0, otherwise the response to the query will be integer 0.
Help Eugeny, answer all his queries.
Input Specification:
The first line contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=2·105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (*a**i*<==<=-1,<=1). Next *m* lines contain Eugene's queries. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*).
Output Specification:
Print *m* integers — the responses to Eugene's queries in the order they occur in the input.
Demo Input:
['2 3\n1 -1\n1 1\n1 2\n2 2\n', '5 5\n-1 1 1 1 -1\n1 1\n2 3\n3 5\n2 5\n1 5\n']
Demo Output:
['0\n1\n0\n', '0\n1\n0\n1\n0\n']
Note:
none
|
```python
#import math
n, m = input().split()
n = int (n)
m = int (m)
#n, m, k = input().split()
#n = int (n)
#m = int (m)
#k = int (k)
#n = int(input())
#m = int(input())
#s = input()
#t = input()
g = list(map(int, input().split()))
ones = g.count(1)
mi = n - ones
#print(l)
#c = list(map(int, input().split()))
#x1, y1, x2, y2 =map(int,input().split())
#n = int(input())
#f = []
#t = [0]*n
#f = [(int(s1[0]),s1[1]), (int(s2[0]),s2[1]), (int(s3[0]), s3[1])]
for i in range(m):
a, b = input().split()
a = int (a)
b = int (b)
d = b-a +1
if (d//2 <= ones and d // 2 <= mi and d % 2 == 0):
print(1)
else:
print(0)
#h = [""] * n
#f1 = sorted(f, key = lambda tup: tup[0])
#f1 = sorted(t, key = lambda tup: tup[0])
```
| 0
|
|
205
|
A
|
Little Elephant and Rozdil
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
|
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
|
[
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] |
[
"2\n",
"Still Rozdil\n"
] |
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
| 500
|
[
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,641,920,367
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 342
| 12,800,000
|
#For fast I/O
import sys
input = sys.stdin.readline
n = int(input())
l = [int(i) for i in input().split()]
smol = min(l)
if l.count(smol) == 1:
print(l.index(smol)+1)
else:
print("Still Rozdil")
|
Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
|
```python
#For fast I/O
import sys
input = sys.stdin.readline
n = int(input())
l = [int(i) for i in input().split()]
smol = min(l)
if l.count(smol) == 1:
print(l.index(smol)+1)
else:
print("Still Rozdil")
```
| 3
|
|
82
|
A
|
Double Cola
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] |
A. Double Cola
|
1
|
256
|
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
|
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
|
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
|
[
"1\n",
"6\n",
"1802\n"
] |
[
"Sheldon\n",
"Sheldon\n",
"Penny\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "Sheldon"
},
{
"input": "6",
"output": "Sheldon"
},
{
"input": "1802",
"output": "Penny"
},
{
"input": "1",
"output": "Sheldon"
},
{
"input": "2",
"output": "Leonard"
},
{
"input": "3",
"output": "Penny"
},
{
"input": "4",
"output": "Rajesh"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "10",
"output": "Penny"
},
{
"input": "534",
"output": "Rajesh"
},
{
"input": "5033",
"output": "Howard"
},
{
"input": "10010",
"output": "Howard"
},
{
"input": "500000000",
"output": "Penny"
},
{
"input": "63",
"output": "Rajesh"
},
{
"input": "841",
"output": "Leonard"
},
{
"input": "3667",
"output": "Penny"
},
{
"input": "38614",
"output": "Howard"
},
{
"input": "282798",
"output": "Rajesh"
},
{
"input": "9266286",
"output": "Rajesh"
},
{
"input": "27385966",
"output": "Leonard"
},
{
"input": "121580142",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "300",
"output": "Howard"
},
{
"input": "1745",
"output": "Leonard"
},
{
"input": "8302",
"output": "Rajesh"
},
{
"input": "184518",
"output": "Sheldon"
},
{
"input": "1154414",
"output": "Rajesh"
},
{
"input": "28643950",
"output": "Leonard"
},
{
"input": "159222638",
"output": "Howard"
},
{
"input": "24",
"output": "Penny"
},
{
"input": "505",
"output": "Penny"
},
{
"input": "4425",
"output": "Rajesh"
},
{
"input": "12079",
"output": "Sheldon"
},
{
"input": "469726",
"output": "Penny"
},
{
"input": "3961838",
"output": "Penny"
},
{
"input": "57710446",
"output": "Leonard"
},
{
"input": "80719470",
"output": "Howard"
},
{
"input": "1000000000",
"output": "Penny"
},
{
"input": "999999999",
"output": "Penny"
},
{
"input": "999999998",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
}
] | 1,419,065,172
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 46
| 0
|
a=int(input())
b=a
j=5
k=0
l=["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"]
if a<5:
print(l[a-1])
else:
for i in range(1,a+1):
if j>b:
p=(j/(5))
k=b//p
k=int(k)
print(l[k])
break
b=b-j
j=j*2
|
Title: Double Cola
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
Input Specification:
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Output Specification:
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
Demo Input:
['1\n', '6\n', '1802\n']
Demo Output:
['Sheldon\n', 'Sheldon\n', 'Penny\n']
Note:
none
|
```python
a=int(input())
b=a
j=5
k=0
l=["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"]
if a<5:
print(l[a-1])
else:
for i in range(1,a+1):
if j>b:
p=(j/(5))
k=b//p
k=int(k)
print(l[k])
break
b=b-j
j=j*2
```
| 0
|
227
|
B
|
Effective Approach
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
|
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
|
[
"2\n1 2\n1\n1\n",
"2\n2 1\n1\n1\n",
"3\n3 1 2\n3\n1 2 3\n"
] |
[
"1 2\n",
"2 1\n",
"6 6\n"
] |
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
| 1,000
|
[
{
"input": "2\n1 2\n1\n1",
"output": "1 2"
},
{
"input": "2\n2 1\n1\n1",
"output": "2 1"
},
{
"input": "3\n3 1 2\n3\n1 2 3",
"output": "6 6"
},
{
"input": "9\n2 9 3 1 6 4 7 8 5\n9\n5 1 5 2 8 4 4 4 5",
"output": "58 32"
},
{
"input": "10\n3 10 9 2 7 6 5 8 4 1\n1\n4",
"output": "9 2"
},
{
"input": "10\n5 2 10 8 3 1 9 7 6 4\n9\n2 5 9 2 3 2 5 9 8",
"output": "31 68"
},
{
"input": "9\n3 8 4 7 1 2 5 6 9\n3\n2 7 1",
"output": "15 15"
},
{
"input": "9\n5 3 8 4 2 6 1 7 9\n4\n6 1 9 2",
"output": "27 13"
},
{
"input": "4\n1 3 2 4\n4\n3 1 2 3",
"output": "8 12"
},
{
"input": "3\n1 2 3\n8\n3 2 1 1 2 3 1 2",
"output": "15 17"
}
] | 1,656,880,673
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 966
| 26,316,800
|
from hashlib import new
import sys
import threading
from sys import stdin, stdout
from itertools import accumulate
input = stdin.readline
print = stdout.write
import math
if __name__ == "__main__":
n = int(input().strip())
arr = list(map(int, input().strip().split()))
dict = {x:i for (i,x) in enumerate(arr)}
front, reverse = 0, 0
m = int(input().strip())
queries = list(map(int, input().strip().split()))
for i in range(m):
pos = dict[queries[i]]
front += pos + 1
reverse += (n-pos)
'''if pos == (n-pos):
continue
elif pos < (n-pos):
front += 1
else:
reverse += 1'''
print(f"{front} {reverse}\n")
|
Title: Effective Approach
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
Output Specification:
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Demo Input:
['2\n1 2\n1\n1\n', '2\n2 1\n1\n1\n', '3\n3 1 2\n3\n1 2 3\n']
Demo Output:
['1 2\n', '2 1\n', '6 6\n']
Note:
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
|
```python
from hashlib import new
import sys
import threading
from sys import stdin, stdout
from itertools import accumulate
input = stdin.readline
print = stdout.write
import math
if __name__ == "__main__":
n = int(input().strip())
arr = list(map(int, input().strip().split()))
dict = {x:i for (i,x) in enumerate(arr)}
front, reverse = 0, 0
m = int(input().strip())
queries = list(map(int, input().strip().split()))
for i in range(m):
pos = dict[queries[i]]
front += pos + 1
reverse += (n-pos)
'''if pos == (n-pos):
continue
elif pos < (n-pos):
front += 1
else:
reverse += 1'''
print(f"{front} {reverse}\n")
```
| 3
|
|
621
|
A
|
Wet Shark and Odd and Even
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
|
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
|
Print the maximum possible even sum that can be obtained if we use some of the given integers.
|
[
"3\n1 2 3\n",
"5\n999999999 999999999 999999999 999999999 999999999\n"
] |
[
"6",
"3999999996"
] |
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
| 500
|
[
{
"input": "3\n1 2 3",
"output": "6"
},
{
"input": "5\n999999999 999999999 999999999 999999999 999999999",
"output": "3999999996"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98",
"output": "870"
},
{
"input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25",
"output": "840"
},
{
"input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44",
"output": "922"
},
{
"input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59",
"output": "674"
},
{
"input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82",
"output": "848"
},
{
"input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93",
"output": "902"
},
{
"input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20",
"output": "798"
},
{
"input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31",
"output": "632"
},
{
"input": "1\n4",
"output": "4"
},
{
"input": "2\n1 4",
"output": "4"
},
{
"input": "3\n1 2 4",
"output": "6"
},
{
"input": "2\n9 3",
"output": "12"
},
{
"input": "2\n1000000000 1001",
"output": "1000000000"
},
{
"input": "3\n1 8 4",
"output": "12"
},
{
"input": "3\n7 4 4",
"output": "8"
},
{
"input": "5\n2 3 4 5 3",
"output": "14"
},
{
"input": "2\n4 5",
"output": "4"
},
{
"input": "3\n2 4 5",
"output": "6"
},
{
"input": "3\n2 2 3",
"output": "4"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "4\n2 3 7 7",
"output": "16"
},
{
"input": "2\n999999999 2",
"output": "2"
},
{
"input": "2\n2 5",
"output": "2"
},
{
"input": "3\n5 3 1",
"output": "8"
},
{
"input": "4\n3 2 5 7",
"output": "14"
}
] | 1,669,211,502
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 31
| 0
|
n = int(input())
a = map(int, input().split())
a = list(a)
s = []
for i in range(n):
if a[i] != 0:
s.append(a[i])
if sum(s)%2!=0:
s.pop(a[i]%2!=0)
if sum(s)%2==0:
print(sum(s))
elif sum(s)%2!=0:
print(0)
|
Title: Wet Shark and Odd and Even
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
Input Specification:
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Output Specification:
Print the maximum possible even sum that can be obtained if we use some of the given integers.
Demo Input:
['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n']
Demo Output:
['6', '3999999996']
Note:
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
|
```python
n = int(input())
a = map(int, input().split())
a = list(a)
s = []
for i in range(n):
if a[i] != 0:
s.append(a[i])
if sum(s)%2!=0:
s.pop(a[i]%2!=0)
if sum(s)%2==0:
print(sum(s))
elif sum(s)%2!=0:
print(0)
```
| -1
|
|
160
|
A
|
Twins
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] | null | null |
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
|
In the single line print the single number — the minimum needed number of coins.
|
[
"2\n3 3\n",
"3\n2 1 2\n"
] |
[
"2\n",
"2\n"
] |
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
| 500
|
[
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "5\n4 2 2 2 2",
"output": "3"
},
{
"input": "7\n1 10 1 2 1 1 1",
"output": "1"
},
{
"input": "5\n3 2 3 3 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "4"
},
{
"input": "7\n10 10 5 5 5 5 1",
"output": "3"
},
{
"input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4",
"output": "8"
},
{
"input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40",
"output": "8"
},
{
"input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90",
"output": "6"
},
{
"input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28",
"output": "14"
},
{
"input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42",
"output": "22"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "51"
},
{
"input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2",
"output": "37"
},
{
"input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "36"
},
{
"input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3",
"output": "33"
},
{
"input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "30"
},
{
"input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2",
"output": "29"
},
{
"input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "30"
},
{
"input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "29"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "30"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n4 1 2 3",
"output": "2"
},
{
"input": "5\n2 2 2 4 4",
"output": "2"
},
{
"input": "4\n100 99 99 100",
"output": "2"
}
] | 1,699,531,650
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 13
| 62
| 0
|
n=int(input())
strcoins= list(map(int, input().split()))
totalvalue=0
sumaextraida=0
nummonedas=0
casillero=[0]*100
#for i in range(100):
#casillero[i]=0
for i in range(n):
totalvalue=totalvalue+strcoins[i]
a=strcoins[i]
casillero[a]=casillero[a]+1
minmoneytotake=(totalvalue/2)
#print(minmoneytotake)
for i in range(99,-1,-1):
while casillero[i]!=0:
sumaextraida=sumaextraida+i
nummonedas=nummonedas+1
if sumaextraida>minmoneytotake:
break
casillero[i]=casillero[i]-1
if sumaextraida>minmoneytotake:
break
#print(sumaextraida)
print(nummonedas)
|
Title: Twins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
Output Specification:
In the single line print the single number — the minimum needed number of coins.
Demo Input:
['2\n3 3\n', '3\n2 1 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
|
```python
n=int(input())
strcoins= list(map(int, input().split()))
totalvalue=0
sumaextraida=0
nummonedas=0
casillero=[0]*100
#for i in range(100):
#casillero[i]=0
for i in range(n):
totalvalue=totalvalue+strcoins[i]
a=strcoins[i]
casillero[a]=casillero[a]+1
minmoneytotake=(totalvalue/2)
#print(minmoneytotake)
for i in range(99,-1,-1):
while casillero[i]!=0:
sumaextraida=sumaextraida+i
nummonedas=nummonedas+1
if sumaextraida>minmoneytotake:
break
casillero[i]=casillero[i]-1
if sumaextraida>minmoneytotake:
break
#print(sumaextraida)
print(nummonedas)
```
| -1
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Some time ago Slastyona the Sweetmaid decided to open her own bakery! She bought required ingredients and a wonder-oven which can bake several types of cakes, and opened the bakery.
Soon the expenses started to overcome the income, so Slastyona decided to study the sweets market. She learned it's profitable to pack cakes in boxes, and that the more distinct cake types a box contains (let's denote this number as the value of the box), the higher price it has.
She needs to change the production technology! The problem is that the oven chooses the cake types on its own and Slastyona can't affect it. However, she knows the types and order of *n* cakes the oven is going to bake today. Slastyona has to pack exactly *k* boxes with cakes today, and she has to put in each box several (at least one) cakes the oven produced one right after another (in other words, she has to put in a box a continuous segment of cakes).
Slastyona wants to maximize the total value of all boxes with cakes. Help her determine this maximum possible total value.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=35000, 1<=≤<=*k*<=≤<=*min*(*n*,<=50)) – the number of cakes and the number of boxes, respectively.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) – the types of cakes in the order the oven bakes them.
|
Print the only integer – the maximum total value of all boxes with cakes.
|
[
"4 1\n1 2 2 1\n",
"7 2\n1 3 3 1 4 4 4\n",
"8 3\n7 7 8 7 7 8 1 7\n"
] |
[
"2\n",
"5\n",
"6\n"
] |
In the first example Slastyona has only one box. She has to put all cakes in it, so that there are two types of cakes in the box, so the value is equal to 2.
In the second example it is profitable to put the first two cakes in the first box, and all the rest in the second. There are two distinct types in the first box, and three in the second box then, so the total value is 5.
| 0
|
[] | 1,501,584,334
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 9
| 2,500
| 8,192,000
|
n,k = map(int, input().split())
cakes = list(map(int, input().split()))
dp = [[0 for _ in range(n)] for _ in range(k+1)]
dp[1] = [len(set(cakes[:i])) for i in range(1,n+1)]
#print(dp)
for box in range(2,k+1):
for cake in range(n):
#print(box, cake, [dp[box-1][i] + len(set(cakes[i+1:cake+1])) for i in range(cake+1)])
dp[box][cake] = max([dp[box-1][i] + len(set(cakes[i+1:cake+1])) for i in range(cake+1)])
print(dp[k][n-1])
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some time ago Slastyona the Sweetmaid decided to open her own bakery! She bought required ingredients and a wonder-oven which can bake several types of cakes, and opened the bakery.
Soon the expenses started to overcome the income, so Slastyona decided to study the sweets market. She learned it's profitable to pack cakes in boxes, and that the more distinct cake types a box contains (let's denote this number as the value of the box), the higher price it has.
She needs to change the production technology! The problem is that the oven chooses the cake types on its own and Slastyona can't affect it. However, she knows the types and order of *n* cakes the oven is going to bake today. Slastyona has to pack exactly *k* boxes with cakes today, and she has to put in each box several (at least one) cakes the oven produced one right after another (in other words, she has to put in a box a continuous segment of cakes).
Slastyona wants to maximize the total value of all boxes with cakes. Help her determine this maximum possible total value.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=35000, 1<=≤<=*k*<=≤<=*min*(*n*,<=50)) – the number of cakes and the number of boxes, respectively.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) – the types of cakes in the order the oven bakes them.
Output Specification:
Print the only integer – the maximum total value of all boxes with cakes.
Demo Input:
['4 1\n1 2 2 1\n', '7 2\n1 3 3 1 4 4 4\n', '8 3\n7 7 8 7 7 8 1 7\n']
Demo Output:
['2\n', '5\n', '6\n']
Note:
In the first example Slastyona has only one box. She has to put all cakes in it, so that there are two types of cakes in the box, so the value is equal to 2.
In the second example it is profitable to put the first two cakes in the first box, and all the rest in the second. There are two distinct types in the first box, and three in the second box then, so the total value is 5.
|
```python
n,k = map(int, input().split())
cakes = list(map(int, input().split()))
dp = [[0 for _ in range(n)] for _ in range(k+1)]
dp[1] = [len(set(cakes[:i])) for i in range(1,n+1)]
#print(dp)
for box in range(2,k+1):
for cake in range(n):
#print(box, cake, [dp[box-1][i] + len(set(cakes[i+1:cake+1])) for i in range(cake+1)])
dp[box][cake] = max([dp[box-1][i] + len(set(cakes[i+1:cake+1])) for i in range(cake+1)])
print(dp[k][n-1])
```
| 0
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,692,187,644
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 31
| 124
| 0
|
def main():
n = int(input())
print(sum([int(i) for i in input().split()])/n)
if __name__ == "__main__":
main()
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
def main():
n = int(input())
print(sum([int(i) for i in input().split()])/n)
if __name__ == "__main__":
main()
```
| 3
|
|
573
|
B
|
Bear and Blocks
|
PROGRAMMING
| 1,600
|
[
"binary search",
"data structures",
"dp",
"math"
] | null | null |
Limak is a little bear who loves to play. Today he is playing by destroying block towers. He built *n* towers in a row. The *i*-th tower is made of *h**i* identical blocks. For clarification see picture for the first sample.
Limak will repeat the following operation till everything is destroyed.
Block is called internal if it has all four neighbors, i.e. it has each side (top, left, down and right) adjacent to other block or to the floor. Otherwise, block is boundary. In one operation Limak destroys all boundary blocks. His paws are very fast and he destroys all those blocks at the same time.
Limak is ready to start. You task is to count how many operations will it take him to destroy all towers.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=109) — sizes of towers.
|
Print the number of operations needed to destroy all towers.
|
[
"6\n2 1 4 6 2 2\n",
"7\n3 3 3 1 3 3 3\n"
] |
[
"3\n",
"2\n"
] |
The picture below shows all three operations for the first sample test. Each time boundary blocks are marked with red color.
| 1,000
|
[
{
"input": "6\n2 1 4 6 2 2",
"output": "3"
},
{
"input": "7\n3 3 3 1 3 3 3",
"output": "2"
},
{
"input": "7\n5128 5672 5805 5452 5882 5567 5032",
"output": "4"
},
{
"input": "10\n1 2 2 3 5 5 5 4 2 1",
"output": "5"
},
{
"input": "14\n20 20 20 20 20 20 3 20 20 20 20 20 20 20",
"output": "5"
},
{
"input": "50\n3 2 4 3 5 3 4 5 3 2 3 3 3 4 5 4 2 2 3 3 4 4 3 2 3 3 2 3 4 4 5 2 5 2 3 5 4 4 2 2 3 5 2 5 2 2 5 4 5 4",
"output": "4"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1049 1098",
"output": "1"
},
{
"input": "2\n100 100",
"output": "1"
},
{
"input": "5\n1 2 3 2 1",
"output": "3"
},
{
"input": "15\n2 2 1 1 2 2 2 2 2 2 2 2 2 1 2",
"output": "2"
},
{
"input": "28\n415546599 415546599 415546599 415546599 415546599 415546599 415546599 415546599 415546599 2 802811737 802811737 802811737 802811737 802811737 802811737 802811737 802811737 1 550595901 550595901 550595901 550595901 550595901 550595901 550595901 550595901 550595901",
"output": "6"
},
{
"input": "45\n3 12 13 11 13 13 10 11 14 15 15 13 14 12 13 11 14 10 10 14 14 11 10 12 11 11 13 14 10 11 14 13 14 11 11 11 12 15 1 10 15 12 14 14 14",
"output": "13"
},
{
"input": "84\n1 3 4 5 6 5 6 7 8 9 7 4 5 4 2 5 1 1 1 3 2 7 7 8 10 9 5 6 5 2 3 3 3 3 3 2 4 8 6 5 8 9 8 7 9 3 4 4 4 2 2 1 6 4 9 5 9 9 10 7 10 4 5 4 2 4 3 3 4 4 6 6 6 9 10 12 7 5 9 8 5 3 3 2",
"output": "8"
},
{
"input": "170\n1 2 1 2 1 1 1 1 2 3 2 1 1 2 2 1 2 1 2 1 1 2 3 3 2 1 1 1 1 1 1 1 1 2 1 2 3 3 2 1 2 2 1 2 3 2 1 1 2 3 2 1 2 1 1 1 2 3 3 2 1 2 1 2 1 1 1 2 1 2 1 1 2 2 1 1 2 1 2 2 1 2 1 2 2 1 2 1 2 3 2 1 1 2 3 4 4 3 2 1 2 1 2 1 2 3 3 2 1 2 1 1 1 1 1 1 1 2 2 1 1 2 1 1 1 1 2 1 1 2 3 2 1 2 2 1 2 1 1 1 2 2 1 2 1 2 3 2 1 2 1 1 1 2 3 4 5 4 3 2 1 1 2 1 2 3 4 3 2 1",
"output": "5"
},
{
"input": "1\n5",
"output": "1"
}
] | 1,691,920,381
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 14
| 187
| 18,739,200
|
import sys
input= lambda: sys.stdin.buffer.readline().decode('utf-8').rstrip('\r\n')
from array import array
inp= lambda: int(input())
mi = lambda x=int : map(x, input().split())
arr= lambda d='i',x=int: array(d,mi(x))
li = lambda x=int: list(mi(x))
lb = lambda: list(map(int, input()))
ls = lambda: list(input())
bi = lambda n: bin(n).replace("0b", "")
yn = ['No', 'Yes']
YN = ['NO', 'YES']
YY = "YES"
NN = "NO"
yy = "Yes"
nn = "No"
inf= sys.maxsize
mod=998244353
alp='abcdefghijklmnopqrstuvwxyz'
from itertools import accumulate as cml,permutations,combinations
from collections import Counter as ctr, deque as dq,defaultdict as dd
from bisect import bisect_left as bl,bisect_right as br
from math import ceil, gcd, log, sqrt
import heapq as hq
mod=10**9+7
mod=1000000007
def main(kase):
n=inp()
h=li()
qq=[(x,i) for i,x in enumerate(h)]
hq.heapify(qq)
ans=[n]*n
while qq:
# print(qq)
h,i=hq.heappop(qq)
if i>0:
ans[i]=min(ans[i],ans[i-1]+1)
if i<n-1:
ans[i]=min(ans[i],ans[i+1]+1)
ans[i]=min(ans[i],i+1,n-i,h)
# print(ans)
print(max(ans))
pass
if __name__ == "__main__":
test_Cases=1
# test_Cases=inp()
for i in range(test_Cases):
main(i)
|
Title: Bear and Blocks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is a little bear who loves to play. Today he is playing by destroying block towers. He built *n* towers in a row. The *i*-th tower is made of *h**i* identical blocks. For clarification see picture for the first sample.
Limak will repeat the following operation till everything is destroyed.
Block is called internal if it has all four neighbors, i.e. it has each side (top, left, down and right) adjacent to other block or to the floor. Otherwise, block is boundary. In one operation Limak destroys all boundary blocks. His paws are very fast and he destroys all those blocks at the same time.
Limak is ready to start. You task is to count how many operations will it take him to destroy all towers.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=109) — sizes of towers.
Output Specification:
Print the number of operations needed to destroy all towers.
Demo Input:
['6\n2 1 4 6 2 2\n', '7\n3 3 3 1 3 3 3\n']
Demo Output:
['3\n', '2\n']
Note:
The picture below shows all three operations for the first sample test. Each time boundary blocks are marked with red color.
|
```python
import sys
input= lambda: sys.stdin.buffer.readline().decode('utf-8').rstrip('\r\n')
from array import array
inp= lambda: int(input())
mi = lambda x=int : map(x, input().split())
arr= lambda d='i',x=int: array(d,mi(x))
li = lambda x=int: list(mi(x))
lb = lambda: list(map(int, input()))
ls = lambda: list(input())
bi = lambda n: bin(n).replace("0b", "")
yn = ['No', 'Yes']
YN = ['NO', 'YES']
YY = "YES"
NN = "NO"
yy = "Yes"
nn = "No"
inf= sys.maxsize
mod=998244353
alp='abcdefghijklmnopqrstuvwxyz'
from itertools import accumulate as cml,permutations,combinations
from collections import Counter as ctr, deque as dq,defaultdict as dd
from bisect import bisect_left as bl,bisect_right as br
from math import ceil, gcd, log, sqrt
import heapq as hq
mod=10**9+7
mod=1000000007
def main(kase):
n=inp()
h=li()
qq=[(x,i) for i,x in enumerate(h)]
hq.heapify(qq)
ans=[n]*n
while qq:
# print(qq)
h,i=hq.heappop(qq)
if i>0:
ans[i]=min(ans[i],ans[i-1]+1)
if i<n-1:
ans[i]=min(ans[i],ans[i+1]+1)
ans[i]=min(ans[i],i+1,n-i,h)
# print(ans)
print(max(ans))
pass
if __name__ == "__main__":
test_Cases=1
# test_Cases=inp()
for i in range(test_Cases):
main(i)
```
| 0
|
|
816
|
B
|
Karen and Coffee
|
PROGRAMMING
| 1,400
|
[
"binary search",
"data structures",
"implementation"
] | null | null |
To stay woke and attentive during classes, Karen needs some coffee!
Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe".
She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste.
Karen thinks that a temperature is admissible if at least *k* recipes recommend it.
Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
|
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively.
The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive.
The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
|
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
|
[
"3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n",
"2 1 1\n1 1\n200000 200000\n90 100\n"
] |
[
"3\n3\n0\n4\n",
"0\n"
] |
In the first test case, Karen knows 3 recipes.
1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive.
A temperature is admissible if at least 2 recipes recommend it.
She asks 4 questions.
In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible.
In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible.
In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none.
In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible.
In the second test case, Karen knows 2 recipes.
1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees.
A temperature is admissible if at least 1 recipe recommends it.
In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
| 1,000
|
[
{
"input": "3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100",
"output": "3\n3\n0\n4"
},
{
"input": "2 1 1\n1 1\n200000 200000\n90 100",
"output": "0"
},
{
"input": "1 1 1\n1 1\n1 1",
"output": "1"
},
{
"input": "1 1 1\n200000 200000\n200000 200000",
"output": "1"
}
] | 1,689,352,422
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 78
| 13,107,200
|
n, k, q = map(int, input().split())
recipes = []
for _ in range(n):
li, ri = map(int, input().split())
recipes.append((li, ri))
recipes.sort() # Sort the recipes based on the start temperature
prefix = [0] * 200001
count = 0
j = 0
for i in range(1, 200001):
while j < n and recipes[j][0] == i:
prefix[i] += 1
prefix[recipes[j][1] + 1] -= 1
j += 1
prefix = [prefix[0]] + list(map(lambda x: x + prefix[x - 1], range(1, len(prefix))))
admissible_temps = list(map(lambda x: x >= k, prefix))
for _ in range(q):
a, b = map(int, input().split())
print(admissible_temps[b] - admissible_temps[a - 1])
|
Title: Karen and Coffee
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To stay woke and attentive during classes, Karen needs some coffee!
Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe".
She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste.
Karen thinks that a temperature is admissible if at least *k* recipes recommend it.
Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
Input Specification:
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively.
The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive.
The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
Output Specification:
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
Demo Input:
['3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n', '2 1 1\n1 1\n200000 200000\n90 100\n']
Demo Output:
['3\n3\n0\n4\n', '0\n']
Note:
In the first test case, Karen knows 3 recipes.
1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive.
A temperature is admissible if at least 2 recipes recommend it.
She asks 4 questions.
In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible.
In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible.
In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none.
In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible.
In the second test case, Karen knows 2 recipes.
1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees.
A temperature is admissible if at least 1 recipe recommends it.
In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
|
```python
n, k, q = map(int, input().split())
recipes = []
for _ in range(n):
li, ri = map(int, input().split())
recipes.append((li, ri))
recipes.sort() # Sort the recipes based on the start temperature
prefix = [0] * 200001
count = 0
j = 0
for i in range(1, 200001):
while j < n and recipes[j][0] == i:
prefix[i] += 1
prefix[recipes[j][1] + 1] -= 1
j += 1
prefix = [prefix[0]] + list(map(lambda x: x + prefix[x - 1], range(1, len(prefix))))
admissible_temps = list(map(lambda x: x >= k, prefix))
for _ in range(q):
a, b = map(int, input().split())
print(admissible_temps[b] - admissible_temps[a - 1])
```
| 0
|
|
907
|
A
|
Masha and Bears
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation"
] | null | null |
A family consisting of father bear, mother bear and son bear owns three cars. Father bear can climb into the largest car and he likes it. Also, mother bear can climb into the middle car and she likes it. Moreover, son bear can climb into the smallest car and he likes it. It's known that the largest car is strictly larger than the middle car, and the middle car is strictly larger than the smallest car.
Masha came to test these cars. She could climb into all cars, but she liked only the smallest car.
It's known that a character with size *a* can climb into some car with size *b* if and only if *a*<=≤<=*b*, he or she likes it if and only if he can climb into this car and 2*a*<=≥<=*b*.
You are given sizes of bears and Masha. Find out some possible integer non-negative sizes of cars.
|
You are given four integers *V*1, *V*2, *V*3, *V**m*(1<=≤<=*V**i*<=≤<=100) — sizes of father bear, mother bear, son bear and Masha, respectively. It's guaranteed that *V*1<=><=*V*2<=><=*V*3.
|
Output three integers — sizes of father bear's car, mother bear's car and son bear's car, respectively.
If there are multiple possible solutions, print any.
If there is no solution, print "-1" (without quotes).
|
[
"50 30 10 10\n",
"100 50 10 21\n"
] |
[
"50\n30\n10\n",
"-1\n"
] |
In first test case all conditions for cars' sizes are satisfied.
In second test case there is no answer, because Masha should be able to climb into smallest car (so size of smallest car in not less than 21), but son bear should like it, so maximum possible size of it is 20.
| 500
|
[
{
"input": "50 30 10 10",
"output": "50\n30\n10"
},
{
"input": "100 50 10 21",
"output": "-1"
},
{
"input": "100 50 19 10",
"output": "100\n50\n19"
},
{
"input": "99 50 25 49",
"output": "100\n99\n49"
},
{
"input": "3 2 1 1",
"output": "4\n3\n1"
},
{
"input": "100 99 98 100",
"output": "-1"
},
{
"input": "100 40 30 40",
"output": "-1"
},
{
"input": "100 50 19 25",
"output": "100\n51\n25"
},
{
"input": "100 50 19 30",
"output": "100\n61\n30"
},
{
"input": "49 48 25 49",
"output": "-1"
},
{
"input": "48 47 23 46",
"output": "94\n93\n46"
},
{
"input": "37 23 16 20",
"output": "42\n41\n20"
},
{
"input": "98 2 1 1",
"output": "98\n3\n1"
},
{
"input": "99 22 13 14",
"output": "99\n29\n14"
},
{
"input": "97 95 3 2",
"output": "97\n95\n3"
},
{
"input": "27 3 2 3",
"output": "-1"
},
{
"input": "13 7 6 2",
"output": "-1"
},
{
"input": "19 17 11 6",
"output": "19\n17\n11"
},
{
"input": "15 6 4 5",
"output": "15\n11\n5"
},
{
"input": "21 3 1 3",
"output": "-1"
},
{
"input": "100 99 98 97",
"output": "196\n195\n98"
},
{
"input": "99 32 13 5",
"output": "-1"
},
{
"input": "5 4 3 1",
"output": "-1"
},
{
"input": "50 20 4 8",
"output": "50\n20\n8"
},
{
"input": "60 30 10 1",
"output": "-1"
},
{
"input": "100 50 10 1",
"output": "-1"
},
{
"input": "40 30 20 10",
"output": "40\n30\n20"
},
{
"input": "50 49 5 10",
"output": "50\n49\n10"
},
{
"input": "99 98 50 97",
"output": "196\n195\n97"
},
{
"input": "50 30 10 5",
"output": "50\n30\n10"
},
{
"input": "4 3 2 1",
"output": "4\n3\n2"
},
{
"input": "100 50 3 1",
"output": "-1"
}
] | 1,514,215,219
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 5,632,000
|
op=input().split()
a=int(op[0])
b=int(op[1])
way=list(input())
i=0
o=0
time=0
true=0
while True:
if i+b>=a-1:
time=time+1
break
for aa in range(i+1,i+b+1):
if way[aa]=="1":
o=aa
if o==i:
true=1
break
else:
i=o
time=time+1
if true==1:
print(-1)
else:
print(time)
|
Title: Masha and Bears
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A family consisting of father bear, mother bear and son bear owns three cars. Father bear can climb into the largest car and he likes it. Also, mother bear can climb into the middle car and she likes it. Moreover, son bear can climb into the smallest car and he likes it. It's known that the largest car is strictly larger than the middle car, and the middle car is strictly larger than the smallest car.
Masha came to test these cars. She could climb into all cars, but she liked only the smallest car.
It's known that a character with size *a* can climb into some car with size *b* if and only if *a*<=≤<=*b*, he or she likes it if and only if he can climb into this car and 2*a*<=≥<=*b*.
You are given sizes of bears and Masha. Find out some possible integer non-negative sizes of cars.
Input Specification:
You are given four integers *V*1, *V*2, *V*3, *V**m*(1<=≤<=*V**i*<=≤<=100) — sizes of father bear, mother bear, son bear and Masha, respectively. It's guaranteed that *V*1<=><=*V*2<=><=*V*3.
Output Specification:
Output three integers — sizes of father bear's car, mother bear's car and son bear's car, respectively.
If there are multiple possible solutions, print any.
If there is no solution, print "-1" (without quotes).
Demo Input:
['50 30 10 10\n', '100 50 10 21\n']
Demo Output:
['50\n30\n10\n', '-1\n']
Note:
In first test case all conditions for cars' sizes are satisfied.
In second test case there is no answer, because Masha should be able to climb into smallest car (so size of smallest car in not less than 21), but son bear should like it, so maximum possible size of it is 20.
|
```python
op=input().split()
a=int(op[0])
b=int(op[1])
way=list(input())
i=0
o=0
time=0
true=0
while True:
if i+b>=a-1:
time=time+1
break
for aa in range(i+1,i+b+1):
if way[aa]=="1":
o=aa
if o==i:
true=1
break
else:
i=o
time=time+1
if true==1:
print(-1)
else:
print(time)
```
| -1
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,696,069,668
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
H = "Hello"
s = input()
cnt = 0
for c in s:
if c == H[cnt]:
cnt += 1
if cnt == len(H):
break
print("YES" if cnt >= len(H) else "NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
H = "Hello"
s = input()
cnt = 0
for c in s:
if c == H[cnt]:
cnt += 1
if cnt == len(H):
break
print("YES" if cnt >= len(H) else "NO")
```
| 0
|
149
|
A
|
Business trip
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
|
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
|
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
|
[
"5\n1 1 1 1 2 2 3 2 2 1 1 1\n",
"0\n0 0 0 0 0 0 0 1 1 2 3 0\n",
"11\n1 1 4 1 1 5 1 1 4 1 1 1\n"
] |
[
"2\n",
"0\n",
"3\n"
] |
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
| 500
|
[
{
"input": "5\n1 1 1 1 2 2 3 2 2 1 1 1",
"output": "2"
},
{
"input": "0\n0 0 0 0 0 0 0 1 1 2 3 0",
"output": "0"
},
{
"input": "11\n1 1 4 1 1 5 1 1 4 1 1 1",
"output": "3"
},
{
"input": "15\n20 1 1 1 1 2 2 1 2 2 1 1",
"output": "1"
},
{
"input": "7\n8 9 100 12 14 17 21 10 11 100 23 10",
"output": "1"
},
{
"input": "52\n1 12 3 11 4 5 10 6 9 7 8 2",
"output": "6"
},
{
"input": "50\n2 2 3 4 5 4 4 5 7 3 2 7",
"output": "-1"
},
{
"input": "0\n55 81 28 48 99 20 67 95 6 19 10 93",
"output": "0"
},
{
"input": "93\n85 40 93 66 92 43 61 3 64 51 90 21",
"output": "1"
},
{
"input": "99\n36 34 22 0 0 0 52 12 0 0 33 47",
"output": "2"
},
{
"input": "99\n28 32 31 0 10 35 11 18 0 0 32 28",
"output": "3"
},
{
"input": "99\n19 17 0 1 18 11 29 9 29 22 0 8",
"output": "4"
},
{
"input": "76\n2 16 11 10 12 0 20 4 4 14 11 14",
"output": "5"
},
{
"input": "41\n2 1 7 7 4 2 4 4 9 3 10 0",
"output": "6"
},
{
"input": "47\n8 2 2 4 3 1 9 4 2 7 7 8",
"output": "7"
},
{
"input": "58\n6 11 7 0 5 6 3 9 4 9 5 1",
"output": "8"
},
{
"input": "32\n5 2 4 1 5 0 5 1 4 3 0 3",
"output": "9"
},
{
"input": "31\n6 1 0 4 4 5 1 0 5 3 2 0",
"output": "9"
},
{
"input": "35\n2 3 0 0 6 3 3 4 3 5 0 6",
"output": "9"
},
{
"input": "41\n3 1 3 4 3 6 6 1 4 4 0 6",
"output": "11"
},
{
"input": "97\n0 5 3 12 10 16 22 8 21 17 21 10",
"output": "5"
},
{
"input": "100\n21 21 0 0 4 13 0 26 0 0 0 15",
"output": "6"
},
{
"input": "100\n0 0 16 5 22 0 5 0 25 0 14 13",
"output": "7"
},
{
"input": "97\n17 0 10 0 0 0 18 0 14 23 15 0",
"output": "6"
},
{
"input": "100\n0 9 0 18 7 0 0 14 33 3 0 16",
"output": "7"
},
{
"input": "95\n5 2 13 0 15 18 17 0 6 11 0 8",
"output": "9"
},
{
"input": "94\n11 13 0 9 15 8 8 16 3 7 1 3",
"output": "11"
},
{
"input": "96\n8 4 12 15 8 0 4 10 6 6 12 11",
"output": "11"
},
{
"input": "100\n5 5 3 8 6 5 0 3 3 8 1 3",
"output": "-1"
},
{
"input": "100\n1 0 0 1 1 0 1 1 1 1 2 1",
"output": "-1"
},
{
"input": "100\n6 3 2 0 4 1 2 2 2 2 1 1",
"output": "-1"
},
{
"input": "0\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
},
{
"input": "0\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "12"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 2",
"output": "12"
},
{
"input": "15\n10 1 1 1 1 1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
}
] | 1,670,674,750
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 6
| 62
| 0
|
# from lib2to3.pgen2.token import RPAR
import math
import sys
# n=int(input())
# t=True
# s=input()
# arr=[]
# arr[:0]=s
# print(arr)
# ans=0
# ax=[]
# ay=[]
# for i in range(int(input())):
# x=int(input())
# a,b,c=map(int,input().split())
# st=input()
# x,y=map(int,input().split())
n=int(input())
a=list(map(int,input().split()))
a.sort()
# print(a.pop())
k=0
cnt=0
while(k<n):
x=a.pop()
k+=x
cnt+=1
print(cnt)
|
Title: Business trip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
Input Specification:
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
Output Specification:
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
Demo Input:
['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n']
Demo Output:
['2\n', '0\n', '3\n']
Note:
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
|
```python
# from lib2to3.pgen2.token import RPAR
import math
import sys
# n=int(input())
# t=True
# s=input()
# arr=[]
# arr[:0]=s
# print(arr)
# ans=0
# ax=[]
# ay=[]
# for i in range(int(input())):
# x=int(input())
# a,b,c=map(int,input().split())
# st=input()
# x,y=map(int,input().split())
n=int(input())
a=list(map(int,input().split()))
a.sort()
# print(a.pop())
k=0
cnt=0
while(k<n):
x=a.pop()
k+=x
cnt+=1
print(cnt)
```
| -1
|
|
96
|
A
|
Football
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Football
|
2
|
256
|
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
|
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
|
Print "YES" if the situation is dangerous. Otherwise, print "NO".
|
[
"001001\n",
"1000000001\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "001001",
"output": "NO"
},
{
"input": "1000000001",
"output": "YES"
},
{
"input": "00100110111111101",
"output": "YES"
},
{
"input": "11110111111111111",
"output": "YES"
},
{
"input": "01",
"output": "NO"
},
{
"input": "10100101",
"output": "NO"
},
{
"input": "1010010100000000010",
"output": "YES"
},
{
"input": "101010101",
"output": "NO"
},
{
"input": "000000000100000000000110101100000",
"output": "YES"
},
{
"input": "100001000000110101100000",
"output": "NO"
},
{
"input": "100001000011010110000",
"output": "NO"
},
{
"input": "010",
"output": "NO"
},
{
"input": "10101011111111111111111111111100",
"output": "YES"
},
{
"input": "1001101100",
"output": "NO"
},
{
"input": "1001101010",
"output": "NO"
},
{
"input": "1111100111",
"output": "NO"
},
{
"input": "00110110001110001111",
"output": "NO"
},
{
"input": "11110001001111110001",
"output": "NO"
},
{
"input": "10001111001011111101",
"output": "NO"
},
{
"input": "10000010100000001000110001010100001001001010011",
"output": "YES"
},
{
"input": "01111011111010111100101100001011001010111110000010",
"output": "NO"
},
{
"input": "00100000100100101110011001011011101110110110010100",
"output": "NO"
},
{
"input": "10110100110001001011110101110010100010000000000100101010111110111110100011",
"output": "YES"
},
{
"input": "00011101010101111001011011001101101011111101000010100000111000011100101011",
"output": "NO"
},
{
"input": "01110000110100110101110100111000101101011101011110110100100111100001110111",
"output": "NO"
},
{
"input": "11110110011000100111100111101101011111110100010101011011111101110110110111",
"output": "YES"
},
{
"input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100",
"output": "NO"
},
{
"input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010",
"output": "NO"
},
{
"input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110",
"output": "NO"
},
{
"input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000",
"output": "NO"
},
{
"input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110",
"output": "YES"
},
{
"input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000",
"output": "NO"
},
{
"input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101",
"output": "YES"
},
{
"input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101",
"output": "YES"
},
{
"input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000",
"output": "NO"
},
{
"input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000",
"output": "YES"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "YES"
},
{
"input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111",
"output": "YES"
},
{
"input": "10100101000",
"output": "NO"
},
{
"input": "11110111011101",
"output": "NO"
},
{
"input": "10000000",
"output": "YES"
},
{
"input": "00000001",
"output": "YES"
},
{
"input": "01111111",
"output": "YES"
},
{
"input": "11111110",
"output": "YES"
}
] | 1,697,094,937
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
# -*- coding: utf-8 -*-
"""
Created on Thu Oct 12 15:11:42 2023
@author: 20311
"""
def check(a):
if a.find('1111111')!=-1 or a.find('0000000')!=-1:
return True
else:
return False
a=str(input())
if check(a):
print('YES')
else:
print('No')
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
Input Specification:
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Output Specification:
Print "YES" if the situation is dangerous. Otherwise, print "NO".
Demo Input:
['001001\n', '1000000001\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
"""
Created on Thu Oct 12 15:11:42 2023
@author: 20311
"""
def check(a):
if a.find('1111111')!=-1 or a.find('0000000')!=-1:
return True
else:
return False
a=str(input())
if check(a):
print('YES')
else:
print('No')
```
| 0
|
244
|
B
|
Undoubtedly Lucky Numbers
|
PROGRAMMING
| 1,600
|
[
"bitmasks",
"brute force",
"dfs and similar"
] | null | null |
Polycarpus loves lucky numbers. Everybody knows that lucky numbers are positive integers, whose decimal representation (without leading zeroes) contain only the lucky digits *x* and *y*. For example, if *x*<==<=4, and *y*<==<=7, then numbers 47, 744, 4 are lucky.
Let's call a positive integer *a* undoubtedly lucky, if there are such digits *x* and *y* (0<=≤<=*x*,<=*y*<=≤<=9), that the decimal representation of number *a* (without leading zeroes) contains only digits *x* and *y*.
Polycarpus has integer *n*. He wants to know how many positive integers that do not exceed *n*, are undoubtedly lucky. Help him, count this number.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=109) — Polycarpus's number.
|
Print a single integer that says, how many positive integers that do not exceed *n* are undoubtedly lucky.
|
[
"10\n",
"123\n"
] |
[
"10\n",
"113\n"
] |
In the first test sample all numbers that do not exceed 10 are undoubtedly lucky.
In the second sample numbers 102, 103, 104, 105, 106, 107, 108, 109, 120, 123 are not undoubtedly lucky.
| 1,000
|
[
{
"input": "10",
"output": "10"
},
{
"input": "123",
"output": "113"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "1000",
"output": "352"
},
{
"input": "1000000000",
"output": "40744"
},
{
"input": "999999999",
"output": "40743"
},
{
"input": "999999998",
"output": "40742"
},
{
"input": "999999997",
"output": "40741"
},
{
"input": "909090901",
"output": "38532"
},
{
"input": "142498040",
"output": "21671"
},
{
"input": "603356456",
"output": "31623"
},
{
"input": "64214872",
"output": "15759"
},
{
"input": "820040584",
"output": "36407"
},
{
"input": "442198",
"output": "3071"
},
{
"input": "784262",
"output": "4079"
},
{
"input": "642678",
"output": "3615"
},
{
"input": "468390",
"output": "3223"
},
{
"input": "326806",
"output": "2759"
},
{
"input": "940",
"output": "331"
},
{
"input": "356",
"output": "175"
},
{
"input": "68",
"output": "68"
},
{
"input": "132",
"output": "114"
},
{
"input": "72",
"output": "72"
},
{
"input": "89",
"output": "89"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "3"
},
{
"input": "4",
"output": "4"
},
{
"input": "5",
"output": "5"
},
{
"input": "6",
"output": "6"
},
{
"input": "7",
"output": "7"
},
{
"input": "8",
"output": "8"
},
{
"input": "9",
"output": "9"
},
{
"input": "101",
"output": "101"
},
{
"input": "102",
"output": "101"
}
] | 1,655,529,741
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 0
|
t = int(input())
cnt = 0
for i in range(t+1):
a = str(i)
if len(set(a)) == 1 or len(set(a)) == 2:
cnt += 1
print(cnt-1)
|
Title: Undoubtedly Lucky Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus loves lucky numbers. Everybody knows that lucky numbers are positive integers, whose decimal representation (without leading zeroes) contain only the lucky digits *x* and *y*. For example, if *x*<==<=4, and *y*<==<=7, then numbers 47, 744, 4 are lucky.
Let's call a positive integer *a* undoubtedly lucky, if there are such digits *x* and *y* (0<=≤<=*x*,<=*y*<=≤<=9), that the decimal representation of number *a* (without leading zeroes) contains only digits *x* and *y*.
Polycarpus has integer *n*. He wants to know how many positive integers that do not exceed *n*, are undoubtedly lucky. Help him, count this number.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=109) — Polycarpus's number.
Output Specification:
Print a single integer that says, how many positive integers that do not exceed *n* are undoubtedly lucky.
Demo Input:
['10\n', '123\n']
Demo Output:
['10\n', '113\n']
Note:
In the first test sample all numbers that do not exceed 10 are undoubtedly lucky.
In the second sample numbers 102, 103, 104, 105, 106, 107, 108, 109, 120, 123 are not undoubtedly lucky.
|
```python
t = int(input())
cnt = 0
for i in range(t+1):
a = str(i)
if len(set(a)) == 1 or len(set(a)) == 2:
cnt += 1
print(cnt-1)
```
| 0
|
|
983
|
A
|
Finite or not?
|
PROGRAMMING
| 1,700
|
[
"implementation",
"math"
] | null | null |
You are given several queries. Each query consists of three integers $p$, $q$ and $b$. You need to answer whether the result of $p/q$ in notation with base $b$ is a finite fraction.
A fraction in notation with base $b$ is finite if it contains finite number of numerals after the decimal point. It is also possible that a fraction has zero numerals after the decimal point.
|
The first line contains a single integer $n$ ($1 \le n \le 10^5$) — the number of queries.
Next $n$ lines contain queries, one per line. Each line contains three integers $p$, $q$, and $b$ ($0 \le p \le 10^{18}$, $1 \le q \le 10^{18}$, $2 \le b \le 10^{18}$). All numbers are given in notation with base $10$.
|
For each question, in a separate line, print Finite if the fraction is finite and Infinite otherwise.
|
[
"2\n6 12 10\n4 3 10\n",
"4\n1 1 2\n9 36 2\n4 12 3\n3 5 4\n"
] |
[
"Finite\nInfinite\n",
"Finite\nFinite\nFinite\nInfinite\n"
] |
$\frac{6}{12} = \frac{1}{2} = 0,5_{10}$
$\frac{4}{3} = 1,(3)_{10}$
$\frac{9}{36} = \frac{1}{4} = 0,01_2$
$\frac{4}{12} = \frac{1}{3} = 0,1_3$
| 500
|
[
{
"input": "2\n6 12 10\n4 3 10",
"output": "Finite\nInfinite"
},
{
"input": "4\n1 1 2\n9 36 2\n4 12 3\n3 5 4",
"output": "Finite\nFinite\nFinite\nInfinite"
},
{
"input": "10\n10 5 3\n1 7 10\n7 5 7\n4 4 9\n6 5 2\n6 7 5\n9 9 7\n7 5 5\n6 6 4\n10 8 2",
"output": "Finite\nInfinite\nInfinite\nFinite\nInfinite\nInfinite\nFinite\nFinite\nFinite\nFinite"
},
{
"input": "10\n1 3 10\n6 2 6\n2 3 9\n7 8 4\n5 6 10\n1 2 7\n0 3 6\n9 3 4\n4 4 9\n10 9 10",
"output": "Infinite\nFinite\nFinite\nFinite\nInfinite\nInfinite\nFinite\nFinite\nFinite\nInfinite"
},
{
"input": "10\n10 8 5\n0 6 9\n0 7 6\n5 7 3\n7 6 8\n0 4 8\n2 6 3\n10 2 9\n6 7 9\n9 1 4",
"output": "Infinite\nFinite\nFinite\nInfinite\nInfinite\nFinite\nFinite\nFinite\nInfinite\nFinite"
},
{
"input": "10\n5 8 2\n0 5 8\n5 9 7\n0 7 2\n6 7 2\n10 3 7\n8 1 10\n9 1 8\n0 7 10\n9 1 4",
"output": "Finite\nFinite\nInfinite\nFinite\nInfinite\nInfinite\nFinite\nFinite\nFinite\nFinite"
},
{
"input": "1\n1 864691128455135232 2",
"output": "Infinite"
},
{
"input": "11\n1 1000000000000000000 10000000\n2 999 9\n2 999 333111\n0 9 7\n17 128 2\n13 311992186885373952 18\n1971402979058461 750473176484995605 75\n14 19 23\n3 21914624432020321 23\n3 21914624432020321 46\n3 21914624432020321 47",
"output": "Finite\nInfinite\nFinite\nFinite\nFinite\nFinite\nFinite\nInfinite\nFinite\nFinite\nInfinite"
},
{
"input": "1\n1 100000000000000000 10000000000000000",
"output": "Finite"
},
{
"input": "1\n1 4294967297 4294967296",
"output": "Infinite"
},
{
"input": "1\n1 5244319080000 30030",
"output": "Finite"
}
] | 1,526,464,622
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 89
| 639
| 18,022,400
|
input()
print('\n'.join(['Infinite' if p * pow(b, 99, q) % q else 'Finite' for p, q, b in map(lambda l: map(int, l.split()), __import__('sys').stdin.readlines())]))
|
Title: Finite or not?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given several queries. Each query consists of three integers $p$, $q$ and $b$. You need to answer whether the result of $p/q$ in notation with base $b$ is a finite fraction.
A fraction in notation with base $b$ is finite if it contains finite number of numerals after the decimal point. It is also possible that a fraction has zero numerals after the decimal point.
Input Specification:
The first line contains a single integer $n$ ($1 \le n \le 10^5$) — the number of queries.
Next $n$ lines contain queries, one per line. Each line contains three integers $p$, $q$, and $b$ ($0 \le p \le 10^{18}$, $1 \le q \le 10^{18}$, $2 \le b \le 10^{18}$). All numbers are given in notation with base $10$.
Output Specification:
For each question, in a separate line, print Finite if the fraction is finite and Infinite otherwise.
Demo Input:
['2\n6 12 10\n4 3 10\n', '4\n1 1 2\n9 36 2\n4 12 3\n3 5 4\n']
Demo Output:
['Finite\nInfinite\n', 'Finite\nFinite\nFinite\nInfinite\n']
Note:
$\frac{6}{12} = \frac{1}{2} = 0,5_{10}$
$\frac{4}{3} = 1,(3)_{10}$
$\frac{9}{36} = \frac{1}{4} = 0,01_2$
$\frac{4}{12} = \frac{1}{3} = 0,1_3$
|
```python
input()
print('\n'.join(['Infinite' if p * pow(b, 99, q) % q else 'Finite' for p, q, b in map(lambda l: map(int, l.split()), __import__('sys').stdin.readlines())]))
```
| 3
|
|
479
|
A
|
Expression
|
PROGRAMMING
| 1,000
|
[
"brute force",
"math"
] | null | null |
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
|
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
|
Print the maximum value of the expression that you can obtain.
|
[
"1\n2\n3\n",
"2\n10\n3\n"
] |
[
"9\n",
"60\n"
] |
none
| 500
|
[
{
"input": "1\n2\n3",
"output": "9"
},
{
"input": "2\n10\n3",
"output": "60"
},
{
"input": "1\n1\n1",
"output": "3"
},
{
"input": "1\n2\n1",
"output": "4"
},
{
"input": "10\n10\n10",
"output": "1000"
},
{
"input": "5\n1\n3",
"output": "20"
},
{
"input": "3\n1\n5",
"output": "20"
},
{
"input": "6\n7\n1",
"output": "48"
},
{
"input": "1\n8\n3",
"output": "27"
},
{
"input": "9\n7\n2",
"output": "126"
},
{
"input": "1\n1\n10",
"output": "20"
},
{
"input": "9\n1\n1",
"output": "18"
},
{
"input": "10\n5\n6",
"output": "300"
},
{
"input": "8\n9\n7",
"output": "504"
},
{
"input": "4\n2\n10",
"output": "80"
},
{
"input": "2\n8\n3",
"output": "48"
},
{
"input": "3\n5\n7",
"output": "105"
},
{
"input": "1\n10\n1",
"output": "12"
},
{
"input": "2\n2\n2",
"output": "8"
},
{
"input": "5\n6\n1",
"output": "35"
},
{
"input": "10\n1\n1",
"output": "20"
},
{
"input": "1\n6\n1",
"output": "8"
},
{
"input": "1\n9\n1",
"output": "11"
},
{
"input": "2\n1\n2",
"output": "6"
},
{
"input": "2\n6\n1",
"output": "14"
},
{
"input": "9\n2\n1",
"output": "27"
},
{
"input": "1\n9\n2",
"output": "20"
},
{
"input": "1\n3\n1",
"output": "5"
},
{
"input": "2\n1\n1",
"output": "4"
}
] | 1,687,260,018
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
a = int(input())
b = int(input())
c = int(input())
if(a==1):
if(a+b*c>(a+b)*c):
print(a+b*c)
else:
print((a+b)*c)
elif(b==1 or c ==1):
print(a*(b+c))
else:
print(a*b*c)
|
Title: Expression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
Input Specification:
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Output Specification:
Print the maximum value of the expression that you can obtain.
Demo Input:
['1\n2\n3\n', '2\n10\n3\n']
Demo Output:
['9\n', '60\n']
Note:
none
|
```python
a = int(input())
b = int(input())
c = int(input())
if(a==1):
if(a+b*c>(a+b)*c):
print(a+b*c)
else:
print((a+b)*c)
elif(b==1 or c ==1):
print(a*(b+c))
else:
print(a*b*c)
```
| 0
|
|
474
|
B
|
Worms
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation"
] | null | null |
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
|
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
|
[
"5\n2 7 3 4 9\n3\n1 25 11\n"
] |
[
"1\n5\n3\n"
] |
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
| 1,000
|
[
{
"input": "5\n2 7 3 4 9\n3\n1 25 11",
"output": "1\n5\n3"
}
] | 1,677,135,258
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 92
| 2,048,000
|
def BS(a, n, x):
L, R, ans = 0, n - 1, 0
while L <= R:
M = (L + R) // 2
if a[M] >= x:
ans = M
R = M - 1
else:
L = M + 1
print(ans + 1)
n = int(input())
a = [0] * n
a[0] = int(input())
for i in range(1, n):
x = int(input())
a[i] = a[i - 1] + x
q = int(input())
for i in range(q):
x = int(input())
BS(a, n, x)
|
Title: Worms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Output Specification:
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
Demo Input:
['5\n2 7 3 4 9\n3\n1 25 11\n']
Demo Output:
['1\n5\n3\n']
Note:
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
|
```python
def BS(a, n, x):
L, R, ans = 0, n - 1, 0
while L <= R:
M = (L + R) // 2
if a[M] >= x:
ans = M
R = M - 1
else:
L = M + 1
print(ans + 1)
n = int(input())
a = [0] * n
a[0] = int(input())
for i in range(1, n):
x = int(input())
a[i] = a[i - 1] + x
q = int(input())
for i in range(q):
x = int(input())
BS(a, n, x)
```
| -1
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.