Unnamed: 0 int64 0 350k | level_0 int64 0 351k | ApplicationNumber int64 9.75M 96.1M | ArtUnit int64 1.6k 3.99k | Abstract stringlengths 1 8.37k | Claims stringlengths 3 292k | abstract-claims stringlengths 68 293k | TechCenter int64 1.6k 3.9k |
|---|---|---|---|---|---|---|---|
21,300 | 21,301 | 17,142,012 | 2,896 | In a general aspect, a receiver is disclosed for sensing radio frequency (RF) electromagnetic radiation. The receiver includes a dielectric body having an array of cavities ordered periodically to define a photonic crystal structure in the dielectric body. The dielectric body also has a region in the array of cavities ... | 1. A receiver for sensing radio frequency (RF) electromagnetic radiation, the receiver comprising:
a dielectric body comprising:
an array of cavities ordered periodically to define a photonic crystal structure in the dielectric body,
a region in the array of cavities defining a defect in the photonic crystal structure,... | In a general aspect, a receiver is disclosed for sensing radio frequency (RF) electromagnetic radiation. The receiver includes a dielectric body having an array of cavities ordered periodically to define a photonic crystal structure in the dielectric body. The dielectric body also has a region in the array of cavities ... | 2,800 |
21,301 | 21,302 | 17,142,037 | 2,864 | Performance and lifespan of batteries deteriorate with time due to various factors. Existing systems for battery management use different approaches for the battery management, and also rely on static value of parameters for State of Health (SOH) and Remaining Useful Life (RUL) estimation, thereby failing to consider c... | 1. A processor implemented method for online battery management, comprising:
determining real-time value of voltage and current of a battery being monitored, via one or more hardware processors; determining a state of the battery as one of charging, discharging, and rest, via the one or more hardware processors, based ... | Performance and lifespan of batteries deteriorate with time due to various factors. Existing systems for battery management use different approaches for the battery management, and also rely on static value of parameters for State of Health (SOH) and Remaining Useful Life (RUL) estimation, thereby failing to consider c... | 2,800 |
21,302 | 21,303 | 17,142,017 | 2,858 | In a general aspect, a system is disclosed for sensing radio frequency (RF) electromagnetic radiation. The system includes a receiver formed of dielectric material. The receiver includes a photonic crystal structure having an elongated slot disposed therein. The receiver also includes an antenna structure extending fro... | 1. A system for sensing radio frequency (RF) electromagnetic radiation, the system comprising:
a receiver formed of dielectric material and comprising:
a photonic crystal structure having an elongated slot disposed therein,
an antenna structure extending from the photonic crystal structure and configured to couple to a... | In a general aspect, a system is disclosed for sensing radio frequency (RF) electromagnetic radiation. The system includes a receiver formed of dielectric material. The receiver includes a photonic crystal structure having an elongated slot disposed therein. The receiver also includes an antenna structure extending fro... | 2,800 |
21,303 | 21,304 | 17,142,036 | 2,833 | A push switch which can have a small separation distance from a side surface of a mounting board, when it is mounted on the mounting board through a step, is disclosed. The push switch includes a substrate having a first surface on which a first fixed contact point and a second fixed contact point surrounding the first... | 1. A push switch which is mountable on a mounting board, comprising:
a substrate comprising a first surface on which a first fixed contact point and a second fixed contact point surrounding the first fixed contact point are formed, a second surface located opposite to the first surface, a third surface extending from t... | A push switch which can have a small separation distance from a side surface of a mounting board, when it is mounted on the mounting board through a step, is disclosed. The push switch includes a substrate having a first surface on which a first fixed contact point and a second fixed contact point surrounding the first... | 2,800 |
21,304 | 21,305 | 17,142,028 | 1,762 | The invention relates to an efficient process for the preparation and isolation of rubber particles formed in aqueous media and highly pure rubbers obtained thereby. The invention further relates to copolymer products comprising the same or derived therefrom. | 1. A sealant comprising:
i) 0.1 to 60 weight percent of a copolymer composition comprising at least 96.0 weight percent of a copolymer and at least one lower critical solution temperature (LCST) compound; ii) 0.1 to 40 weight percent of at least one filler; iii) 0.1 to 30 weight percent of at least one secondary rubber... | The invention relates to an efficient process for the preparation and isolation of rubber particles formed in aqueous media and highly pure rubbers obtained thereby. The invention further relates to copolymer products comprising the same or derived therefrom.1. A sealant comprising:
i) 0.1 to 60 weight percent of a cop... | 1,700 |
21,305 | 21,306 | 17,142,034 | 2,697 | Implementations generally relate to importing data and presenting the data in a user interface (UI). In some implementations, a method includes capturing an image of an object using a camera, where the object includes text. The method further includes recognizing the text and recognizing data in a table. The method fur... | 1. A method for interactively assisting a user to import data using a client device with a client display screen, comprising the following steps:
(a) receiving a raw image from the user, the raw image showing at least a part of an object that includes one or more areas with data in text format; (b) scanning the raw ima... | Implementations generally relate to importing data and presenting the data in a user interface (UI). In some implementations, a method includes capturing an image of an object using a camera, where the object includes text. The method further includes recognizing the text and recognizing data in a table. The method fur... | 2,600 |
21,306 | 21,307 | 17,142,030 | 2,663 | A visual search system facilitates retrieval of provenance information using a machine learning model to generate content fingerprints that are invariant to benign transformations while being sensitive to manipulations. The machine learning model is trained on a training image dataset that includes original images, ben... | 1. One or more computer storage media storing computer-useable instructions that, when used by a computing device, cause the computing device to perform operations, the operations comprising:
accessing a training image dataset comprising a plurality of original images, one or more benign transformed images for each ori... | A visual search system facilitates retrieval of provenance information using a machine learning model to generate content fingerprints that are invariant to benign transformations while being sensitive to manipulations. The machine learning model is trained on a training image dataset that includes original images, ben... | 2,600 |
21,307 | 21,308 | 17,142,035 | 2,442 | Disclosed is a system and application for digital media that allows users to share a media playlist and synchronize playing for all connected users. The user browses their device for media files to create a playlist, and then hosts the playlist over an existing local area network or creates a Wi-Fi hotspot. The playlis... | 1. A method for synchronized media playback, comprising the steps of:
providing a host device having a media playlist; providing one or more user devices; sharing the media playlist from the host device to the one or more user devices; engaging a play user interface element on the host device; sending a play signal to ... | Disclosed is a system and application for digital media that allows users to share a media playlist and synchronize playing for all connected users. The user browses their device for media files to create a playlist, and then hosts the playlist over an existing local area network or creates a Wi-Fi hotspot. The playlis... | 2,400 |
21,308 | 21,309 | 17,142,016 | 2,811 | An integrated circuit includes a strip structure having a front side and a back side. A gate structure is on the front side of the strip structure. The integrated circuit includes a plurality of channel layers above the front side of the strip structure, wherein each of the plurality of channel layers is enclosed withi... | 1. An integrated circuit, comprising:
a strip structure having a front side and a back side; a gate structure on the front side of the strip structure; a plurality of channel layers above the front side of the strip structure, wherein each of the plurality of channel layers is enclosed within the gate structure; an iso... | An integrated circuit includes a strip structure having a front side and a back side. A gate structure is on the front side of the strip structure. The integrated circuit includes a plurality of channel layers above the front side of the strip structure, wherein each of the plurality of channel layers is enclosed withi... | 2,800 |
21,309 | 21,310 | 17,142,026 | 1,654 | The present invention provides methods of treating a subject having a primary inflammatory disease or disorder comprising administering to the subject a composition comprising a conjugate of an LLP2A peptidomimetic ligand and a bisphosphonate drug, wherein the composition comprising the LLP2A-bisphosphonate conjugate e... | 1. A method of treating a subject having a primary inflammatory disease or disorder selected from arthritis, inflammatory arthritis, rheumatoid arthritis, synovitis, juvenile rheumatoid arthritis, ankylosing spondylitis, psoriatic arthritis, spondylarthritis, and osteoarthritis, the method comprising administering to t... | The present invention provides methods of treating a subject having a primary inflammatory disease or disorder comprising administering to the subject a composition comprising a conjugate of an LLP2A peptidomimetic ligand and a bisphosphonate drug, wherein the composition comprising the LLP2A-bisphosphonate conjugate e... | 1,600 |
21,310 | 21,311 | 17,142,054 | 2,693 | In at least one embodiment, a display device includes a panel including a display area in which a plurality of pixels is arranged. An optical module is superposed on the display area. The display area has a low-resolution area having a polygonal shape and superposed on the optical module and a high-resolution area neig... | 1. A display device, comprising:
a panel including a display area in which a plurality of pixels is arranged; and an optical module superposed on the display area, wherein the display area has a low-resolution area having a polygonal shape and superposed on the optical module and a high-resolution area neighboring the ... | In at least one embodiment, a display device includes a panel including a display area in which a plurality of pixels is arranged. An optical module is superposed on the display area. The display area has a low-resolution area having a polygonal shape and superposed on the optical module and a high-resolution area neig... | 2,600 |
21,311 | 21,312 | 17,142,052 | 1,714 | Aspects of the present disclosure generally relate to oscillating a boundary layer of a flow of process gas in methods and systems for processing substrates. In one aspect, one or more of a pressure, a gas flow rate, and/or a height of a substrate are oscillated during processing. In one implementation, a method of pro... | 1. A method of processing a substrate, comprising:
conducting a processing operation on the substrate in an interior volume of a processing chamber, the conducting the processing operation on the substrate comprising:
moving a flow of one or more process gases over a surface of the substrate; and
oscillating a boundar... | Aspects of the present disclosure generally relate to oscillating a boundary layer of a flow of process gas in methods and systems for processing substrates. In one aspect, one or more of a pressure, a gas flow rate, and/or a height of a substrate are oscillated during processing. In one implementation, a method of pro... | 1,700 |
21,312 | 21,313 | 17,142,025 | 2,857 | Apparatuses, methods, and program products are disclosed for determining usage of an information handling device. One apparatus includes at least one processor and a memory that stores code executable by the at least one processor. The code is executable by the processor to monitor, by use of the at least one processor... | 1. An apparatus comprising:
at least one processor; and a memory that stores code executable by the at least one processor to:
monitor, by use of the at least one processor, a plurality of parameters indicative of a usage of an information handling device, wherein the plurality of parameters is for a plurality of compo... | Apparatuses, methods, and program products are disclosed for determining usage of an information handling device. One apparatus includes at least one processor and a memory that stores code executable by the at least one processor. The code is executable by the processor to monitor, by use of the at least one processor... | 2,800 |
21,313 | 21,314 | 17,141,985 | 2,662 | System and methods for processing audio signals are disclosed. In one implementation, a system may comprise a wearable camera configured to capture images from an environment of a user; a microphone configured to capture sounds from the environment of the user; and a processor. The processor may be configured to receiv... | 1. A system for processing audio signals, the system comprising:
a wearable camera configured to capture a plurality of images from an environment of a user; at least one microphone configured to capture sounds from the environment of the user; and at least one processor programmed to:
receive at least one image of the... | System and methods for processing audio signals are disclosed. In one implementation, a system may comprise a wearable camera configured to capture images from an environment of a user; a microphone configured to capture sounds from the environment of the user; and a processor. The processor may be configured to receiv... | 2,600 |
21,314 | 21,315 | 17,142,000 | 3,736 | Packaging for medical containers, including a tub having a peripheral wall, a sealing cover sealable on an opening of the tub and a sealing envelope able to protect the sealing cover. The sealing envelope includes: a lower sealing part, having a frame able to be sealed to the peripheral wall of the tub, and a bonding s... | 1. A packaging for medical containers, comprising:
a tub configured to receive a plurality of medical containers therein, the tub having a peripheral wall and a flange extending from the peripheral wall; a sealing cover sealable on an opening of the tub; and a sealing envelope for protecting the sealing cover against p... | Packaging for medical containers, including a tub having a peripheral wall, a sealing cover sealable on an opening of the tub and a sealing envelope able to protect the sealing cover. The sealing envelope includes: a lower sealing part, having a frame able to be sealed to the peripheral wall of the tub, and a bonding s... | 3,700 |
21,315 | 21,316 | 17,142,022 | 2,651 | A device includes one or more processors configured to, during a call, receive a sequence of audio frames from a first device. The one or more processors are configured to, in response to determining that no audio frame of the sequence has been received for a threshold duration since a last received audio frame of the ... | 1. A device for communication comprising:
one or more processors configured to, during a call:
receive a sequence of audio frames from a first device;
in response to determining that no audio frame of the sequence has been received for a threshold duration since a last received audio frame of the sequence, initiate tra... | A device includes one or more processors configured to, during a call, receive a sequence of audio frames from a first device. The one or more processors are configured to, in response to determining that no audio frame of the sequence has been received for a threshold duration since a last received audio frame of the ... | 2,600 |
21,316 | 21,317 | 17,142,020 | 2,684 | A communication system for underwater lifesaving and a method for locating a person immersed in water. The communication system for underwater lifesaving includes: a water immersion signal generation unit that is worn on the body of a user, detects whether the user is immersed in water, and generates a water immersion ... | 1. A communication system for underwater lifesaving comprising:
a water immersion signal generation unit, which is adapted to be worn on a body of a user, for detecting a water immersion of the user and generating a water immersion detection signal corresponding to the user when the water immersion is detected; and a w... | A communication system for underwater lifesaving and a method for locating a person immersed in water. The communication system for underwater lifesaving includes: a water immersion signal generation unit that is worn on the body of a user, detects whether the user is immersed in water, and generates a water immersion ... | 2,600 |
21,317 | 21,318 | 17,142,015 | 2,462 | A WLAN baseband chip and an FDMA PPDU generation method are disclosed. The WLAN baseband chip obtains a subcarrier coefficient corresponding to a subcarrier set, m LDR SYNC sequences, and n−m HDR SYNC sequences. The WLAN baseband chip performs duplicating processing on m data streams in n data streams, to obtain m data... | 1. A wireless local area network (WLAN) baseband chip, wherein the WLAN baseband chip comprises a memory and an inverse fast Fourier transform (IFFT) circuit, and the WLAN baseband chip is configured to:
obtain, based on a subcarrier coefficient sequence in the memory, a subcarrier coefficient corresponding to a subcar... | A WLAN baseband chip and an FDMA PPDU generation method are disclosed. The WLAN baseband chip obtains a subcarrier coefficient corresponding to a subcarrier set, m LDR SYNC sequences, and n−m HDR SYNC sequences. The WLAN baseband chip performs duplicating processing on m data streams in n data streams, to obtain m data... | 2,400 |
21,318 | 21,319 | 17,142,058 | 2,842 | A detector circuit includes: a squaring circuit configured to receive an output of a power amplifier of a radio transmitter and to produce an output current, the output of the power amplifier including: a desired tone; a local oscillator leakage tone; and an image tone, and the output current of the squaring circuit in... | 1. A radio transceiver comprising:
a radio transmitter comprising a power amplifier; a radio receiver comprising a transimpedance amplifier; and a local oscillator leakage and image tone detector circuit connected between the power amplifier of the radio transmitter and the transimpedance amplifier of the radio transce... | A detector circuit includes: a squaring circuit configured to receive an output of a power amplifier of a radio transmitter and to produce an output current, the output of the power amplifier including: a desired tone; a local oscillator leakage tone; and an image tone, and the output current of the squaring circuit in... | 2,800 |
21,319 | 21,320 | 17,142,067 | 3,677 | A jewelry link assembly and a method of assembling jewelry chain links are disclosed. The jewelry link assembly comprises a male member comprising a ball portion having two prongs at opposite ends. The jewelry link assembly comprises a female member having two wings. Each wing comprises a prong receiving section. The b... | 1. A jewelry link assembly, comprising:
a male member comprising a ball portion having two prongs at opposite ends; a female member comprising two wings, wherein each wing having a prong receiving section, wherein the ball portion is received between the two wings such that the prongs are made to slide into the prong r... | A jewelry link assembly and a method of assembling jewelry chain links are disclosed. The jewelry link assembly comprises a male member comprising a ball portion having two prongs at opposite ends. The jewelry link assembly comprises a female member having two wings. Each wing comprises a prong receiving section. The b... | 3,600 |
21,320 | 21,321 | 17,142,053 | 3,618 | A skateboard system includes a first suspension member having first through third portions, each portion having a largest flat planar surface. The first portion includes a plurality of mount holes to mount it with a skateboard deck. The largest flat planar surface of the second portion is angled between fifteen and six... | 1. A skateboard system, comprising:
a first suspension member comprising:
a first portion having a largest flat planar surface configured to mate flush with an underside of a deck of a skateboard, the first portion comprising a plurality of mount holes configured to allow mounting of the first portion with the deck;
a ... | A skateboard system includes a first suspension member having first through third portions, each portion having a largest flat planar surface. The first portion includes a plurality of mount holes to mount it with a skateboard deck. The largest flat planar surface of the second portion is angled between fifteen and six... | 3,600 |
21,321 | 21,322 | 17,141,995 | 2,463 | Aspects described herein relate to determining a physical downlink control channel (PDCCH) limit corresponding to at least one of a number of blind detections (BDs) and a number of control channel elements (CCEs) based on one or more PDCCH candidates for a first cell that are monitored in a second cell or one or more P... | 1. A method of wireless communication, comprising:
determining a physical downlink control channel (PDCCH) limit corresponding to at least one of a number of blind detections (BDs) and a number of control channel elements (CCEs) based on one or more PDCCH candidates for a first cell that are monitored in a second cell ... | Aspects described herein relate to determining a physical downlink control channel (PDCCH) limit corresponding to at least one of a number of blind detections (BDs) and a number of control channel elements (CCEs) based on one or more PDCCH candidates for a first cell that are monitored in a second cell or one or more P... | 2,400 |
21,322 | 21,323 | 17,142,011 | 2,647 | A method, an apparatus, an electronic device, and a storage medium for monitoring an image acquisition device are provided, which are related to a field of computer vision technology. The method for monitoring the image acquisition device includes: determining a stop position of each target vehicle from a first video i... | 1. A Method for monitoring an image acquisition device, comprising:
determining a stop position of each target vehicle from a first video image acquired by the image acquisition device; determining a marking line in the first video image according to the stop positions of then respective target vehicles; and determinin... | A method, an apparatus, an electronic device, and a storage medium for monitoring an image acquisition device are provided, which are related to a field of computer vision technology. The method for monitoring the image acquisition device includes: determining a stop position of each target vehicle from a first video i... | 2,600 |
21,323 | 21,324 | 17,142,007 | 3,673 | An improved support structure includes a mattress and base support therefor, and a support system adjustably locatable at predetermined pressure attenuation areas of the mattress and base of the bed. Portions of the support system include a carriage movably mounted on a longitudinal track in the base, where the carriag... | 1-76. (canceled) 77. An improved support structure having a plurality of supports locatable at a plurality of pressure attenuation areas in each or all its planes to improve posture of a user and adjustability of the bed comprising:
a mattress and base support therefor; a support system adjustably locatable at predeter... | An improved support structure includes a mattress and base support therefor, and a support system adjustably locatable at predetermined pressure attenuation areas of the mattress and base of the bed. Portions of the support system include a carriage movably mounted on a longitudinal track in the base, where the carriag... | 3,600 |
21,324 | 21,325 | 17,142,068 | 2,828 | A method for making a selective-area lift-off thin film comprises depositing a van der Waals (vdW) buffer on a substrate; depositing a thin film material (or device structure) on the van der Waals buffer; depositing an adhesion layer on the thin film material; forming a stressor layer on top of the thin film layer; and... | 1. A method for making a selective-area lift-off thin film, comprising:
depositing a van der Waals (vdW) buffer on a substrate, wherein the vdW buffer includes hBN; depositing a thin film material or a device structure on the van der Waals buffer; depositing an adhesion layer on the thin film material; forming a stress... | A method for making a selective-area lift-off thin film comprises depositing a van der Waals (vdW) buffer on a substrate; depositing a thin film material (or device structure) on the van der Waals buffer; depositing an adhesion layer on the thin film material; forming a stressor layer on top of the thin film layer; and... | 2,800 |
21,325 | 21,326 | 17,142,002 | 2,423 | Techniques of providing an interactive programming guide with a personalized lineup are disclosed. In some embodiments, a profile is accessed, and a personalized lineup is determined based on the profile. The personalized lineup may include a corresponding media content identification assigned to each one of a pluralit... | 1. A system comprising:
at least one processor; and a machine-readable medium storing executable instructions which, when executed, cause the at least one processor to perform operations including:
in response to a first selection of a first one of a plurality of time slots included in a personalized lineup of an inter... | Techniques of providing an interactive programming guide with a personalized lineup are disclosed. In some embodiments, a profile is accessed, and a personalized lineup is determined based on the profile. The personalized lineup may include a corresponding media content identification assigned to each one of a pluralit... | 2,400 |
21,326 | 21,327 | 17,142,079 | 1,797 | Disclosed herein are p-n metal oxide semiconductor (MOS) heterostructure-based sensors and systems. The sensors and systems described herein can include sensing element that comprises a first region comprising a p-type MOS material (e.g., NiO) and a second region comprising an n-type MOS material (e.g., In2O3). These s... | 1. A sensor device for sensing NH3 in a gas sample, the sensor device comprising a sensing element comprising:
a first region comprising a p-type metal oxide semiconductor (MOS) material comprising NiO; and a second region comprising an n-type MOS material comprising In2O3; wherein the first region is adjacent to and c... | Disclosed herein are p-n metal oxide semiconductor (MOS) heterostructure-based sensors and systems. The sensors and systems described herein can include sensing element that comprises a first region comprising a p-type MOS material (e.g., NiO) and a second region comprising an n-type MOS material (e.g., In2O3). These s... | 1,700 |
21,327 | 21,328 | 17,142,060 | 1,619 | Compositions, methods and systems are provided for pulmonary or nasal delivery of two or more active agents via a metered dose inhaler. In one embodiment, the compositions include a suspension medium, active agent particles, and suspending particles, in which the active agent particles and suspending particles form a c... | 1.-61. (canceled) 62. A pharmaceutical composition deliverable from a metered dose inhaler, the pharmaceutical composition comprising:
a suspension medium comprising a pharmaceutically acceptable propellant; a plurality of respirable active agent particles comprising a corticosteroid or a pharmaceutically acceptable sa... | Compositions, methods and systems are provided for pulmonary or nasal delivery of two or more active agents via a metered dose inhaler. In one embodiment, the compositions include a suspension medium, active agent particles, and suspending particles, in which the active agent particles and suspending particles form a c... | 1,600 |
21,328 | 21,329 | 17,142,051 | 1,658 | The present disclosure relates to a cell penetrating short peptide TAT-HuR-HNS-3 and application thereof in inflammatory disease, wherein the amino acid sequence of cell penetrating short peptide TAT-HuR-HNS-3 for inflammatory diseases caused by elevated inflammatory factors is YGRKKRRQRRR-SPMGVDHMSGLSGVNVPGNASSG, the ... | 1. A cell penetrating short peptide TAT-HuR-HNS-3, wherein the amino acid sequence of the cell penetrating short peptide TAT-HuR-HNS-3 for inflammatory diseases caused by the increase of inflammatory factors is as follows: YGRKKRRQRRR-SPMGVDHMSGLSGVNVPGNASSG. 2. The cell penetrating short peptide TAT-HuR-HNS-3 accordin... | The present disclosure relates to a cell penetrating short peptide TAT-HuR-HNS-3 and application thereof in inflammatory disease, wherein the amino acid sequence of cell penetrating short peptide TAT-HuR-HNS-3 for inflammatory diseases caused by elevated inflammatory factors is YGRKKRRQRRR-SPMGVDHMSGLSGVNVPGNASSG, the ... | 1,600 |
21,329 | 21,330 | 17,142,050 | 2,636 | Described herein are photonic integrated circuits (PICs) comprising a semiconductor optical amplifier (SOA) to output a signal comprising a plurality of wavelengths, a sensor to detect data associated with a power value of each wavelength of the output signal of the SOA, a filter to filter power values of one or more o... | 1. A photonic integrated circuit comprising:
a semiconductor optical amplifier to amplify a beam that includes a plurality of wavelengths; and a Mach-Zehnder interferometer integrated in the photonic integrated circuit to receive an amplified beam from the semiconductor optical amplifier, the Mach-Zehnder interferomete... | Described herein are photonic integrated circuits (PICs) comprising a semiconductor optical amplifier (SOA) to output a signal comprising a plurality of wavelengths, a sensor to detect data associated with a power value of each wavelength of the output signal of the SOA, a filter to filter power values of one or more o... | 2,600 |
21,330 | 21,331 | 17,142,076 | 2,834 | A motor includes: a motor housing; a shaft disposed inside the motor housing and extending along a rotation axis; a rotor having magnetism, and coupled to an outer circumferential surface of the shaft; a stator accommodated in the motor housing, disposed to be spaced apart from an outside of the rotor in a radial direc... | 1. A motor comprising:
a motor housing; a shaft disposed inside the motor housing and extending along a rotational axis; a rotor coupled to an outer circumferential surface of the shaft; a stator disposed in the motor housing, spaced apart from the rotor in a radial direction of the shaft, and wound around with a coil;... | A motor includes: a motor housing; a shaft disposed inside the motor housing and extending along a rotation axis; a rotor having magnetism, and coupled to an outer circumferential surface of the shaft; a stator accommodated in the motor housing, disposed to be spaced apart from an outside of the rotor in a radial direc... | 2,800 |
21,331 | 21,332 | 17,142,042 | 2,452 | A notification system is described herein. Notifications can be generated for groupings of devices. A notification indication can be sent to a larger grouping of client devices. The notification indication can include one or more grouping parameters that specify one or more conditions that define a smaller device group... | 1. A method for sending notifications to a grouping of client devices, the method comprising:
generating a request to send a notification to the grouping of client devices, the grouping of client devices comprising a subset of a population of client devices that are managed by a management service; identifying at least... | A notification system is described herein. Notifications can be generated for groupings of devices. A notification indication can be sent to a larger grouping of client devices. The notification indication can include one or more grouping parameters that specify one or more conditions that define a smaller device group... | 2,400 |
21,332 | 21,333 | 17,142,074 | 2,897 | A display device includes: a substrate on which a plurality of sub-pixels are arranged; a light-emitting device including a light-emitting layer in each of the plurality of sub-pixels; a thin film encapsulation layer covering the light-emitting layer in each of the plurality of sub-pixels; a black matrix around the plu... | 1. A display device comprising:
a substrate; a plurality of sub-pixels arranged on the substrate; a light-emitting device comprising a light-emitting layer disposed in each of the plurality of sub-pixels; a thin film encapsulation layer covering the light-emitting layer in each of the plurality of sub-pixels; a black m... | A display device includes: a substrate on which a plurality of sub-pixels are arranged; a light-emitting device including a light-emitting layer in each of the plurality of sub-pixels; a thin film encapsulation layer covering the light-emitting layer in each of the plurality of sub-pixels; a black matrix around the plu... | 2,800 |
21,333 | 21,334 | 17,142,085 | 3,659 | A hybrid-electric powertrain system for aircraft includes a gearbox having a first rotary shaft for output to drive an air mover for aircraft thrust. The system includes a first prime mover connected by a second rotary shaft to the gearbox for power input to the gearbox. Further, the system includes a second prime move... | 1. A hybrid-electric powertrain system for aircraft, the system comprising:
a gearbox having a first rotary shaft for output to drive an air mover for aircraft thrust; a first prime mover connected by a second rotary shaft to the gearbox for power input to the gearbox; and a second prime mover connected by a third rota... | A hybrid-electric powertrain system for aircraft includes a gearbox having a first rotary shaft for output to drive an air mover for aircraft thrust. The system includes a first prime mover connected by a second rotary shaft to the gearbox for power input to the gearbox. Further, the system includes a second prime move... | 3,600 |
21,334 | 21,335 | 17,142,066 | 3,711 | A ball striking device, such as an iron-type golf club head, includes a face having a ball striking surface and a body connected to the face. The body has a sole surface extending rearward from a leading edge of the face, and a toe surface extending rearward from a toe edge of the face. The sole surface configured to c... | 1. An iron-type golf club head, comprising:
a face comprising a substantially flat ball striking surface with a plurality of grooves and a rear surface, a rear surface opposite the ball striking surface, a body comprising a hosel, a heel side, a toe side, a toe surface, a top surface, and a sole surface, wherein the fa... | A ball striking device, such as an iron-type golf club head, includes a face having a ball striking surface and a body connected to the face. The body has a sole surface extending rearward from a leading edge of the face, and a toe surface extending rearward from a toe edge of the face. The sole surface configured to c... | 3,700 |
21,335 | 21,336 | 17,142,082 | 2,143 | A method implements data visualization collaboration. The method displays, for a second user, an interface with a comment pane that displays a first comment text and a first thumbnail image of a data visualization generated according to a first visual specification, from a first user. In response to detecting an input ... | 1. A method of data visualization collaboration, comprising:
at computer having a display, one or more processors, and memory storing one or more programs configured for execution by the one or more processors:
displaying a data visualization user interface, including a comment pane, for a second user, the comment pane... | A method implements data visualization collaboration. The method displays, for a second user, an interface with a comment pane that displays a first comment text and a first thumbnail image of a data visualization generated according to a first visual specification, from a first user. In response to detecting an input ... | 2,100 |
21,336 | 21,337 | 17,142,070 | 3,752 | A sprinkler assembly with a nutating distribution plate can improve even distribution of water. The distribution plate can tilt and/or translate upon water impinging the distribution plate to disperse water in different directions. The sprinkler assembly can have a deflector assembly including the distribution plate, a... | 1. A sprinkler assembly comprising:
an inlet configured to receive water; a bracket supported by the inlet; a nozzle in fluid communication with the inlet and positioned downstream of the inlet, the nozzle being configured to direct the water out of the nozzle along an axis; a bearing positioned downstream of the nozzl... | A sprinkler assembly with a nutating distribution plate can improve even distribution of water. The distribution plate can tilt and/or translate upon water impinging the distribution plate to disperse water in different directions. The sprinkler assembly can have a deflector assembly including the distribution plate, a... | 3,700 |
21,337 | 21,338 | 17,142,061 | 3,692 | The biometric actuated balance-displaying debit card gives users a secure and convenient method to view their account balance. It is of utmost convenience to be able to safely view the balance of one's account on the card used to make the purchase. Once the built-in fingerprint scanner recognizes the user's fingerprint... | 1. An electronic banking card comprising:
a composite substrate for a plurality of components comprising a programmable logic circuit, an account display, an account owner biometric indicia, an account host indicia and an inductive power coupler; a microchip comprising the programmable logic circuit in communication wi... | The biometric actuated balance-displaying debit card gives users a secure and convenient method to view their account balance. It is of utmost convenience to be able to safely view the balance of one's account on the card used to make the purchase. Once the built-in fingerprint scanner recognizes the user's fingerprint... | 3,600 |
21,338 | 21,339 | 17,142,048 | 2,847 | An electronic device includes: a display panel having an active region and a peripheral region adjacent to the active region; an electronic module disposed below the display panel; a first light-blocking element disposed on the display panel and overlapping the peripheral region; and a second light-blocking element dis... | 1. An electronic device, comprising:
a display panel having an active region and a peripheral region adjacent to the active region; an electronic module disposed below the display panel; a first light-blocking element disposed on the display panel and overlapping the peripheral region; and a second light-blocking eleme... | An electronic device includes: a display panel having an active region and a peripheral region adjacent to the active region; an electronic module disposed below the display panel; a first light-blocking element disposed on the display panel and overlapping the peripheral region; and a second light-blocking element dis... | 2,800 |
21,339 | 21,340 | 17,142,095 | 2,445 | A system for transmitting time-critical analog signals and/or digital signals between a first device and a second device. The system includes at least a first protocol converter connected to the first device and at least a second protocol converter connected to the second device. A data transmission network for transmi... | 1. A system for transmitting at least one of time-critical analog signals and time-critical digital signals between a first device and a second device, wherein the system comprises at least a first protocol converter connected to the first device and at least a second protocol converter connected to the second device, ... | A system for transmitting time-critical analog signals and/or digital signals between a first device and a second device. The system includes at least a first protocol converter connected to the first device and at least a second protocol converter connected to the second device. A data transmission network for transmi... | 2,400 |
21,340 | 21,341 | 17,142,087 | 2,846 | A method of engaging a medical instrument with a medical instrument manipulator comprises receiving an indication that a first input coupling of the medical instrument is positioned adjacent to a first drive output of the manipulator. The first drive output is driven by a first actuating element. In response to receivi... | 1-22. (canceled) 23. A medical system comprising:
a control system having one or more processors; and an instrument manipulator configured to receive an instrument, the instrument manipulator including a first drive output and a first actuating element configured to drive movement of the first drive output, the first d... | A method of engaging a medical instrument with a medical instrument manipulator comprises receiving an indication that a first input coupling of the medical instrument is positioned adjacent to a first drive output of the manipulator. The first drive output is driven by a first actuating element. In response to receivi... | 2,800 |
21,341 | 21,342 | 17,142,047 | 3,745 | Methods and apparatus for real-time clearance assessment using a pressure measurement are disclosed. An example method includes determining a first and a second static pressure measurement at a first measurement location and a second measurement location, respectively, relative to the blade tip clearance, determining a... | 1. A method to assess real-time blade tip clearance in a turbine engine, the method comprising:
determining a first and a second static pressure measurement at a first measurement location and a second measurement location, respectively, relative to the blade tip clearance; determining a normalized pressure measurement... | Methods and apparatus for real-time clearance assessment using a pressure measurement are disclosed. An example method includes determining a first and a second static pressure measurement at a first measurement location and a second measurement location, respectively, relative to the blade tip clearance, determining a... | 3,700 |
21,342 | 21,343 | 17,142,107 | 2,689 | A control device includes a controller and a safety disconnect mechanism that is illuminable. The controller couples to a power supply line and a load line. Further, the controller is operable to control a power output on the load line using a power supplied by the power supply line. The safety disconnect mechanism is ... | 1. A control device comprising:
a controller to couple to a power supply line and a load line, the controller being operable to control a power output on the load line using a power supplied by the power supply line; a safety disconnect mechanism provided with the controller, the safety disconnect mechanism being manip... | A control device includes a controller and a safety disconnect mechanism that is illuminable. The controller couples to a power supply line and a load line. Further, the controller is operable to control a power output on the load line using a power supplied by the power supply line. The safety disconnect mechanism is ... | 2,600 |
21,343 | 21,344 | 17,142,045 | 2,611 | The present invention provides a method of generating a robust global map using a plurality of limited field-of-view cameras to capture an environment.Provided is a method for generating a three-dimensional map comprising: receiving a plurality of sequential image data wherein each of the plurality of sequential image ... | 1. A computer-implemented method comprising:
determining, by a computing system, subsets of image data associated with an area, wherein the subsets of image data are based on a set of images captured at the area; determining, by the computing system, a first group of the subsets of image data having image properties th... | The present invention provides a method of generating a robust global map using a plurality of limited field-of-view cameras to capture an environment.Provided is a method for generating a three-dimensional map comprising: receiving a plurality of sequential image data wherein each of the plurality of sequential image ... | 2,600 |
21,344 | 21,345 | 17,142,044 | 2,664 | Automated detection of features and/or parameters within an ocean environment using image data. In an embodiment, captured image data is received from ocean-facing camera(s) that are positioned to capture a region of an ocean environment. Feature(s) are identified within the captured image data, and parameter(s) are me... | 1. A method comprising using at least one hardware processor to:
for each of one or more ocean-facing cameras that are positioned to capture image data of a region of an ocean environment,
receive the captured image data via at least one network,
identify one or more waves within the captured image data using a machine... | Automated detection of features and/or parameters within an ocean environment using image data. In an embodiment, captured image data is received from ocean-facing camera(s) that are positioned to capture a region of an ocean environment. Feature(s) are identified within the captured image data, and parameter(s) are me... | 2,600 |
21,345 | 21,346 | 17,142,092 | 2,857 | A method for predicting end-of-life for a component includes determining a baseline lifetime model for a component connected to a machine functional safety system. The component is part of a system with physical devices. The method includes monitoring environmental conditions and usage conditions of the component and m... | 1. A method comprising:
determining a baseline lifetime model for a component connected to a machine functional safety system, the component part of a system with physical devices; monitoring environmental conditions and usage conditions of the component; modifying the baseline lifetime model based on the monitored env... | A method for predicting end-of-life for a component includes determining a baseline lifetime model for a component connected to a machine functional safety system. The component is part of a system with physical devices. The method includes monitoring environmental conditions and usage conditions of the component and m... | 2,800 |
21,346 | 21,347 | 17,142,071 | 2,845 | An arithmetic encoder for encoding a plurality of symbols having symbol values is configured to derive an interval size information for an arithmetic encoding of one or more symbol values to be encoded based on a plurality of state variable values representing statistics of a plurality of previously encoded symbol valu... | 1. An arithmetic encoder for encoding a plurality of symbols comprising symbol values,
wherein the arithmetic encoder is configured to derive an interval size information for an arithmetic encoding of one or more symbol values to be encoded on the basis of a plurality of state variable values, which represent statistic... | An arithmetic encoder for encoding a plurality of symbols having symbol values is configured to derive an interval size information for an arithmetic encoding of one or more symbol values to be encoded based on a plurality of state variable values representing statistics of a plurality of previously encoded symbol valu... | 2,800 |
21,347 | 21,348 | 17,142,088 | 1,783 | An antiglare glass substrate includes a glass substrate having a first main surface and a second main surface that is opposite to the first main surface. The first main surface has undergone an antiglare treatment and a fluorine-containing organosilicon compound coating film as an antifouling film is laminated thereon.... | 1. An antiglare glass substrate comprising a glass substrate having a first main surface and a second main surface that is opposite to the first main surface,
wherein the first main surface has undergone an antiglare treatment and wherein the first main surface further comprises an antifouling film comprising a fluorin... | An antiglare glass substrate includes a glass substrate having a first main surface and a second main surface that is opposite to the first main surface. The first main surface has undergone an antiglare treatment and a fluorine-containing organosilicon compound coating film as an antifouling film is laminated thereon.... | 1,700 |
21,348 | 21,349 | 17,142,103 | 2,849 | A skew compensation circuit includes a skew detection circuit configured to generate skew detection signals by detecting a skew characteristic of a basic logic element constituting a semiconductor apparatus, a skew compensation signal generation circuit configured to generate a skew compensation signal by comparing the... | 1. A semiconductor apparatus comprising:
an input buffer configured to generate an output signal by buffering an input signal and control a sink current amount according to a skew compensation signal; and a skew compensation circuit configured to generate the skew compensation signal according to a detection result of ... | A skew compensation circuit includes a skew detection circuit configured to generate skew detection signals by detecting a skew characteristic of a basic logic element constituting a semiconductor apparatus, a skew compensation signal generation circuit configured to generate a skew compensation signal by comparing the... | 2,800 |
21,349 | 21,350 | 17,142,090 | 1,652 | Disclosed are fluorescent markers that include a known number of copies of a fluorescently-labeled protein regularly interspersed along the length of the fluorescent marker. The fluorescent markers may be used to quantify fluorescently-labeled samples in fluorescent microscopy. | 1.-20. (Canceled) 21. A method for quantifying a fluorescently-labeled molecule in a sample, the method comprising:
(A) performing fluorescence microscopy on the sample and performing fluorescence microscopy on a fluorescent marker, the fluorescent marker comprising a tubular or cylindrical biological structure formed ... | Disclosed are fluorescent markers that include a known number of copies of a fluorescently-labeled protein regularly interspersed along the length of the fluorescent marker. The fluorescent markers may be used to quantify fluorescently-labeled samples in fluorescent microscopy.1.-20. (Canceled) 21. A method for quantif... | 1,600 |
21,350 | 21,351 | 17,142,099 | 2,163 | Systems and methods are provided for database or data file backup. The system may comprise one or more processors and a memory storing instructions that, when executed by the one or more processors, cause the system to identify a list of data files required for restoring the database or data files, create a backup comp... | 1. A method for restoring a database, being implemented by a computing system including one or more physical processors and storage media storing machine-readable instructions, the method comprising:
receiving at least a latest backup of a sequential series of incremental backups generated for the database, wherein the... | Systems and methods are provided for database or data file backup. The system may comprise one or more processors and a memory storing instructions that, when executed by the one or more processors, cause the system to identify a list of data files required for restoring the database or data files, create a backup comp... | 2,100 |
21,351 | 21,352 | 17,142,094 | 3,681 | A location based consumer interface for retail environments includes a plurality of data packet generators distributed around a retail store. The data packet generators include a wireless communication device and are configured to wirelessly transmit codes to mobile computing devices in the retail store. The codes are ... | 1. A method of validating a presentation of promotional content to a consumer, the method comprising:
receiving a code at a server computing device from a mobile computing device, wherein receipt of the code indicates that promotional content has been presented to the consumer, the code including at least a validation ... | A location based consumer interface for retail environments includes a plurality of data packet generators distributed around a retail store. The data packet generators include a wireless communication device and are configured to wirelessly transmit codes to mobile computing devices in the retail store. The codes are ... | 3,600 |
21,352 | 21,353 | 17,142,081 | 2,613 | A processing device receives, from an image capture device associated with an augmented reality (AR) display, a plurality of images of a face of a patient. The processing device selects a subset of the plurality of images that meet one or more image selection criteria. The selection comprises determining, from the plur... | 1. A method comprising:
receiving, from an image capture device associated with an augmented reality (AR) display, a plurality of images of a face of a patient; selecting a subset of the plurality of images that meet one or more image selection criteria, the selecting comprising: determining, from the plurality of imag... | A processing device receives, from an image capture device associated with an augmented reality (AR) display, a plurality of images of a face of a patient. The processing device selects a subset of the plurality of images that meet one or more image selection criteria. The selection comprises determining, from the plur... | 2,600 |
21,353 | 21,354 | 17,142,096 | 3,616 | A compact bendable cargo securement device for stabilizing unrestrained items in the bed or cargo area of a pick-up truck or storage area in a motorhome or recreational trailer is disclosed. It may also be used as a stabilizer doing woodwork and other jobs that require stability of the work platform. The device will co... | 1. A method of securing cargo comprised of regular shaped objects and irregular shaped objects with a bendable cargo securement device comprising:
a) uncoiling a flexible tubular section having a first end and a second end, wherein said flexible tubular section is hollow; b) engaging a first closure device configured f... | A compact bendable cargo securement device for stabilizing unrestrained items in the bed or cargo area of a pick-up truck or storage area in a motorhome or recreational trailer is disclosed. It may also be used as a stabilizer doing woodwork and other jobs that require stability of the work platform. The device will co... | 3,600 |
21,354 | 21,355 | 17,142,093 | 3,791 | A method and system for measuring personal health, the method comprising detecting a photoplethysmograph (PPG) wave, the PPG wave generated based on a combination of infra-red and red lights, transmitting the PPG wave to a server, the server processing the PPG wave to infer biometric statistics based on machine learned... | 1. A method, in a data processing system comprising a processor and a memory, for measuring personal health, the method comprising:
detecting a photoplethysmograph (PPG) wave by a personal healthcare device, the PPG waves are generated by infra-red, green or red lights emitted from the personal healthcare device, where... | A method and system for measuring personal health, the method comprising detecting a photoplethysmograph (PPG) wave, the PPG wave generated based on a combination of infra-red and red lights, transmitting the PPG wave to a server, the server processing the PPG wave to infer biometric statistics based on machine learned... | 3,700 |
21,355 | 21,356 | 17,142,097 | 2,148 | A system, method, and computer-readable medium for generating factual and/or counterfactual data are described. This may have the effect of improving the complexity of data available for training machine learning models. The models may include, but not limited to, a probabilistic graphical model (PGM) and/or an agent-b... | 1. A computer-implemented method comprising:
receiving a simulation specification comprising an agent having a probability distribution definition, the agent probability distribution definition comprising attribute probability distribution definitions and identifying one or more behaviors to be simulated; receiving one... | A system, method, and computer-readable medium for generating factual and/or counterfactual data are described. This may have the effect of improving the complexity of data available for training machine learning models. The models may include, but not limited to, a probabilistic graphical model (PGM) and/or an agent-b... | 2,100 |
21,356 | 21,357 | 17,142,080 | 3,753 | The present disclosure discloses an electromagnetic regulating valve with a check function. The valve may effectively regulate the flow in a valve body. Due to different lengths and taper angles of a valve flap group, the flow can be regulated more finely, and a medium can be prevented from backflow by a check function... | 1. An electromagnetic regulating valve with a check function, the electromagnetic regulating valve comprising a left end valve body, valve flaps, an electromagnetic coil, an iron core, an annular permanent magnet, an annular spring, a right end valve body, a sealing ring, an orifice plate, and a valve group flap base; ... | The present disclosure discloses an electromagnetic regulating valve with a check function. The valve may effectively regulate the flow in a valve body. Due to different lengths and taper angles of a valve flap group, the flow can be regulated more finely, and a medium can be prevented from backflow by a check function... | 3,700 |
21,357 | 21,358 | 17,142,083 | 3,624 | According to an aspect of an embodiment, operations may include obtaining a first fixed temperature and a second fixed temperature of a replica exchange Markov Chain Monte Carlo (MCMC) process used to solve an optimization problem associated with a system, and obtaining a plurality of replicas of the system. The operat... | 1. A method comprising:
obtaining a first fixed temperature of a replica exchange Markov Chain Monte Carlo (MCMC) process used to solve an optimization problem associated with a system; obtaining a second fixed temperature of the replica exchange MCMC process; obtaining a plurality of replicas of the system to use in t... | According to an aspect of an embodiment, operations may include obtaining a first fixed temperature and a second fixed temperature of a replica exchange Markov Chain Monte Carlo (MCMC) process used to solve an optimization problem associated with a system, and obtaining a plurality of replicas of the system. The operat... | 3,600 |
21,358 | 21,359 | 17,142,078 | 2,683 | Methods and apparatus for detecting false alarms are disclosed. An indication may be received that a sensor device has changed state. Data indicative of movement of the sensor device may also be received. Based on the received data indicative of movement of the sensor device, it may be determined whether the movement o... | 1. A method comprising:
receiving data indicative of movement of a sensor device; determining, based on the data, whether the movement of the sensor device is abnormal or normal; and causing, based on determining that the movement of the sensor device is abnormal or normal, output of an indication associated with abnor... | Methods and apparatus for detecting false alarms are disclosed. An indication may be received that a sensor device has changed state. Data indicative of movement of the sensor device may also be received. Based on the received data indicative of movement of the sensor device, it may be determined whether the movement o... | 2,600 |
21,359 | 21,360 | 17,142,084 | 2,894 | Multijunction photovoltaic cells having at least three subcells are disclosed, in which at least one of the subcells comprises a base layer formed of GaInNAsSb. The GaInNAsSb subcells exhibit high internal quantum efficiencies over a broad range of irradiance energies. | 1. A multijunction photovoltaic cell comprising:
a (Si,Sn) Ge substrate; at least three subcells overlying the (Si,Sn)Ge substrate, wherein:
each of the at least three subcells is lattice matched to each of the other subcells and to the (Si,Sn)Ge substrate;
at least one of the subcells comprises a GaInNAsSb subcell com... | Multijunction photovoltaic cells having at least three subcells are disclosed, in which at least one of the subcells comprises a base layer formed of GaInNAsSb. The GaInNAsSb subcells exhibit high internal quantum efficiencies over a broad range of irradiance energies.1. A multijunction photovoltaic cell comprising:
a ... | 2,800 |
21,360 | 21,361 | 17,142,062 | 3,661 | An amusement vehicle, retrofittable hardware gamification attachment, and method for simulating power-ups in-game virtual vehicle enhancements and virtual weaponry for improved racing experience are disclosed. Amusement vehicle comprises sensor-specific transmitters/receivers for communicating with other amusement vehi... | 1. An amusement vehicle for simulating power-ups in-game virtual vehicle enhancements and virtual weaponry for improved racing experience, said amusement vehicle comprising:
sensor-specific transmitters that mount at a front end and a rear end of a frame housing of said amusement vehicle said sensor-specific transmitte... | An amusement vehicle, retrofittable hardware gamification attachment, and method for simulating power-ups in-game virtual vehicle enhancements and virtual weaponry for improved racing experience are disclosed. Amusement vehicle comprises sensor-specific transmitters/receivers for communicating with other amusement vehi... | 3,600 |
21,361 | 21,362 | 17,142,091 | 3,771 | A needle assembly comprises an outer cannula having a longitudinally extending cannula wall with a sharpened distal tip. An inner surface of the cannula wall defines a longitudinally extending cannula lumen. A plunger housing is connected to a proximal end portion of the outer cannula. A plunger is received in the plun... | 1. An instrument assembly comprising:
an outer cannula having a distal end, a proximal end, and a cannula lumen extending longitudinally therebetween; a plunger housing connected to the proximal end of the outer cannula; a plunger received in the plunger housing, the plunger having a distal portion, a proximal portion,... | A needle assembly comprises an outer cannula having a longitudinally extending cannula wall with a sharpened distal tip. An inner surface of the cannula wall defines a longitudinally extending cannula lumen. A plunger housing is connected to a proximal end portion of the outer cannula. A plunger is received in the plun... | 3,700 |
21,362 | 21,363 | 17,142,064 | 2,886 | Described herein are apparatuses for dental scanning and components of apparatuses for dental scanning. A component of a dental scanning apparatus may include a beam splitter, a transparency and an image sensor. The component may have a first surface and a second surface. The transparency may be affixed to the first su... | 1. A component for a dental scanning apparatus, comprising:
a beam splitter having a first surface and a second surface; a transparency directly bonded to the first surface of the beam splitter, the transparency comprising a spatial pattern disposed thereon, wherein the transparency is configured to be illuminated by l... | Described herein are apparatuses for dental scanning and components of apparatuses for dental scanning. A component of a dental scanning apparatus may include a beam splitter, a transparency and an image sensor. The component may have a first surface and a second surface. The transparency may be affixed to the first su... | 2,800 |
21,363 | 21,364 | 17,142,046 | 2,435 | A method for generating a key includes: obtaining key parameters indicated by a network side, the key parameters at least comprising a next hop chaining counter (NCC) and frequency point information for generating a key, the frequency information being a frequency of one Synchronization Signal Block (SSB) of a target c... | 1. A method for generating a key, applied to User Equipment (UE), the method comprising:
obtaining key parameters indicated by a network side, wherein the key parameters comprise at least a Next Hop Chaining Counter (NCC), and frequency information for generating the key, the frequency information being a frequency of ... | A method for generating a key includes: obtaining key parameters indicated by a network side, the key parameters at least comprising a next hop chaining counter (NCC) and frequency point information for generating a key, the frequency information being a frequency of one Synchronization Signal Block (SSB) of a target c... | 2,400 |
21,364 | 21,365 | 17,142,069 | 2,844 | Some embodiments include a high voltage pulsing power supply. A high voltage pulsing power supply may include: a high voltage pulser having an output that provides pulses with an amplitude greater than about 1 kV, a pulse width greater than about 1 μs, and a pulse repetition frequency greater than about 20 kHz; a plasm... | 1. A high voltage pulsing power supply comprising:
a high voltage pulser having an output that provides pulses with an amplitude greater than about 1 kV, a pulse width less than about 1 μs, and a pulse repetition frequency greater than about 20 kHz; a plasma chamber; and an electrode disposed within the plasma chamber ... | Some embodiments include a high voltage pulsing power supply. A high voltage pulsing power supply may include: a high voltage pulser having an output that provides pulses with an amplitude greater than about 1 kV, a pulse width greater than about 1 μs, and a pulse repetition frequency greater than about 20 kHz; a plasm... | 2,800 |
21,365 | 21,366 | 17,142,063 | 1,662 | The current disclosure relates to the field of plants, in particular to the fields of plant breeding and plant genetics. More particular, the disclosure concerns inventive methodology that may be useful in improving plant properties. In particular the invention may be useful in removing linkage drag. Also provided are ... | 1. A method for inducing a targeted translocation between a first locus A and a second locus B present on a first plant chromosome in a plant or plant cell, the method comprising:
(a) providing at least one plant cell comprising:
(i) the first chromosome comprising an introgression comprising the first locus A and the ... | The current disclosure relates to the field of plants, in particular to the fields of plant breeding and plant genetics. More particular, the disclosure concerns inventive methodology that may be useful in improving plant properties. In particular the invention may be useful in removing linkage drag. Also provided are ... | 1,600 |
21,366 | 21,367 | 17,142,056 | 2,832 | A system includes a wind turbine with a vertical axis of rotation; and an electric generator that is configured to generate electrical power from rotational energy of the wind turbine. The wind turbine is adapted to be mounted along of a vertical corner of a building. | 1. A turbine assembly comprising:
a wind turbine defining a first axis as a vertical axis of rotation; an electric generator operatively connected to said wind turbine and configured to generate electrical power from rotational energy of said wind turbine; and, said turbine assembly being configured to be mounted along... | A system includes a wind turbine with a vertical axis of rotation; and an electric generator that is configured to generate electrical power from rotational energy of the wind turbine. The wind turbine is adapted to be mounted along of a vertical corner of a building.1. A turbine assembly comprising:
a wind turbine def... | 2,800 |
21,367 | 21,368 | 17,142,141 | 3,675 | A motorized lock assembly and a method of motorizing a lock installed in a door. The motorized lock assembly including a motorized drive assembly to be mounted to an interior side of the door in driving engagement with a bolt assembly of the lock in place of a thumb turn of the lock. The motorized lock assembly also in... | 1. A method of retrofitting a lock installed in a door, comprising:
removing a thumb turn of the lock from an interior side of the door to expose a bolt assembly of the lock within the door; attaching a drive shaft of a motorized drive assembly to the bolt assembly in driving engagement with the bolt assembly to extend... | A motorized lock assembly and a method of motorizing a lock installed in a door. The motorized lock assembly including a motorized drive assembly to be mounted to an interior side of the door in driving engagement with a bolt assembly of the lock in place of a thumb turn of the lock. The motorized lock assembly also in... | 3,600 |
21,368 | 21,369 | 17,142,059 | 2,424 | A media player system is provided for receiving and processing a media program that uses a time interval interval to required to decode ND frames of the media program segment. The media system receives the requested media program segment, processes the segment and determines if the throughput of the media program diffe... | 1. A method of receiving and processing a media program, the media program comprising a plurality of media program versions, each of the plurality of media program versions generated for a different presentation throughput than the other of the plurality of media program versions, each of the plurality of media program... | A media player system is provided for receiving and processing a media program that uses a time interval interval to required to decode ND frames of the media program segment. The media system receives the requested media program segment, processes the segment and determines if the throughput of the media program diffe... | 2,400 |
21,369 | 21,370 | 17,142,146 | 3,771 | The disclosed embodiments provide for surgical instruments and methods for using and manufacturing the same. The disclosed surgical instrument includes a combination of serrated forceps and non-serrated forceps, the serrated forceps and the non-serrated forceps being operable independently of each other. A method of us... | 1. An instrument, comprising:
first forceps that operates to grasp a tissue; and second forceps that operates to control movement of an object through the tissue. 2. The instrument of claim 1, wherein the first forceps comprises serrated forceps and the second forceps comprises non-serrated forceps. 3. The instrument o... | The disclosed embodiments provide for surgical instruments and methods for using and manufacturing the same. The disclosed surgical instrument includes a combination of serrated forceps and non-serrated forceps, the serrated forceps and the non-serrated forceps being operable independently of each other. A method of us... | 3,700 |
21,370 | 21,371 | 17,142,124 | 2,415 | A first apparatus may determine that a DU function of a child IAB node is to transition between a first set of resources associated with an MT function of the child IAB node and a second set of resources associated with the DU function. The first apparatus may further configure a guard period associated with the transi... | 1. A method of wireless communication at an integrated access and backhaul (IAB) apparatus, comprising:
determining that a distributed unit (DU) function of a child IAB node is to transition between a first set of resources and a second set of resources at a transition time, the first set of resources being associated ... | A first apparatus may determine that a DU function of a child IAB node is to transition between a first set of resources associated with an MT function of the child IAB node and a second set of resources associated with the DU function. The first apparatus may further configure a guard period associated with the transi... | 2,400 |
21,371 | 21,372 | 17,142,131 | 2,699 | A display device includes: a pixel configured to display an image based on image data and a reference voltage; a controller configured to generate reference voltage data corresponding to the reference voltage for restraining leakage current in the pixel based on a frame frequency; and a power supply configured to gener... | 1. A display device comprising:
a pixel configured to display an image based on image data and a reference voltage; a controller configured to generate reference voltage data corresponding to the reference voltage for restraining leakage current in the pixel based on a frame frequency; and a power supply configured to ... | A display device includes: a pixel configured to display an image based on image data and a reference voltage; a controller configured to generate reference voltage data corresponding to the reference voltage for restraining leakage current in the pixel based on a frame frequency; and a power supply configured to gener... | 2,600 |
21,372 | 21,373 | 17,142,106 | 3,677 | This disclosure relates to articles that include a tightening mechanism, such as reel-based lace tightening mechanism, configured to tighten the article by rotation of a knob. The articles can include a concealing portion that is configured to conceal or protect at least a portion of the tightening mechanism, such as t... | 1. (canceled) 2. A reel based closure device comprising:
a housing having an interior region; a spool positioned within the interior region of the housing, the spool being rotatable in a first direction to wind a tension member about the spool and the spool being rotatable in a second direction to unwind the tension me... | This disclosure relates to articles that include a tightening mechanism, such as reel-based lace tightening mechanism, configured to tighten the article by rotation of a knob. The articles can include a concealing portion that is configured to conceal or protect at least a portion of the tightening mechanism, such as t... | 3,600 |
21,373 | 21,374 | 17,142,142 | 3,668 | Methods and systems for automatically implementing occupant settings in a vehicle. The system includes one or more sensors of a vehicle configured to detect sensor data associated with an identification of an occupant within the vehicle and a location of the occupant within the vehicle. The system also includes an elec... | 1. A system for automatically implementing occupant settings in a vehicle, the system comprising:
one or more sensors of a vehicle configured to detect sensor data associated with an identification of an occupant within the vehicle and a location of the occupant within the vehicle; and an electronic control unit (ECU) ... | Methods and systems for automatically implementing occupant settings in a vehicle. The system includes one or more sensors of a vehicle configured to detect sensor data associated with an identification of an occupant within the vehicle and a location of the occupant within the vehicle. The system also includes an elec... | 3,600 |
21,374 | 21,375 | 17,142,108 | 2,139 | A data storage system can scan one or more information stores and analyze the metadata of files stored in the one or more information stores to identify secondary copy operations (e.g., archiving) that can be performed on the files. The storage system can also identify storage usage information of each file during the ... | 1. A computer-readable storage medium storing instructions that when executed by a computer cause the computer to perform a method for using a computer system to manage data in information stores, the method comprising:
copying metadata of a plurality of files stored in one or more non-volatile information stores to an... | A data storage system can scan one or more information stores and analyze the metadata of files stored in the one or more information stores to identify secondary copy operations (e.g., archiving) that can be performed on the files. The storage system can also identify storage usage information of each file during the ... | 2,100 |
21,375 | 21,376 | 17,142,122 | 2,419 | Systems, methods, and computer readable media for delivery of content are provided. In some embodiments, systems for controlling delivery of content are provided, the systems comprising processing circuitry configured to: receive a request to stream the content, the request being received from a user equipment device; ... | 1. A system for delivery of content, the system comprising: processing circuitry configured to: receive a request to stream the content, the request being received from a user equipment device;
determine a first location of the user equipment device; determine a count of user equipment devices that are located at the f... | Systems, methods, and computer readable media for delivery of content are provided. In some embodiments, systems for controlling delivery of content are provided, the systems comprising processing circuitry configured to: receive a request to stream the content, the request being received from a user equipment device; ... | 2,400 |
21,376 | 21,377 | 17,142,143 | 2,816 | A semiconductor device and a method for forming a semiconductor are provided. The semiconductor device includes: a first substrate, a first conductive line disposed on the first substrate, a second substrate opposite to the first substrate, a second conductive line disposed on the second substrate and adjacent to the f... | 1. A semiconductor device, comprising:
a first substrate; a first conductive line disposed on the first substrate, wherein the first conductive line comprises a plurality of first segments separated from one another; a second substrate opposite to the first substrate; a second conductive line disposed on the second sub... | A semiconductor device and a method for forming a semiconductor are provided. The semiconductor device includes: a first substrate, a first conductive line disposed on the first substrate, a second substrate opposite to the first substrate, a second conductive line disposed on the second substrate and adjacent to the f... | 2,800 |
21,377 | 21,378 | 17,142,135 | 2,434 | In a computer system operable at more than one privilege level, an interrupt security module handles interrupts without exposing a secret value of a register to virtual interrupt handling code that executes at a lower privilege level than the interrupt security module. The interrupt security module is configured to int... | 1. A method of securing secret values stored in registers in a computer system, the method comprising:
intercepting, by a first process executing at a first privilege level, a first interrupt or exception that is targeted to be handled by a second process executing instructions at a second privilege level lower than th... | In a computer system operable at more than one privilege level, an interrupt security module handles interrupts without exposing a secret value of a register to virtual interrupt handling code that executes at a lower privilege level than the interrupt security module. The interrupt security module is configured to int... | 2,400 |
21,378 | 21,379 | 17,142,132 | 2,193 | In one embodiment, a method performed by a microcontroller of an electronic device includes accessing one or more real-time sensor data associated with one or more sensors of the electronic device, determining, by a machine-learning model running on the microcontroller, that an anomalous event has occurred on the elect... | 1. An electronic device comprising:
one or more displays; one or more non-transitory computer-readable storage media; one or more processors coupled to the storage media; one or more sensors; and a microcontroller configured to:
access one or more real-time sensor data associated with the one or more sensors;
determine... | In one embodiment, a method performed by a microcontroller of an electronic device includes accessing one or more real-time sensor data associated with one or more sensors of the electronic device, determining, by a machine-learning model running on the microcontroller, that an anomalous event has occurred on the elect... | 2,100 |
21,379 | 21,380 | 17,142,111 | 3,732 | A method for preparing continuous bamboo fibers, which relates to a technical field of bamboo fiber preparation. The method includes processing bamboo raw materials into reticulated bamboo fiber tapes, screening the bamboo fiber tapes, dividing the reticulated bamboo fiber tapes with different properties according to p... | 1. A method for preparing continuous bamboo fibers, the method comprising:
processing bamboo raw materials into bamboo fiber tapes to form preliminary differentiated bamboo fibers; screening the bamboo fiber tapes: dividing the bamboo fiber tapes with different properties according to product requirements; performing h... | A method for preparing continuous bamboo fibers, which relates to a technical field of bamboo fiber preparation. The method includes processing bamboo raw materials into reticulated bamboo fiber tapes, screening the bamboo fiber tapes, dividing the reticulated bamboo fiber tapes with different properties according to p... | 3,700 |
21,380 | 21,381 | 17,142,114 | 2,875 | An integrated ceiling device includes an electronics housing configured to retain an electronics assembly, a heat sink defining a central through opening, the electronics housing extends above the heat sink and is substantially aligned with the central through opening along a vertical axis, and the electronics housing ... | 1. An integrated ceiling device comprising:
an electronics housing configured to retain an electronics assembly; a heat sink defining a central through opening,
wherein the electronics housing extends above the heat sink and is substantially aligned with the central through opening along a vertical axis, and
wherein th... | An integrated ceiling device includes an electronics housing configured to retain an electronics assembly, a heat sink defining a central through opening, the electronics housing extends above the heat sink and is substantially aligned with the central through opening along a vertical axis, and the electronics housing ... | 2,800 |
21,381 | 21,382 | 17,142,118 | 2,196 | Methods and systems for searching a frozen index are provided. Exemplary methods include: a method may comprise: receiving an initial search and a subsequent search; loading the initial search and the subsequent search into a throttled thread pool, the throttled thread pool including; getting the initial search from th... | 1. A computer-implemented method for searching a frozen index comprising:
receiving a search request for the frozen index, the frozen index comprising a collection of documents; sending a request to pre-check shards to multiple nodes; identifying a plurality of nodes for performing the search; sending the search reques... | Methods and systems for searching a frozen index are provided. Exemplary methods include: a method may comprise: receiving an initial search and a subsequent search; loading the initial search and the subsequent search into a throttled thread pool, the throttled thread pool including; getting the initial search from th... | 2,100 |
21,382 | 21,383 | 17,142,110 | 2,414 | Methods, systems, and devices for wireless communications are described. The described techniques provide for the configuration and operation of a multi-hop relay at different layers to enable a remote user equipment (UE) to act as a relay for a client UE that may be out of coverage of a network. For example, a network... | 1. A method for wireless communications at a network relay user equipment (UE), comprising:
establishing a communication link with a network; transmitting, to a remote UE, a relay configuration that authorizes the remote UE as a multi-hop relay to provide a connection to the network for one or more client UEs; and prov... | Methods, systems, and devices for wireless communications are described. The described techniques provide for the configuration and operation of a multi-hop relay at different layers to enable a remote user equipment (UE) to act as a relay for a client UE that may be out of coverage of a network. For example, a network... | 2,400 |
21,383 | 21,384 | 17,142,161 | 3,628 | Systems and methods for fingerprint recognition-based event admission are provided. A user may use a user device to purchase a ticket for an event and provide a fingerprint scanned on the user device to a fingerprint validation system. The fingerprint validation system may associate the purchased ticket with the user a... | 1. A system, comprising:
a fingerprint validation system, including:
a fingerprint association module configured to:
receive ticket purchase information associated with a first user who has purchased a ticket, the ticket purchase information including a user identifier of a second user whom the first user has designate... | Systems and methods for fingerprint recognition-based event admission are provided. A user may use a user device to purchase a ticket for an event and provide a fingerprint scanned on the user device to a fingerprint validation system. The fingerprint validation system may associate the purchased ticket with the user a... | 3,600 |
21,384 | 21,385 | 17,142,100 | 2,163 | A method, apparatus, and system for join operations of a plurality of relations that are distributed over a plurality of storage locations over a network of computing components. | 1. A method comprising:
receiving a relational join query comprising a join condition and one or more indications collectively identifying a first table and a second table to be joined, wherein at least one of the first table and the second table is partitioned over a set of nodes of a cluster; determining an actual si... | A method, apparatus, and system for join operations of a plurality of relations that are distributed over a plurality of storage locations over a network of computing components.1. A method comprising:
receiving a relational join query comprising a join condition and one or more indications collectively identifying a f... | 2,100 |
21,385 | 21,386 | 17,142,119 | 3,624 | Examples described herein include systems and methods for scheduling tasks based on emails intended for a user. An email application, agent, or server can identify a task by parsing an unread email intended for a user. Then a machine learning model specific to that user can be applied to the task and task list informat... | 1. A method for scheduling actionable emails, comprising:
identifying a task by parsing an unread email intended for a user; locating at least one open time slot in a calendar associated with the user; applying a machine learning model to the task and at least one open time slot, wherein the machine learning model is p... | Examples described herein include systems and methods for scheduling tasks based on emails intended for a user. An email application, agent, or server can identify a task by parsing an unread email intended for a user. Then a machine learning model specific to that user can be applied to the task and task list informat... | 3,600 |
21,386 | 21,387 | 17,142,116 | 2,478 | A method and an apparatus for self-interference cancellation in a communication device. The communication device includes an antenna configured to transmit a transmit signal and receive a receive signal through a duplexer in FDD communications, a first analog to digital converter (ADC) configured to convert the receive... | 1. A communication device comprising:
an antenna configured to receive a receive signal in a receive frequency band and transmit a transmit signal in a transmit frequency band; transmit path circuitry configured to generate the transmit signal; receive path circuitry configured to process the receive signal, the receiv... | A method and an apparatus for self-interference cancellation in a communication device. The communication device includes an antenna configured to transmit a transmit signal and receive a receive signal through a duplexer in FDD communications, a first analog to digital converter (ADC) configured to convert the receive... | 2,400 |
21,387 | 21,388 | 17,142,102 | 2,685 | A touch-based control device is operable to detect touch input over an entirety of the control device's exterior, including at regions of an exterior panel that (i) overlay portions of a circuit board where no touch sensors exist, and/or (ii) extend beyond a perimeter of a touch region or circuit board on which touch s... | 1. A touch-based control device comprising:
an interior housing; an exterior panel that overlays the interior housing; and a control module provided within the interior housing to implement touch detection at any location of the exterior panel, wherein the control module generates one or more output signals to control ... | A touch-based control device is operable to detect touch input over an entirety of the control device's exterior, including at regions of an exterior panel that (i) overlay portions of a circuit board where no touch sensors exist, and/or (ii) extend beyond a perimeter of a touch region or circuit board on which touch s... | 2,600 |
21,388 | 21,389 | 17,142,105 | 2,471 | In wireless communications for multi-users, a station may generate a first frame and transmit the first frame to an access point. The first frame may include media access control protocol data units (MPDUs). Each MPDU is associated with a traffic identifier (TID). In one aspect, a TID of one of the MPDUs is different f... | 1. A station for facilitating communication in a wireless network for a transmission, the station comprising:
one or more memories; and one or more processors coupled to the one or more memories, the one or more processors configured to:
generate a first frame that comprises a plurality of data units, wherein each of t... | In wireless communications for multi-users, a station may generate a first frame and transmit the first frame to an access point. The first frame may include media access control protocol data units (MPDUs). Each MPDU is associated with a traffic identifier (TID). In one aspect, a TID of one of the MPDUs is different f... | 2,400 |
21,389 | 21,390 | 17,142,145 | 2,467 | A visibility platform can be used to monitor traffic traversing private cloud infrastructures and/or public cloud infrastructures. In some instances, the traffic is provided to a set of network services that are accessible to the visibility platform. These network services can be provisioned in a serial or parallel fas... | 1. A method comprising:
obtaining information that specifies how to route traffic processed by a cloud computing platform through a service chain that represents a sequence of network tools; populating a data structure with entries for the sequence of network tools,
wherein each entry includes information that indicate... | A visibility platform can be used to monitor traffic traversing private cloud infrastructures and/or public cloud infrastructures. In some instances, the traffic is provided to a set of network services that are accessible to the visibility platform. These network services can be provisioned in a serial or parallel fas... | 2,400 |
21,390 | 21,391 | 17,142,112 | 2,178 | Systems and methods are described for extracting and populating content from an email link. In an example, a machine learning (“ML”) model can be trained based on user interactions with emails. When an email is received for the user, the ML model can be applied to score the email. An application can extract a link in t... | 1. A method for extracting and populating content from an email link, comprising:
detecting links in a plurality of emails addressed to an email account of a user; extracting the links from the plurality of emails; creating a plurality of tiles, each of the plurality of tiles including at least one of the links; presen... | Systems and methods are described for extracting and populating content from an email link. In an example, a machine learning (“ML”) model can be trained based on user interactions with emails. When an email is received for the user, the ML model can be applied to score the email. An application can extract a link in t... | 2,100 |
21,391 | 21,392 | 17,142,149 | 2,199 | Methods and apparatus to provide holistic global performance and power management are described. In an embodiment, logic (e.g., coupled to each compute node of a plurality of compute nodes) causes determination of a policy for power and performance management across the plurality of compute nodes. The policy is coordin... | 1. An apparatus comprising:
logic, coupled to each node of a plurality of nodes, to cause determination of a policy for power and performance management to transmit to the plurality of nodes, wherein the policy is to cause coordination of power and performance management across the plurality of nodes, wherein the polic... | Methods and apparatus to provide holistic global performance and power management are described. In an embodiment, logic (e.g., coupled to each compute node of a plurality of compute nodes) causes determination of a policy for power and performance management across the plurality of compute nodes. The policy is coordin... | 2,100 |
21,392 | 21,393 | 17,142,162 | 2,159 | A method and apparatus for generating personalized suggestions for natural language search queries, where the method includes receiving a natural language query input from a user, obtaining set of suggestions for the natural language query, identifying a set of concepts in the set of suggestions, applying co-occurrence... | 1. A method of generating personalized suggestions for natural language search queries, the method comprising:
receiving an input of a natural language query from a user; obtaining set of suggestions for the natural language query; identifying a set of concepts in the set of suggestions; applying co-occurrence model to... | A method and apparatus for generating personalized suggestions for natural language search queries, where the method includes receiving a natural language query input from a user, obtaining set of suggestions for the natural language query, identifying a set of concepts in the set of suggestions, applying co-occurrence... | 2,100 |
21,393 | 21,394 | 17,142,151 | 2,117 | A device controller can include one or more touch sensors, an exterior panel, and a wireless transceiver to communicate with a local network of smart devices and one or more intermediary devices for transmitting scene commands for implementation by a second device controller. The device controller may create a mesh bri... | 1. A device controller comprising:
a housing; one or more sensors provided within the housing; a control module provided within the housing; a wireless transceiver having a given range; wherein the control module includes one or more processors and a memory storing instructions that, when executed by the one or more pr... | A device controller can include one or more touch sensors, an exterior panel, and a wireless transceiver to communicate with a local network of smart devices and one or more intermediary devices for transmitting scene commands for implementation by a second device controller. The device controller may create a mesh bri... | 2,100 |
21,394 | 21,395 | 17,142,178 | 1,785 | Disclosed herein is a foldable display apparatus which can reduce occurrence of marks on a folding section thereof, wherein the display apparatus includes a display panel, a mid-frame, and an adhesive layer, the mid-frame is disposed on one surface of the display panel, the adhesive layer is interposed between the disp... | 1. A foldable display apparatus comprising:
a display panel; a mid-frame disposed on one surface of the display panel; and an adhesive layer interposed between the display panel and the mid-frame to bond the display panel to the mid-frame, wherein the mid-frame is formed of glass. 2. The foldable display apparatus acco... | Disclosed herein is a foldable display apparatus which can reduce occurrence of marks on a folding section thereof, wherein the display apparatus includes a display panel, a mid-frame, and an adhesive layer, the mid-frame is disposed on one surface of the display panel, the adhesive layer is interposed between the disp... | 1,700 |
21,395 | 21,396 | 17,142,179 | 3,641 | In one embodiment, a less lethal munition including a ring airfoil projectile. The flight trajectory of the projectile has increased accuracy resulting from the aerodynamic stabilization of the projectile. In some embodiments, the projectile is both aerodynamically stabilized and spin stabilized. | 1-9. (canceled) 10. A munition for a gun having a barrel, comprising:
a ring airfoil projectile having a substantially open inner flowpath and a ring-shaped wall with an airfoil cross-sectional shape, the center of pressure of the airfoil being aft of the center of gravity of the projectile, the projectile having an ou... | In one embodiment, a less lethal munition including a ring airfoil projectile. The flight trajectory of the projectile has increased accuracy resulting from the aerodynamic stabilization of the projectile. In some embodiments, the projectile is both aerodynamically stabilized and spin stabilized.1-9. (canceled) 10. A m... | 3,600 |
21,396 | 21,397 | 17,142,153 | 3,711 | A golf club head comprising a channel, a slidable weight that can be reversibly fixed at any point within the channel, and a pocket to store a portion of the slidable weight is disclosed herein. The slidable weight comprises first and second weight plates, each made of materials having different densities, a lightweigh... | 1. A golf club head comprising:
a body comprising a sole, a heel side, a toe side, a face portion, a rear side, a pocket, and a channel; and a weight assembly comprising;
a first weight plate comprising a first through opening and a first flange;
a second weight plate comprising a second through opening and a second fl... | A golf club head comprising a channel, a slidable weight that can be reversibly fixed at any point within the channel, and a pocket to store a portion of the slidable weight is disclosed herein. The slidable weight comprises first and second weight plates, each made of materials having different densities, a lightweigh... | 3,700 |
21,397 | 21,398 | 17,142,155 | 1,655 | Therapeutic compositions for addressing physiological stresses and aging include an immune modulator and one or more adaptogenic nutrients. Some non-limiting examples of immune modulators include as transfer factor, low molecular weight fraction immune modulators and/or other low molecular weight fractions of colostrum... | 1. A composition, comprising:
an immune modulator comprising an effective amount of at least one of transfer factor, a source of transfer factor, a nanofraction immune modulator, a source of a nanofraction immune modulator; and a blend of adaptogenic nutrient components, comprising effective amounts of:
Rhaponticum ca... | Therapeutic compositions for addressing physiological stresses and aging include an immune modulator and one or more adaptogenic nutrients. Some non-limiting examples of immune modulators include as transfer factor, low molecular weight fraction immune modulators and/or other low molecular weight fractions of colostrum... | 1,600 |
21,398 | 21,399 | 17,142,158 | 2,818 | A semiconductor memory structure includes a first cell, a second cell, a first bit line, a first source line, a second bit line and a second source line. The first cell includes a first source structure and a first drain structure, and the second cell includes a second source structure and a second drain structure. The... | 1. A semiconductor memory structure comprising:
a first cell extending along a first direction and comprising a first source structure and a first drain structure; a second cell extending along the first direction and comprising a second source structure and a second drain structure, wherein the first cell and the seco... | A semiconductor memory structure includes a first cell, a second cell, a first bit line, a first source line, a second bit line and a second source line. The first cell includes a first source structure and a first drain structure, and the second cell includes a second source structure and a second drain structure. The... | 2,800 |
21,399 | 21,400 | 17,142,152 | 2,897 | A semiconductor memory structure and method of manufacturing a semiconductor memory structure are provided. The semiconductor memory structure comprises a cell array region, at least one connection region formed beside the cell array region and an interconnect structure formed on the connection region. The connection r... | 1. A semiconductor memory structure, comprising:
a substrate; a cell array region formed on the substrate; at least one connection region formed on the substrate and beside the cell array region, and comprising:
at least one staircase portion, comprising:
a staircase structure of alternating insulating layers and condu... | A semiconductor memory structure and method of manufacturing a semiconductor memory structure are provided. The semiconductor memory structure comprises a cell array region, at least one connection region formed beside the cell array region and an interconnect structure formed on the connection region. The connection r... | 2,800 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.