Unnamed: 0
int64
0
350k
level_0
int64
0
351k
ApplicationNumber
int64
9.75M
96.1M
ArtUnit
int64
1.6k
3.99k
Abstract
stringlengths
1
8.37k
Claims
stringlengths
3
292k
abstract-claims
stringlengths
68
293k
TechCenter
int64
1.6k
3.9k
340,900
341,774
16,754,252
1,747
A tilting pad bearing including pads disposed around a rotating shaft so as to face an outer peripheral surface of the rotating shaft, liners each supporting an outside of the pad in a radial direction with an axis of the rotating shaft as a center, and pivots each supporting an outside of the liner in the radial direc...
1. A tilting pad bearing comprising: pads disposed around a rotating shaft so as to face an outer peripheral surface of the rotating shaft; liners each supporting an outside of the pad in a radial direction with an axis of the rotating shaft as a center; and pivots each supporting an outside of the liner in the radial ...
A tilting pad bearing including pads disposed around a rotating shaft so as to face an outer peripheral surface of the rotating shaft, liners each supporting an outside of the pad in a radial direction with an axis of the rotating shaft as a center, and pivots each supporting an outside of the liner in the radial direc...
1,700
340,901
341,775
16,754,259
1,747
For automated driving, a driving system can be operated at least in a first automated driving mode with automated longitudinal and/or transverse guidance. A display device includes a driving mode display with a lighting unit. The driving mode display corresponds to a steering wheel display with a light strip structure ...
1.-17. (canceled) 18. A display device for a driving system for automated driving of a motor vehicle, wherein for the automated driving the driving system is operable at least in a first automated driving mode with automated longitudinal and/or lateral control, comprising: a driving mode display for a vehicle cockpit w...
For automated driving, a driving system can be operated at least in a first automated driving mode with automated longitudinal and/or transverse guidance. A display device includes a driving mode display with a lighting unit. The driving mode display corresponds to a steering wheel display with a light strip structure ...
1,700
340,902
341,776
16,754,245
1,747
A method of operating a UE to provide feedback on a streaming session. The method includes determining when a streaming session used by an application layer of the UE is being started and/or ended. Responsive to the determination, the method transmits an indication to a RAN that the streaming session is being started a...
1. A method of operating a user equipment, UE, to provide feedback on a streaming session, the method comprising: determining when a streaming session used by an application layer of the UE is being started and/or ended; and responsive to the determining, transmitting an indication to a radio access network, RAN, that ...
A method of operating a UE to provide feedback on a streaming session. The method includes determining when a streaming session used by an application layer of the UE is being started and/or ended. Responsive to the determination, the method transmits an indication to a RAN that the streaming session is being started a...
1,700
340,903
341,777
16,754,250
1,747
An operation device includes an operation unit to which a plurality of functions of an operated object are assigned corresponding to a position to be touched by an operation finger, a detection unit that is arranged on at least one plane extended including a plane facing the operation unit to detect the operation finge...
1. An operation device, comprising: an operation unit to which a plurality of functions of an operated object are assigned corresponding to a position to be touched by an operation finger; a detection unit that is arranged on at least one plane extended including a plane facing the operation unit to detect the operatio...
An operation device includes an operation unit to which a plurality of functions of an operated object are assigned corresponding to a position to be touched by an operation finger, a detection unit that is arranged on at least one plane extended including a plane facing the operation unit to detect the operation finge...
1,700
340,904
341,778
16,754,278
1,747
A catalyst composition comprising at least a catalyst compound selected from multi metal cyanide compounds for the selective production of oxazolidinone compounds by reacting an isocyanate compound with an epoxide compound and oxazolidinone comprising materials obtained using said catalyst compound.
1. A method for the production of oxazolidinone compounds, said method comprising combining and mixing at a temperature in the range 130-200° C. at least following compounds to form a reactive mixture: an isocyanate composition comprising at least one isocyanate compound; an epoxide composition comprising at least one ...
A catalyst composition comprising at least a catalyst compound selected from multi metal cyanide compounds for the selective production of oxazolidinone compounds by reacting an isocyanate compound with an epoxide compound and oxazolidinone comprising materials obtained using said catalyst compound.1. A method for the ...
1,700
340,905
341,779
16,754,283
1,747
An artificial turf fiber comprising at least one monofilament, each monofilament comprising a cylindrical core and a cladding. The core comprises a core polymer and threadlike regions formed by a thread polymer and embedded in the core polymer. The cladding is formed by a cladding polymer surrounding the core. It has a...
1. An artificial turf fiber comprising at least one monofilament, each of the at least one monofilament comprising a cylindrical core and a cladding, the core comprising a core polymer and threadlike regions formed by a thread polymer, the threadlike regions being embedded in the core polymer, the cladding being formed...
An artificial turf fiber comprising at least one monofilament, each monofilament comprising a cylindrical core and a cladding. The core comprises a core polymer and threadlike regions formed by a thread polymer and embedded in the core polymer. The cladding is formed by a cladding polymer surrounding the core. It has a...
1,700
340,906
341,780
16,754,260
1,765
A curable silicone composition includes at least: (A) an organopolysiloxane represented by an average composition formula and having at least two alkenyl groups in the molecule thereof; (B) an organopolysiloxane having at least two silicon-atom-bonded hydrogen atoms in the molecule thereof, at least 5 mol % of silicon-...
1. A curable silicone composition containing at least (A) an organopolysiloxane represented by average composition formula: R11 aSiO(4-a)/2 wherein in the formula, R11 represents an unsubstituted or halogen-substituted monovalent hydrocarbon group, alkoxy group or hydroxyl group, and, per molecule, at least 2 of th...
A curable silicone composition includes at least: (A) an organopolysiloxane represented by an average composition formula and having at least two alkenyl groups in the molecule thereof; (B) an organopolysiloxane having at least two silicon-atom-bonded hydrogen atoms in the molecule thereof, at least 5 mol % of silicon-...
1,700
340,907
341,781
16,754,232
1,765
The invention relates to a method for masking an image (20) of an image sequence with a mask (30), wherein a mask colour is determined according to an image colour of the image (20) in the environment of the mask (30), and a colour of the mask (30) is set according to the determined mask colour or with the determined m...
1. A method for masking an image (20) of an image sequence with a mask (30), the method comprising: determining, a mask color according to an image color of the image (20) in the environment of the mask (30); and adjusting, via a filter, a color of the mask (30) according to the determined mask color or with the determ...
The invention relates to a method for masking an image (20) of an image sequence with a mask (30), wherein a mask colour is determined according to an image colour of the image (20) in the environment of the mask (30), and a colour of the mask (30) is set according to the determined mask colour or with the determined m...
1,700
340,908
341,782
16,754,246
1,765
Provided is a computer-implemented method for verifying a user identity, including: receiving, from a user device, authentication data for a user, the authentication data including an account identifier corresponding to an account with a first issuer institution; generating, with at least one processor and based at lea...
1. A computer-implemented method for verifying a user identity, comprising: receiving, from a user device, authentication data for a user, the authentication data comprising an account identifier corresponding to an account with a first issuer institution; generating, with at least one processor and based at least part...
Provided is a computer-implemented method for verifying a user identity, including: receiving, from a user device, authentication data for a user, the authentication data including an account identifier corresponding to an account with a first issuer institution; generating, with at least one processor and based at lea...
1,700
340,909
341,783
16,754,237
1,765
Provided is a valve assembly including: a valve housing inserted into, after removing a portion of an exhaust line of a vacuum chamber, the removed portion of the exhaust line to be open in a direction communicating with the exhaust line and to have a predetermined inner space in a direction perpendicular to the direct...
1. A valve assembly comprising: a valve housing inserted into, after removing a portion of an exhaust line of a vacuum chamber, the removed portion of the exhaust line in such a manner as to be open in a direction communicating with the exhaust line and to have a predetermined inner space in a direction perpendicular t...
Provided is a valve assembly including: a valve housing inserted into, after removing a portion of an exhaust line of a vacuum chamber, the removed portion of the exhaust line to be open in a direction communicating with the exhaust line and to have a predetermined inner space in a direction perpendicular to the direct...
1,700
340,910
341,784
16,754,258
2,622
A method of assisting a user wearing a head mountable display (HMD) when determining that the user may be in a pathological state includes: detecting, by one or more sensors, one or more parameters indicating one or more current properties of the user, generating information indicating the one or more current propertie...
1. A method of assisting a user wearing a head mountable display (HMD) when determining that the user may be in a pathological state, the method comprising the steps of: detecting, by one or more sensors, one or more parameters indicating one or more current properties of the user; generating information indicating the...
A method of assisting a user wearing a head mountable display (HMD) when determining that the user may be in a pathological state includes: detecting, by one or more sensors, one or more parameters indicating one or more current properties of the user, generating information indicating the one or more current propertie...
2,600
340,911
341,785
16,754,255
2,622
A composition comprising at least two visually distinguishable phases, comprises at least one fatty phase with oil, at least one aqueous phase with hydrophilic gelling agent, and at least one compound chosen from N,N-dimethylglycine derivatives, alkyl(poly)glucosides, or a mixture thereof.
1. A composition, comprising: at least two visually distinguishable phases, comprising: a) at least one fatty phase, comprising at least one oil; b) at least one aqueous phase comprising: i) at least one hydrophilic gelling agent; and ii) at least one compound selected from the group consisting of, relative to the tota...
A composition comprising at least two visually distinguishable phases, comprises at least one fatty phase with oil, at least one aqueous phase with hydrophilic gelling agent, and at least one compound chosen from N,N-dimethylglycine derivatives, alkyl(poly)glucosides, or a mixture thereof.1. A composition, comprising: ...
2,600
340,912
341,786
16,754,224
2,622
An implementation of an optical system for expanding the field of view can include a first optical element and a second optical element. The first optical element can include a first surface and a second surface. The first surface can be configured to reflect a first light beam incident on the first surface at a first ...
1. A system comprising: a first optical element including a first surface and a second surface, the first surface configured to reflect a first light beam incident on the first surface at a first incident angle greater than a first predetermined angle, and the second surface configured to reflect the reflected first li...
An implementation of an optical system for expanding the field of view can include a first optical element and a second optical element. The first optical element can include a first surface and a second surface. The first surface can be configured to reflect a first light beam incident on the first surface at a first ...
2,600
340,913
341,787
16,754,249
2,622
Provided are a method and a device for smart control of a vehicle while defending against an RSA by using a mobile device. The method includes the steps of: establishing a communication network to be able to transmit/receive information to/from a mobile device of a driver through Bluetooth or Wi-Fi; and determining, wh...
1. A method for smart control of a vehicle while defending against a relay station attack (RSA) by using a mobile device, the method comprising: establishing a communication network to transmit and receive information with a mobile device of a driver via Bluetooth or Wi-Fi communication; when a received signal strength...
Provided are a method and a device for smart control of a vehicle while defending against an RSA by using a mobile device. The method includes the steps of: establishing a communication network to be able to transmit/receive information to/from a mobile device of a driver through Bluetooth or Wi-Fi; and determining, wh...
2,600
340,914
341,788
16,754,256
2,622
The present invention relates to a process for reshaping keratin fibers, preferably hair, comprising the steps of: (i) applying onto the keratin fibers a composition comprising (a) at least one organic acid salt of alkaline earth metal, wherein the composition has a pH of from 8.0 to 13.5, preferably from 8.0 to 12.0, ...
1.-15. (canceled) 16. A process for reshaping keratin fibers comprising: (i) applying onto the keratin fibers a composition comprising at least one organic acid salt of alkaline earth metal, wherein the composition has a pH ranging from 8.0 to 13.5; and (ii) heating the keratin fibers after applying the composition ont...
The present invention relates to a process for reshaping keratin fibers, preferably hair, comprising the steps of: (i) applying onto the keratin fibers a composition comprising (a) at least one organic acid salt of alkaline earth metal, wherein the composition has a pH of from 8.0 to 13.5, preferably from 8.0 to 12.0, ...
2,600
340,915
341,789
16,754,248
2,622
According to examples, a three-dimensional (3D) fabrication system may include fabrication components and a controller. The controller may control the fabrication components to fabricate parts of a 3D object in a build envelope, the parts to be assembled together to form the object, and in which the parts are fabricate...
1. A three-dimensional (3D) fabrication system comprising: fabrication components; and a controller to: control the fabrication components to fabricate parts of a 3D object in a build envelope, the parts to be assembled together to form the 3D object, wherein the parts are fabricated at locations corresponding to relat...
According to examples, a three-dimensional (3D) fabrication system may include fabrication components and a controller. The controller may control the fabrication components to fabricate parts of a 3D object in a build envelope, the parts to be assembled together to form the object, and in which the parts are fabricate...
2,600
340,916
341,790
16,754,293
2,472
A vehicle control device including a microcontroller, a wifi/bluetooth device, a voltage stabilizer circuit and a voltage protector circuit, a battery and a battery charge control circuit, an analogue-digital bus can adapter circuit of transceiver type, an optical-digital signal adapter, a radiofrequency (rf) module, a...
1. A vehicle control device comprising: a microcontroller, a wifi/bluetooth device, a voltage stabilizer circuit, a voltage protector circuit, a battery, a battery charge control circuit, an analogue-digital bus can adapter circuit of transceiver type, an optical-digital signal adapter, a radiofrequency (rf) module, an...
A vehicle control device including a microcontroller, a wifi/bluetooth device, a voltage stabilizer circuit and a voltage protector circuit, a battery and a battery charge control circuit, an analogue-digital bus can adapter circuit of transceiver type, an optical-digital signal adapter, a radiofrequency (rf) module, a...
2,400
340,917
341,791
16,754,270
2,472
A rotor for a hover-capable aircraft is described, comprising: a hub rotatable about an axis and, in turn, comprising a plurality of blades; a mast connectable to a drive member of the aircraft and operatively connected to the hub to drive the hub in rotation about the axis; and damping means for damping vibrations tra...
1. A rotor (3, 3′) for a hover-capable aircraft (1), comprising: a hub (5) rotatable about a first axis (A) and, in turn, comprising a plurality of blades (9); a mast (6) connectable to a drive member of said aircraft (1) and operatively connected to said hub (5) to drive the hub (5) in rotation about said axis (A); an...
A rotor for a hover-capable aircraft is described, comprising: a hub rotatable about an axis and, in turn, comprising a plurality of blades; a mast connectable to a drive member of the aircraft and operatively connected to the hub to drive the hub in rotation about the axis; and damping means for damping vibrations tra...
2,400
340,918
341,792
16,754,272
2,472
An improved electromechanically drivable spreader unit having an integrated adjustment apparatus for a drum brake, in which the linear motion of brake shoe holders is produced by two ball-ramp devices, wherein a first ball-ramp device includes a first actuation piston arranged for rotation about the axis and a second b...
1. An electromechanically drivable spreader unit for a drum brake comprising: a housing and two first and second brake shoe holders, which are arranged in a manner secured against rotation in relation to the housing and which can be actuated linearly along an axis, respectively away from one another in a spreading dire...
An improved electromechanically drivable spreader unit having an integrated adjustment apparatus for a drum brake, in which the linear motion of brake shoe holders is produced by two ball-ramp devices, wherein a first ball-ramp device includes a first actuation piston arranged for rotation about the axis and a second b...
2,400
340,919
341,793
16,754,267
2,472
A decoupled ETP model processor is configured to store power consumption data retrieved from power systems; convert the power consumption data into power activated time cycles and power non-activated time cycles; derive a thermal resistance (R) parameter and a capacitance (C) parameter for a predetermined heat flow (Q)...
1. A method of improving an energy parameter estimation, comprising: storing power consumption data retrieved from a plurality of power systems into a power consumption database; converting, via processing circuitry, the power consumption data into power activated time cycles and power non-activated time cycles; calcul...
A decoupled ETP model processor is configured to store power consumption data retrieved from power systems; convert the power consumption data into power activated time cycles and power non-activated time cycles; derive a thermal resistance (R) parameter and a capacitance (C) parameter for a predetermined heat flow (Q)...
2,400
340,920
341,794
16,754,266
2,472
A therapeutic agent for treatment of solid cancers, including, as an effective component, N-{5-[(6,7-dimethoxy-4-quinolinyl)oxy]-2-pyridinyl}-2,5-dioxo-1-phenyl-1,2,5,6,7,8-hexahydro-3-quinolinecarboxamide, a pharmaceutically acceptable salt thereof, or a hydrate of the compound or the salt in combination with osimerti...
1. A therapeutic agent for treatment of a solid cancer comprising an Axl inhibitor as an effective component to be administered in combination with osimertinib or a pharmaceutically acceptable salt thereof, wherein the Axl inhibitor is N-{5-[(6,7-dimethoxy-4-quinolinyl)oxy]-2-pyridinyl}-2,5-dioxo-1-phenyl-1,2,5,6,7,8-h...
A therapeutic agent for treatment of solid cancers, including, as an effective component, N-{5-[(6,7-dimethoxy-4-quinolinyl)oxy]-2-pyridinyl}-2,5-dioxo-1-phenyl-1,2,5,6,7,8-hexahydro-3-quinolinecarboxamide, a pharmaceutically acceptable salt thereof, or a hydrate of the compound or the salt in combination with osimerti...
2,400
340,921
341,795
16,754,298
2,472
Disclosed is a server for performing authentication or identification using biometric information including basic information and detailed information includes a storage for storing basic information and detailed information that are separately encrypted for each of a plurality of users, a communicator for communicatin...
1. A server for performing authentication or identification using biometric information including basic information and detailed information, the server comprising: a storage for storing basic information and detailed information that are separately encrypted for each of a plurality of users; a communicator for communi...
Disclosed is a server for performing authentication or identification using biometric information including basic information and detailed information includes a storage for storing basic information and detailed information that are separately encrypted for each of a plurality of users, a communicator for communicatin...
2,400
340,922
341,796
16,754,295
2,472
An ink tank includes a cap assembly attached to the ink tank by a preloaded hinge that defines a rotational axis of the cap assembly when the cap assembly is opened and closed. The preloaded hinge biases the cap assembly to an opened position when the cap assembly is unlatched. The cap assembly includes a cap housing, ...
1. An apparatus, comprising: a cap assembly attached to an ink tank by a preloaded hinge, the hinge defining a rotational axis of the cap assembly when the cap assembly is opened and closed, the preloaded hinge to bias the cap assembly to an opened position when the cap assembly is unlatched, the cap assembly comprisin...
An ink tank includes a cap assembly attached to the ink tank by a preloaded hinge that defines a rotational axis of the cap assembly when the cap assembly is opened and closed. The preloaded hinge biases the cap assembly to an opened position when the cap assembly is unlatched. The cap assembly includes a cap housing, ...
2,400
340,923
341,797
16,754,304
2,472
The disclosure provides a display panel, a manufacturing method thereof, and a display device. The display panel is divided into a display area and a camera area. The camera area includes a first through-hole, a first light-transmitting layer, an inorganic layer, a second through-hole, a second light-transmitting layer...
1. A display panel, comprising a display area and a camera area; wherein the camera area comprises: a flexible substrate; a first through-hole penetrating through the flexible substrate; a first light-transmitting layer disposed in the first through-hole; an inorganic layer disposed on a side surface of the flexible su...
The disclosure provides a display panel, a manufacturing method thereof, and a display device. The display panel is divided into a display area and a camera area. The camera area includes a first through-hole, a first light-transmitting layer, an inorganic layer, a second through-hole, a second light-transmitting layer...
2,400
340,924
341,798
16,754,285
2,472
The present invention provides new modified anti-SIRPa antibodies linked to an immunotherapeutic agent which are bifunctional and able to specifically enhance the immune response and uses thereof.
1. A bifunctional anti-human SIRPa antibody or antigen-binding fragment thereof, which comprises: a) a heavy chain variable domain comprising HCDR1, HCDR2 and HCDR3, and b) a light chain variable domain comprising LCDR1, LCDR2 and LCDR3, wherein: HCDR1 comprises or consists of the amino acid sequence set forth in SEQ I...
The present invention provides new modified anti-SIRPa antibodies linked to an immunotherapeutic agent which are bifunctional and able to specifically enhance the immune response and uses thereof.1. A bifunctional anti-human SIRPa antibody or antigen-binding fragment thereof, which comprises: a) a heavy chain variable ...
2,400
340,925
341,799
16,754,264
2,472
An estimation unit estimates a thermal sensation representing how hot or cold a user feels based on an image of the user taken by a camera. A control unit controls an air-conditioning operation of an air conditioner based on an estimation result of the estimation unit so that the thermal sensation falls within a target...
1. An air-conditioning control apparatus, comprising: an imaging unit that takes an image of at least one user; an estimation unit that estimates a thermal sensation representing how hot or cold the at least one user feels based on the image of the at least one user taken by the imaging unit; and a control unit that co...
An estimation unit estimates a thermal sensation representing how hot or cold a user feels based on an image of the user taken by a camera. A control unit controls an air-conditioning operation of an air conditioner based on an estimation result of the estimation unit so that the thermal sensation falls within a target...
2,400
340,926
341,800
16,754,265
2,472
A superabsorbent polymer composition exhibiting very improved antimicrobial and deodorizing properties while maintaining basic absorption performance, and can significantly reduce the generation of dust during the application for a process, and thus fulfills both stability and processability and can be usefully applied...
1. A superabsorbent polymer composition comprising: superabsorbent polymer particles comprising a crosslinked polymer of water-soluble ethylenically unsaturated monomers including acid groups, wherein at least a part of the acid groups are neutralized; and an antimicrobial agent having a controlled particle size, where...
A superabsorbent polymer composition exhibiting very improved antimicrobial and deodorizing properties while maintaining basic absorption performance, and can significantly reduce the generation of dust during the application for a process, and thus fulfills both stability and processability and can be usefully applied...
2,400
340,927
341,801
16,754,268
2,472
A method for producing expanded thermoplastic polymeric (eTP) material and tuning the density of the eTP during the process of producing said eTP wherein the density of the eTP material can be decreased by increasing the partial pressure of the at least one gas which is soluble in the TP material and/or by increasing t...
1. A method for producing expanded thermoplastic polymeric (“eTP”) material and reducing the density of the eTP during the process of producing said eTP, said method comprising at least following steps: providing non-expanded thermoplastic polymeric (TP) material, and then placing the non-expanded TP material in an aut...
A method for producing expanded thermoplastic polymeric (eTP) material and tuning the density of the eTP during the process of producing said eTP wherein the density of the eTP material can be decreased by increasing the partial pressure of the at least one gas which is soluble in the TP material and/or by increasing t...
2,400
340,928
341,802
16,754,254
2,472
An electrode for a non-aqueous electrolyte secondary battery has a current collector and an electrode active material layer arranged on a surface of the current collector, and is used for a non-aqueous electrolyte secondary battery having a liquid volume coefficient of 1.4 to 2.0, in which the electrode active material...
1. An electrode for a non-aqueous electrolyte secondary battery, comprising: a current collector; and an electrode active material layer arranged on a surface of the current collector, and being used for a non-aqueous electrolyte secondary battery having a liquid volume coefficient of 1.4 or more, wherein the electrode...
An electrode for a non-aqueous electrolyte secondary battery has a current collector and an electrode active material layer arranged on a surface of the current collector, and is used for a non-aqueous electrolyte secondary battery having a liquid volume coefficient of 1.4 to 2.0, in which the electrode active material...
2,400
340,929
341,803
16,754,263
2,472
The present invention relates to a photocurable dental composition comprising a specific polymerization initiator system containing the combination of a photoinitiator compound and a coinitiator compound being a sulfinate compound or a sulfonate compound. The present invention also relates to the use of this polymeriza...
1. Photocurable dental composition comprising (a) one or more radical-polymerizable compounds, and (b) a polymerization initiator system containing (i) an photoinitiator compound having a light absorption maximum in the range from 300 to 800 nm; and (ii) a coinitiator compound; wherein the coinitiator compound is a su...
The present invention relates to a photocurable dental composition comprising a specific polymerization initiator system containing the combination of a photoinitiator compound and a coinitiator compound being a sulfinate compound or a sulfonate compound. The present invention also relates to the use of this polymeriza...
2,400
340,930
341,804
16,754,273
2,472
In general, the invention relates to a gearbox. The gearbox may include a controller comprising circuity and is configured to make a first determination that an available data amount at a first clock cycle is greater than a required data amount and that no idle Ethernet Block is being processed, wherein the available d...
1. A gearbox, comprising: a controller comprising circuity and configured to: make a first determination that an available data amount at a first clock cycle is greater than a required data amount and that no idle Ethernet Block is being processed, wherein the available data amount at the first clock cycle comprises an...
In general, the invention relates to a gearbox. The gearbox may include a controller comprising circuity and is configured to make a first determination that an available data amount at a first clock cycle is greater than a required data amount and that no idle Ethernet Block is being processed, wherein the available d...
2,400
340,931
341,805
16,754,271
2,472
A tubular electromechanical actuator includes an electronic control unit including a housing and an electronic board. A first electrical connection device includes first electrical connection elements configured to electrically connect the board to electrical connection elements of an electric motor and second electric...
1. A tubular electromechanical actuator for a closure or sun protection home automation installation, the electromechanical actuator comprising at least: an electric motor, a reduction gear, an electronic control unit, the electronic control unit comprising a housing and an electronic board, the electronic board being ...
A tubular electromechanical actuator includes an electronic control unit including a housing and an electronic board. A first electrical connection device includes first electrical connection elements configured to electrically connect the board to electrical connection elements of an electric motor and second electric...
2,400
340,932
341,806
16,754,307
2,472
The invention relates to an extended release oral pharmaceutical composition comprising a core, wherein the core comprises apremilast or pharmaceutically acceptable salts, ester, solvates, polymorphs thereof, at least one extended release polymer and one or more pharmaceutically acceptable excipients, wherein the core ...
1. An extended release oral pharmaceutical composition comprising: (i) a core comprising apremilast or its pharmaceutically acceptable salts, ester, solvates, polymorphs thereof, one or more extended release polymer and one or more pharmaceutically acceptable excipients; and (ii) optionally a film coating. 2. The exten...
The invention relates to an extended release oral pharmaceutical composition comprising a core, wherein the core comprises apremilast or pharmaceutically acceptable salts, ester, solvates, polymorphs thereof, at least one extended release polymer and one or more pharmaceutically acceptable excipients, wherein the core ...
2,400
340,933
341,807
16,754,299
2,472
The present disclosure relates to a modular movable robot that is capable of providing various services and realizing autonomous driving. Also, the modular movable robot according to an embodiment of the present disclosure includes a main body, a traveling unit mounted on a lower end of the main body to allow the main ...
1. A modular movable robot comprising: a main body; a traveling unit mounted on a lower portion of the main body to allow the main body to be movable; a porter module coupled to the main body to fix an object to be transferred, the porter module being configured to provide module information to the main body; a body di...
The present disclosure relates to a modular movable robot that is capable of providing various services and realizing autonomous driving. Also, the modular movable robot according to an embodiment of the present disclosure includes a main body, a traveling unit mounted on a lower end of the main body to allow the main ...
2,400
340,934
341,808
16,754,269
2,472
The present disclosure provides a method of volumetric imaging of a sample. The method comprises providing a plurality of depth images of a region of interest of the sample using a volumetric imaging system. The region of interest is below a surface area of interest of the sample. Each depth image is associated with a ...
1-26. (canceled) 27. A method of volumetric imaging of a sample, the method comprising the steps of: providing a plurality of depth images of a region of interest of the sample using a volumetric imaging system, the region of interest being below a surface area of interest of the sample, each depth image being associat...
The present disclosure provides a method of volumetric imaging of a sample. The method comprises providing a plurality of depth images of a region of interest of the sample using a volumetric imaging system. The region of interest is below a surface area of interest of the sample. Each depth image is associated with a ...
2,400
340,935
341,809
16,754,292
2,472
The invention discloses a method of operating a system for neurofeedback (NFB) that includes trained animal in a feedback chain. Feedback chain consists of the following steps:
1-11. (canceled) 12. A method of operating a system for neurofeedback (NFB) training on a subject that includes an animal species in a feedback chain; wherein the system comprises at least one user module, a mobile module and optionally—option modules selected from one or more separated modules placed in a NFB performa...
The invention discloses a method of operating a system for neurofeedback (NFB) that includes trained animal in a feedback chain. Feedback chain consists of the following steps:1-11. (canceled) 12. A method of operating a system for neurofeedback (NFB) training on a subject that includes an animal species in a feedback ...
2,400
340,936
341,810
16,754,301
2,472
The present invention is directed to compounds of the formula (I), wherein all substituents are defined herein, as well as pharmaceutically acceptable compositions comprising compounds of the invention and methods of using said compositions in the treatment of various disorders.
1. A compound of the formula 2. The compound according to claim 1 of formula (I) 3. The compound according to claim 1 of formula (I) 4. The compound according to claim 1 of the formula 5. The compound according to claim 1 of the formula 6. The compound according to claim 1 of the formula 7-8. (canceled) 9. The compound...
The present invention is directed to compounds of the formula (I), wherein all substituents are defined herein, as well as pharmaceutically acceptable compositions comprising compounds of the invention and methods of using said compositions in the treatment of various disorders.1. A compound of the formula 2. The compo...
2,400
340,937
341,811
16,754,309
2,472
A bendable medical instrument including: a handle at a proximal end of the bendable medical instrument, a modular distal shaft including a plurality of vertebrae configured to bend and situated near a distal end of the bendable medical instrument, a bendable internal rod disposed through at least some of the plurality ...
1. A bendable medical instrument comprising: a handle at a proximal end of the bendable medical instrument; a modular distal shaft including a plurality of vertebrae configured to bend and situated near a distal end of the bendable medical instrument; a bendable internal rod disposed through at least some of the plural...
A bendable medical instrument including: a handle at a proximal end of the bendable medical instrument, a modular distal shaft including a plurality of vertebrae configured to bend and situated near a distal end of the bendable medical instrument, a bendable internal rod disposed through at least some of the plurality ...
2,400
340,938
341,812
16,754,290
2,472
The invention relates to methods for manufacturing an inorganic polymer object from a precursor wherein the precursor consists of one or more or comprises one or more selected from the group consisting of gibbsite-containing bauxite, gibbsite containing residue of the Bayer process, thermally processed gibbsite-contain...
1-20. (canceled) 21. A method for manufacturing an inorganic polymer object from a precursor that comprises a gibbsite-containing residue or a thermally processed gibbsite-containing residue of the Bayer process, the precursor comprising less than 0.01 wt % silica fume, the method comprising: alkaline-activating the pr...
The invention relates to methods for manufacturing an inorganic polymer object from a precursor wherein the precursor consists of one or more or comprises one or more selected from the group consisting of gibbsite-containing bauxite, gibbsite containing residue of the Bayer process, thermally processed gibbsite-contain...
2,400
340,939
341,813
16,754,310
2,472
A PRV is provided, comprising an inlet, an outlet, and a pressure regulating system therebetween to maintain a set pressure at the outlet. The PRV further comprises a selection system configured to select between the two working pressures based on the pressure of the fluid at the inlet of the PRV, and to direct the pre...
1-45. (canceled) 46. A pressure regulating valve (PRV), comprising: a PRV inlet at an upstream end thereof; a PRV outlet at a downstream end thereof; a pressure regulating system operatively disposed therebetween being configured to maintain a set pressure at the PRV outlet by regulating a flow of fluid between the PRV...
A PRV is provided, comprising an inlet, an outlet, and a pressure regulating system therebetween to maintain a set pressure at the outlet. The PRV further comprises a selection system configured to select between the two working pressures based on the pressure of the fluid at the inlet of the PRV, and to direct the pre...
2,400
340,940
341,814
16,754,314
2,472
The invention provides a tubular solid state lamp having a driver at each end each with an associated section of the solid state light source arrangement. The two drivers are for connection in series so that the mains voltage is shared between them. In this way, each end connector of the lamp holder is only required to...
1. A tubular solid state lamp for connecting to a fluorescent luminaire and for direct connecting with a mains voltage, the tubular solid state lamp comprising: a first pair of connection pins at one end of the tubular solid state lamp and a second pair of connection pins at the other end of the tubular solid state lam...
The invention provides a tubular solid state lamp having a driver at each end each with an associated section of the solid state light source arrangement. The two drivers are for connection in series so that the mains voltage is shared between them. In this way, each end connector of the lamp holder is only required to...
2,400
340,941
341,815
16,754,312
2,472
The present invention relates to a novel process for the preparation of lifitegrast of Formula I. The present invention further provides a novel process for the purification of lifitegrast of Formula I.
1. A process for the preparation of lifitegrast of Formula I, 2. The process as claimed in claim 1, wherein said base is selected from dimethyl amino pyridine (DMAP), triethyl amine (TEA), diisopropyl ethyl amine (DIPEA), 2,4,6-collidine, 1,3,5-collidine, sodium hydroxide, potassium hydroxide, cesium hydroxide, lithium...
The present invention relates to a novel process for the preparation of lifitegrast of Formula I. The present invention further provides a novel process for the purification of lifitegrast of Formula I.1. A process for the preparation of lifitegrast of Formula I, 2. The process as claimed in claim 1, wherein said base ...
2,400
340,942
341,816
16,754,303
1,761
The present invention concerns a composition for suppressing formation and transmission of dust particles. Such de-dusting of particulate products has benefits in health and safety as well as preventing corrosive effects of dust particles. The composition comprises high quality glycerin substantially free of chloride a...
1. Fugitive emission-suppressant and non-corrosive agent for dust-issuing particulate products, characterized by the fact that it comprises glycerin which is substantially free of chloride and sulphate and water and/or vegetable oils and/or derivatives thereof. 2. Fugitive emission-suppressant and non-corrosive agent a...
The present invention concerns a composition for suppressing formation and transmission of dust particles. Such de-dusting of particulate products has benefits in health and safety as well as preventing corrosive effects of dust particles. The composition comprises high quality glycerin substantially free of chloride a...
1,700
340,943
341,817
16,754,279
1,761
A method and network device for forwarding data packets. Specifically, the method and network device disclosed herein separate the known data packet forwarding architecture in network devices, often implemented using a single component, into two components. In implementing the pair of components, functionalities direct...
1. A method for forwarding data packets, comprising: receiving, by a collision detector and forwarder (CDF), a first data packet arriving through a first ingress network interface (INI) and a second data packet arriving through a second INI; receiving, by a data packet buffer (DPB), a first data packet copy arriving th...
A method and network device for forwarding data packets. Specifically, the method and network device disclosed herein separate the known data packet forwarding architecture in network devices, often implemented using a single component, into two components. In implementing the pair of components, functionalities direct...
1,700
340,944
341,818
16,754,327
1,761
A display panel and a display device provided by the present disclosure comprise a substrate comprising a plurality of pixel unit areas disposed in an array, and a plurality of pixel units respectively disposed in the plurality of pixel unit areas. Each pixel unit of the plurality of pixel units comprises an R sub-pixe...
1. A display panel, comprising: a substrate comprising a plurality of pixel unit areas disposed in an array; and a plurality of pixel units respectively disposed in the plurality of pixel unit areas, wherein each of the plurality of pixel units comprises an R sub-pixel, a G sub-pixel, and a B sub-pixel; and wherein a p...
A display panel and a display device provided by the present disclosure comprise a substrate comprising a plurality of pixel unit areas disposed in an array, and a plurality of pixel units respectively disposed in the plurality of pixel unit areas. Each pixel unit of the plurality of pixel units comprises an R sub-pixe...
1,700
340,945
341,819
16,754,289
1,761
A method for automatically parking a vehicle in a parking slot involves manually driving the vehicle into the parking slot in a training step, and thereafter automatically driving the vehicle into the parking slot in a replay step. Automatically driving the vehicle into the parking slot involves detecting information o...
1. A method for automatically parking a vehicle in a parking slot, comprising: manually driving the vehicle into the parking slot in a training step; and thereafter, automatically driving the vehicle into the parking slot in a replay step, wherein the step of manually driving the vehicle into the parking slot comprises...
A method for automatically parking a vehicle in a parking slot involves manually driving the vehicle into the parking slot in a training step, and thereafter automatically driving the vehicle into the parking slot in a replay step. Automatically driving the vehicle into the parking slot involves detecting information o...
1,700
340,946
341,820
16,754,302
1,761
A component includes an outer wall that includes an exterior surface, and at least one plenum defined interiorly to the outer wall and configured to receive a cooling fluid therein. The component also includes a coating system disposed on the exterior surface. The coating system has a thickness. The component further i...
1. A component comprising: an outer wall comprising an exterior surface; at least one plenum defined interiorly to said outer wall and configured to receive a cooling fluid therein; a coating system disposed on said exterior surface, said coating system having a thickness; and a plurality of adaptive cooling openings d...
A component includes an outer wall that includes an exterior surface, and at least one plenum defined interiorly to the outer wall and configured to receive a cooling fluid therein. The component also includes a coating system disposed on the exterior surface. The coating system has a thickness. The component further i...
1,700
340,947
341,821
16,754,276
1,761
The invention relates to an electrode composition for lithium-ion battery, a process for preparing the composition, such an electrode and a lithium-ion battery incorporating same. The composition comprises an active substance able to perform reversible insertion/deinsertion of lithium in the electrode, an electrically ...
1. A composition comprising: an active material for performing reversible insertion/deinsertion of lithium in an electrode, an electrically conductive filler and a polymeric binder comprising a modified polyolefin, wherein the modified polyolefin is derived from an apolar aliphatic polyolefin and incorporates CO and OH...
The invention relates to an electrode composition for lithium-ion battery, a process for preparing the composition, such an electrode and a lithium-ion battery incorporating same. The composition comprises an active substance able to perform reversible insertion/deinsertion of lithium in the electrode, an electrically ...
1,700
340,948
341,822
16,754,284
1,761
An image projection system utilising a digital mirror device with pivotable mirrors and an asymmetric angular illumination of the mirrors.
1. An image projection apparatus for a head up display, the apparatus comprising: a digital mirror device comprising a plurality of pivotable mirrors; an illumination source configured to illuminate the pivotable mirrors with incident light distributed spatially across the mirrors and angularly across an input cone; an...
An image projection system utilising a digital mirror device with pivotable mirrors and an asymmetric angular illumination of the mirrors.1. An image projection apparatus for a head up display, the apparatus comprising: a digital mirror device comprising a plurality of pivotable mirrors; an illumination source configur...
1,700
340,949
341,823
16,754,291
1,761
A neural stimulator, suitable for implanting in a recipient, and having a flying lead with a configurable electrode. A benefit is an intra-operative ability to adjust the connection between the lead and an anatomically correct electrode, which obviates the need to manufacture multiple different configurations of implan...
1. An implantable neural stimulator, comprising: an attachment and an electrode lead configured to accept the attachment, wherein the attachment is adapted to secure the lead to a location on a recipient's anatomy. 2. The neural stimulator of claim 1, wherein the attachment is configured to be joined to a tip of the el...
A neural stimulator, suitable for implanting in a recipient, and having a flying lead with a configurable electrode. A benefit is an intra-operative ability to adjust the connection between the lead and an anatomically correct electrode, which obviates the need to manufacture multiple different configurations of implan...
1,700
340,950
341,824
16,754,280
1,761
In order to reduce the effect on a compressor caused by foaming in an oil tank, a control unit for controlling an oil pump starts the oil pump before a compressor is started (SA1), starts the compressor (SA4) when an oil supply differential pressure P satisfies a compressor startup condition during a reference time Tas...
1. A centrifugal chiller comprising: a compressor which compresses a refrigerant; a condenser which condenses the refrigerant compressed by the compressor; an expansion valve which expands a liquid refrigerant introduced from the condenser; an evaporator which evaporates the refrigerant expanded by the expansion valve;...
In order to reduce the effect on a compressor caused by foaming in an oil tank, a control unit for controlling an oil pump starts the oil pump before a compressor is started (SA1), starts the compressor (SA4) when an oil supply differential pressure P satisfies a compressor startup condition during a reference time Tas...
1,700
340,951
341,825
16,754,275
1,761
The invention provides a system and method of identifying when a message is received at a control station from at least one device in a network having a plurality of devices, said method comprising the steps of receiving at the control station a low bandwidth signal from at least one device; obtaining a coarse timestam...
1. A method of identifying when a message is received at a control station from at least one device in a network having a plurality of devices, said method comprising the steps of: receiving at the control station a low bandwidth signal from at least one device; obtaining a coarse timestamp estimate of when said low ba...
The invention provides a system and method of identifying when a message is received at a control station from at least one device in a network having a plurality of devices, said method comprising the steps of receiving at the control station a low bandwidth signal from at least one device; obtaining a coarse timestam...
1,700
340,952
341,826
16,754,324
1,761
A decision support system and method can be used to control a water treatment or distribution system. The decision support system collects data from multiple water system operators and analyses the data for a selected water system according to one or more rules or algorithms. The system returns data, optionally includi...
1. A decision support system for a water system comprising, an interface program operable on a user interface device at a water system; an analytical program operable on a remote server; and, one or more data collection devices at the water system including at least one device that provides microbial population data, w...
A decision support system and method can be used to control a water treatment or distribution system. The decision support system collects data from multiple water system operators and analyses the data for a selected water system according to one or more rules or algorithms. The system returns data, optionally includi...
1,700
340,953
341,827
16,754,247
1,761
The invention relates to recombinant microorganisms and methods for producing steviol glycosides and steviol glycoside precursors.
1. A recombinant host cell capable of producing one or more steviol glycosides or a steviol glycoside composition in a cell culture, comprising: (a) a recombinant gene encoding a polypeptide capable of debranching glycogen; and/or (b) a recombinant gene encoding a polypeptide capable of synthesizing glucose-1-phosphate...
The invention relates to recombinant microorganisms and methods for producing steviol glycosides and steviol glycoside precursors.1. A recombinant host cell capable of producing one or more steviol glycosides or a steviol glycoside composition in a cell culture, comprising: (a) a recombinant gene encoding a polypeptide...
1,700
340,954
341,828
16,754,311
1,784
The present disclosure relates to an improved anti-reflective architectural or automotive glass. The glass may include a porous, nano-structured anti-reflective coating on at least one side of a glass product, including tempered or laminated glass. The porous, nano-structured anti-reflective coating may include pores i...
1. An automotive or architectural glass product, comprising: a first side and a second side, wherein the first side faces an exterior side of the automotive or architectural glass product and the second side faces an interior side of the automotive or architectural glass product; a first anti-reflective coating on the ...
The present disclosure relates to an improved anti-reflective architectural or automotive glass. The glass may include a porous, nano-structured anti-reflective coating on at least one side of a glass product, including tempered or laminated glass. The porous, nano-structured anti-reflective coating may include pores i...
1,700
340,955
341,829
16,754,330
1,784
A method and a device for obstacle or ground recognition and flight control, and an aircraft. The method for obstacle or ground recognition includes: determining point cloud data of a region in front of an aircraft; dividing the region in front into several subareas, determining an altitude of each of the subregions ba...
1. A method for obstacle or ground recognition, comprising the following acts performed by a device: determining point cloud data of a region in front of an aircraft; dividing the front region into several subregions, and determining an altitude of each of the subregions according to the point cloud data in each of the...
A method and a device for obstacle or ground recognition and flight control, and an aircraft. The method for obstacle or ground recognition includes: determining point cloud data of a region in front of an aircraft; dividing the region in front into several subareas, determining an altitude of each of the subregions ba...
1,700
340,956
341,830
16,754,333
1,784
An electronic device (12) in a cluster (10) that has the potential to serve as a new cluster head (36) receives cluster head assistance data from a current cluster head (36) device. The cluster head assistance data includes at least one data item related to establishment of operative communication with the wireless com...
1. A method of operating an electronic device to serve as a new cluster head of electronic devices, comprising: receiving cluster head assistance data from a current cluster head device, the cluster head assistance data comprising at least one data item related to establishment of operative communication with a wireles...
An electronic device (12) in a cluster (10) that has the potential to serve as a new cluster head (36) receives cluster head assistance data from a current cluster head (36) device. The cluster head assistance data includes at least one data item related to establishment of operative communication with the wireless com...
1,700
340,957
341,831
16,754,341
1,784
An apparatus for transmitting electrical energy to an electrical consumer, includes a transmitter device for transmitting an electrical energy having at least one first coil and a first capacitor for producing a resonant tank circuit at the transmitter device; at least one receiver device for receiving the energy trans...
1-8. (canceled) 9: An apparatus for transmitting electrical energy to at least one electrical consumer, the apparatus comprising: at least one transmitter for transmitting an electrical energy having at least one first coil and at least one first capacitor for producing a resonant tank circuit at the transmitter; at le...
An apparatus for transmitting electrical energy to an electrical consumer, includes a transmitter device for transmitting an electrical energy having at least one first coil and a first capacitor for producing a resonant tank circuit at the transmitter device; at least one receiver device for receiving the energy trans...
1,700
340,958
341,832
16,754,358
1,784
In one inventive concept, a product for modifying a cellulose-lignin material with siloxane includes a mixture having a siloxane species, a metal catalyst, and a nonpolar solvent. The mixture is operative to modify a cellulose-lignin material with siloxane upon wetting of the cellulose-lignin material with the mixture ...
1. A product for modifying a cellulose-lignin material with siloxane, the product comprising: a mixture, having a siloxane species, a metal catalyst, and a nonpolar solvent, the mixture being operative to modify a cellulose-lignin material with siloxane upon wetting of the cellulose-lignin material with the mixture and...
In one inventive concept, a product for modifying a cellulose-lignin material with siloxane includes a mixture having a siloxane species, a metal catalyst, and a nonpolar solvent. The mixture is operative to modify a cellulose-lignin material with siloxane upon wetting of the cellulose-lignin material with the mixture ...
1,700
340,959
341,833
16,754,351
1,784
A physiological feature of a subject is monitored by implanting a plurality of targets, such as magnets, and detecting at least one change in a physical property of the targets, followed by modifying a physiological feature of the subject in response to a change of state detected by the change in physical property dete...
1. A method for detecting a physical property of tissue, comprising the steps of: a) implanting a plurality of targets at a tissue; and b) employing an array of sensors to detect at least one state of the targets relative to each other, wherein the state of the targets is indicative of a physical property, thereby dete...
A physiological feature of a subject is monitored by implanting a plurality of targets, such as magnets, and detecting at least one change in a physical property of the targets, followed by modifying a physiological feature of the subject in response to a change of state detected by the change in physical property dete...
1,700
340,960
341,834
16,754,328
1,784
An electronic device is provided. The electronic device includes a camera, a communication interface, and a processor configured to capture an image of a background of a display device through the camera, to divide the captured image into a plurality of blocks, to compare a target gradation value with gradation values ...
1. An electronic device comprising: a camera; a communication interface; and a processor configured to capture an image of a background of a display device through the camera, to divide the captured image into a plurality of blocks, to compare a target gradation value with gradation values of the each of the plurality ...
An electronic device is provided. The electronic device includes a camera, a communication interface, and a processor configured to capture an image of a background of a display device through the camera, to divide the captured image into a plurality of blocks, to compare a target gradation value with gradation values ...
1,700
340,961
341,835
16,754,347
1,784
An assembled structure includes multiple first assembling units, each of the first assembling units comprising main body parts and connection parts, wherein the main body parts have a profile shape of a polygon having 6n equal-length sides, wherein n is a positive integer; and the connection parts are provided on each ...
1. An assembly structure, comprising: a plurality of first assembly units, wherein each of the plurality of first assembly units includes a main body portion and a connecting portion, an outline shape of the main body portion is a polygon with 6n equal sides, wherein “n” is a positive integer, the connecting portion is...
An assembled structure includes multiple first assembling units, each of the first assembling units comprising main body parts and connection parts, wherein the main body parts have a profile shape of a polygon having 6n equal-length sides, wherein n is a positive integer; and the connection parts are provided on each ...
1,700
340,962
341,836
16,754,346
3,752
A system for delivering a cooling agent to cooking appliance to aid in fire suppression is disclosed, which includes a fuel delivery path extending from a source of cooking fuel to a heating element of the cooking appliance, a source of cooling agent selectively in fluid communication with the fuel delivery path, and a...
1. A system for cooling a cooking appliance to aid in fire suppression, comprising: a fuel delivery path extending from a source of cooking fuel to a heating element of the cooking appliance; a source of cooling agent selectively in fluid communication with the fuel delivery path; and a valve assembly operatively assoc...
A system for delivering a cooling agent to cooking appliance to aid in fire suppression is disclosed, which includes a fuel delivery path extending from a source of cooking fuel to a heating element of the cooking appliance, a source of cooling agent selectively in fluid communication with the fuel delivery path, and a...
3,700
340,963
341,837
16,754,323
3,752
A method for manufacturing a semiconductor device comprises the steps of providing a semiconductor body with a main plane of extension, and forming a trench in the semiconductor body from a top side of the semiconductor body in a vertical direction which is perpendicular to the main plane of extension of the semiconduc...
1. A method for manufacturing a semiconductor device, the method comprising: providing a semiconductor body with a main plane of extension, forming a trench in the semiconductor body from a top side of the semiconductor body in a vertical direction which is perpendicular to the main plane of extension of the semiconduc...
A method for manufacturing a semiconductor device comprises the steps of providing a semiconductor body with a main plane of extension, and forming a trench in the semiconductor body from a top side of the semiconductor body in a vertical direction which is perpendicular to the main plane of extension of the semiconduc...
3,700
340,964
341,838
16,754,348
3,752
An apparatus for transmitting electrical energy to an electrical consumer, includes a transmitter device for transmitting an electrical energy having at least one first coil and a first capacitor for producing a resonant tank circuit at the transmitter device; at least one receiver device for receiving the energy trans...
1-8. (canceled) 9. An apparatus for transmitting electrical energy to at least one electrical consumer, the apparatus comprising: at least one transmitter for transmitting an electrical energy having at least one first coil and at least one first capacitor for producing a resonant tank circuit at the transmitter; at le...
An apparatus for transmitting electrical energy to an electrical consumer, includes a transmitter device for transmitting an electrical energy having at least one first coil and a first capacitor for producing a resonant tank circuit at the transmitter device; at least one receiver device for receiving the energy trans...
3,700
340,965
341,839
16,754,305
3,752
A cutting element (1) for a tool with an electrically conductive track (6) formed at a surface region. The cutting element (1) comprises a HPHT produced polycrystalline diamond body. The conductive track (6) comprises graphite such that the electrically conductive track (6) has an electrical resistance substantially lo...
1. A cutting element for a tool, the cutting element comprising: a high pressure-high temperature polycrystalline diamond body comprising a surface region; an electrically conductive track formed at the surface region, the conductive track comprising graphite, wherein the electrically conductive track has an electrical...
A cutting element (1) for a tool with an electrically conductive track (6) formed at a surface region. The cutting element (1) comprises a HPHT produced polycrystalline diamond body. The conductive track (6) comprises graphite such that the electrically conductive track (6) has an electrical resistance substantially lo...
3,700
340,966
341,840
16,754,317
3,752
There is provided a holographic security element including a substrate; and an array of nano-reflectors configured to form a pattern on the substrate and to generate a holographic image corresponding to the pattern at a predetermined distance from the substrate when irradiated with a predetermined light source. In part...
1. A holographic security element comprising: a substrate; and an array of nano-reflectors configured to form a pattern on the substrate and to generate a holographic image corresponding to the pattern at a predetermined distance from the substrate when irradiated with a predetermined light source, wherein the array of...
There is provided a holographic security element including a substrate; and an array of nano-reflectors configured to form a pattern on the substrate and to generate a holographic image corresponding to the pattern at a predetermined distance from the substrate when irradiated with a predetermined light source. In part...
3,700
340,967
341,841
16,754,362
3,752
Provided herein are coated substrates. Also provided herein are methods for attaching phosphonates, phosphonic acids, or derivatives thereof to an organic or an inorganic substrate (e.g., a metal oxide substrate) via phosphonate chemistry to form the coated substrates provided herein.
1. A coated substrate comprising Formula X, Formula Xb, or a combination of Formula X and Xb: 2. The coated substrate of claim 1, wherein J2 is —(CH2)2N(+)(CH3)3, —(CH2)6NH2, —(CH2)9COOH, —(CH2)6R4 or —(CH2)9R4. 3. The coated substrate of claim 1, wherein J2 is —(CH2)6R4. 4. The coated substrate of claim 1, wherein J2 ...
Provided herein are coated substrates. Also provided herein are methods for attaching phosphonates, phosphonic acids, or derivatives thereof to an organic or an inorganic substrate (e.g., a metal oxide substrate) via phosphonate chemistry to form the coated substrates provided herein.1. A coated substrate comprising Fo...
3,700
340,968
341,842
16,754,325
3,752
A method of tracking a user position using a crowd robot, a tag device, and a robot implementing the same are disclosed, and the robot includes a controller, which cumulatively stores position information of a tag device, generates a moving route corresponding to the stored position information of the tag device, and c...
1. A robot tracking a user position using a crowd robot, the robot comprising: a positioning sensor configured to receive a signal based on a first protocol from a tag device to calculate a position of the tag device; a Bluetooth module configured to receive a signal based on a second protocol from the tag device; an o...
A method of tracking a user position using a crowd robot, a tag device, and a robot implementing the same are disclosed, and the robot includes a controller, which cumulatively stores position information of a tag device, generates a moving route corresponding to the stored position information of the tag device, and c...
3,700
340,969
341,843
16,754,326
3,752
A control unit that controls a motor includes a semiconductor device, the semiconductor device includes a semiconductor package including a plurality of first electrodes, a wiring board including a plurality of second electrodes arranged so as to correspond to each of the plurality of first electrodes, and solder joint...
1. An electronic control unit comprising a control unit that controls a motor, wherein the control unit includes a semiconductor device, the semiconductor device includes: a semiconductor package including a plurality of first electrodes; a wiring board including a plurality of second electrodes arranged so as to corre...
A control unit that controls a motor includes a semiconductor device, the semiconductor device includes a semiconductor package including a plurality of first electrodes, a wiring board including a plurality of second electrodes arranged so as to correspond to each of the plurality of first electrodes, and solder joint...
3,700
340,970
341,844
16,754,321
3,752
A method for ascertaining emissions of a motor vehicle driven with the aid of an internal combustion engine in a practical driving operation. A machine learning system is trained to generate time curves of the operating variables with the aid of measured time curves of operating variables of the motor vehicle and/or of...
1-17. (canceled) 18. A method for ascertaining emissions of a motor vehicle driven using an internal combustion engine in a practical driving operation, the method comprising the following steps: training a machine learning system to generate time curves using measured time curves of the operating variables of the inte...
A method for ascertaining emissions of a motor vehicle driven with the aid of an internal combustion engine in a practical driving operation. A machine learning system is trained to generate time curves of the operating variables with the aid of measured time curves of operating variables of the motor vehicle and/or of...
3,700
340,971
341,845
16,754,340
3,752
A misalignment sensing system for a molding structure and a method for using same. The molding structure includes a first component and a second component, at least one of the components being selectively repositionable between a closed configuration of the mold structure and an open configuration of the mold structure...
1. A misalignment sensing system for a molding structure, the molding structure being positionable in use in a mold for producing molded articles, the molding structure including a first component and a second component, at least one of the first component and the second component being selectively repositionable betwe...
A misalignment sensing system for a molding structure and a method for using same. The molding structure includes a first component and a second component, at least one of the components being selectively repositionable between a closed configuration of the mold structure and an open configuration of the mold structure...
3,700
340,972
341,846
16,754,316
3,752
The disclosure provides a liquid crystal antenna including: a first substrate; a second substrate facing the first substrate; a third substrate facing the second substrate such that the second substrate is between the first substrate and the third substrate; a liquid crystal layer between the first substrate and the se...
1. A liquid crystal antenna, comprising: a first substrate; a second substrate facing the first substrate; a third substrate facing the second substrate such that the second substrate is between the first substrate and the third substrate; a liquid crystal layer between the first substrate and the second substrate; a t...
The disclosure provides a liquid crystal antenna including: a first substrate; a second substrate facing the first substrate; a third substrate facing the second substrate such that the second substrate is between the first substrate and the third substrate; a liquid crystal layer between the first substrate and the se...
3,700
340,973
341,847
16,754,365
3,752
A helmet includes a first sensor for detecting biological information of a wearer, a second sensor for detecting environment information around the wearer, and a controller configured to acquire the biological information and the environment information from the first sensor and the second sensor, respectively. The con...
1. A helmet comprising: a first sensor for detecting biological information of a wearer; a second sensor for detecting environment information around the wearer; and a controller configured to acquire the biological information and the environment information from the first sensor and the second sensor, respectively, w...
A helmet includes a first sensor for detecting biological information of a wearer, a second sensor for detecting environment information around the wearer, and a controller configured to acquire the biological information and the environment information from the first sensor and the second sensor, respectively. The con...
3,700
340,974
341,848
16,754,364
3,752
A vehicle includes an information acquisition unit configured to acquire a movement of a body of a driver; and a controller configured to determine whether the movement of the body of the driver acquired by the information acquisition unit is a normal pattern of the driver.
1. A vehicle comprising: an information acquisition unit configured to acquire a movement of a body of a driver; and a controller configured to determine whether the movement of the body of the driver acquired by the information acquisition unit is a normal pattern of the driver. 2. The vehicle according to claim 1, fu...
A vehicle includes an information acquisition unit configured to acquire a movement of a body of a driver; and a controller configured to determine whether the movement of the body of the driver acquired by the information acquisition unit is a normal pattern of the driver.1. A vehicle comprising: an information acquis...
3,700
340,975
341,849
16,754,339
3,752
A dedicated network gateway device that is capable of bridging, switching or routing network traffic between traditional network and direct interconnect networks, comprising: a first set of one or more traditional network ports with a single link per port generally comprising one or more of SFP+, QSFP, and QSFP+ connec...
1. A dedicated network gateway device that is capable of bridging, switching or routing network traffic between traditional and direct interconnect networks, comprising: a first set of at least one traditional network ports with a single link per port and a second set of at least one direct interconnect ports with at l...
A dedicated network gateway device that is capable of bridging, switching or routing network traffic between traditional network and direct interconnect networks, comprising: a first set of one or more traditional network ports with a single link per port generally comprising one or more of SFP+, QSFP, and QSFP+ connec...
3,700
340,976
341,850
16,841,682
1,777
A portable water filtration system that is configured to provide potable water from a contaminated water source. The portable water filtration system includes a pre-treatment module and a polishing module that are fluidly coupled and contained within a stackable housing configuration. The pre-treatment module has dispo...
1. A portable water filtration system configured to create potable water from a contaminated water source comprising: a pre-treatment module, said pre-treatment module having a housing, said housing configured to provide access to an interior volume of said housing, said pre-treatment module having disposed in said int...
A portable water filtration system that is configured to provide potable water from a contaminated water source. The portable water filtration system includes a pre-treatment module and a polishing module that are fluidly coupled and contained within a stackable housing configuration. The pre-treatment module has dispo...
1,700
340,977
341,851
16,754,357
1,654
The present invention relates to variants of porcine granulocyte colony stimulating factor (pG-CSF). The pG-CSF variants are useful in treating preventing or reducing the incidence of bacterial infections in swine. Methods of treating swine are disclosed.
1. A porcine granulocyte colony stimulating factor (pG-CSF) variant consisting of a sequence of: X1PLSPASSLPQSFLLKX2LEQVRKIQADGAELQERLCATHKLC(pAF)PQELVLLGHSLGL PQASLSSCSSQALQLTGCLNQLHGGLVLYQGLLQALAGISPELAPALDILQLDVTDLATN IWLQX3EDLRX3APASLPTQGTVPTFTSAFQRRAGGVLVVSQLQSFLELAYRVLRYLAEP (SEQ ID NO: 13); wherein X1 is selecte...
The present invention relates to variants of porcine granulocyte colony stimulating factor (pG-CSF). The pG-CSF variants are useful in treating preventing or reducing the incidence of bacterial infections in swine. Methods of treating swine are disclosed.1. A porcine granulocyte colony stimulating factor (pG-CSF) varia...
1,600
340,978
341,852
16,754,361
1,654
A vibration damping system for injection systems of motor vehicles includes an actively controllable actuator element, which is situated at a component of the injection system. The actuator element is situated at the component in such a way that, during operation of the injection system a vibration reduction of the inj...
1-10. (canceled) 11. A vibration damping system for an injection system of a motor vehicle, comprising: at least one actively controllable actuator element which is situated at a component of the injection system, the actuator element being situated at the component in such a way that, during operation of the injection...
A vibration damping system for injection systems of motor vehicles includes an actively controllable actuator element, which is situated at a component of the injection system. The actuator element is situated at the component in such a way that, during operation of the injection system a vibration reduction of the inj...
1,600
340,979
341,853
16,754,345
1,654
A first comparator compares first input data with second input data, and provides one when the first input data is larger than the second input data and zero when the first input data is equal to or smaller than the second input data as a first comparison result. A data generator generates data based on the second inpu...
1. A data processing apparatus comprising: a first comparator configured to compare first input data with second input data, and to provide one when the first input data is larger than the second input data and zero when the first input data is equal to or smaller than the second input data as a first comparison result...
A first comparator compares first input data with second input data, and provides one when the first input data is larger than the second input data and zero when the first input data is equal to or smaller than the second input data as a first comparison result. A data generator generates data based on the second inpu...
1,600
340,980
341,854
16,754,366
1,654
Disclosed is a vehicle display system (1) for displaying an image of surroundings of a vehicle. The vehicle display system (1) includes: a display (18a) configured to display an image thereon; a camera (4, 6, 8, 10) mounted on the vehicle and configured to image surroundings of the vehicle; and a display control unit (...
1. A vehicle display system for displaying an image of surroundings of a vehicle, comprising: a display configured to display an image thereon; a camera mounted on the vehicle and configured to image surroundings of the vehicle; and a display controller configured to subject an image captured by the camera to mask proc...
Disclosed is a vehicle display system (1) for displaying an image of surroundings of a vehicle. The vehicle display system (1) includes: a display (18a) configured to display an image thereon; a camera (4, 6, 8, 10) mounted on the vehicle and configured to image surroundings of the vehicle; and a display control unit (...
1,600
340,981
341,855
16,841,686
1,654
A LED driving apparatus with clock embedded cascaded LED drivers is introduced, including: a plurality of LED drivers, wherein the first stage LED driver receives an original display data signal and outputs a first display data signal, the Nth stage LED driver receives a (N−1)th display data signal and outputs a Nth di...
1. A Light-emitting diode (LED) driving apparatus, comprising: a plurality of LED drivers, wherein the first stage LED driver receives an original display data signal and outputs a first display data signal, the Nth stage LED driver receives a (N−1)th display data signal and outputs a Nth display data signal, and N is ...
A LED driving apparatus with clock embedded cascaded LED drivers is introduced, including: a plurality of LED drivers, wherein the first stage LED driver receives an original display data signal and outputs a first display data signal, the Nth stage LED driver receives a (N−1)th display data signal and outputs a Nth di...
1,600
340,982
341,856
16,754,354
1,654
A corrugated tube with a plurality of wave valleys and wave crests, which are alternately arranged in a longitudinal direction of the corrugated tube, and a plurality of wave flanks, which connect the wave valleys and the wave crests to each other, wherein each wave flank comprises a first wave flank section, a second ...
1. Corrugated tube comprising: a plurality of wave valleys and wave crests, which are alternately arranged in a longitudinal direction of the corrugated tube, and comprises a plurality of wave flanks, which connect the wave valleys and the wave crests to each other, wherein each wave flank comprises a first wave flank ...
A corrugated tube with a plurality of wave valleys and wave crests, which are alternately arranged in a longitudinal direction of the corrugated tube, and a plurality of wave flanks, which connect the wave valleys and the wave crests to each other, wherein each wave flank comprises a first wave flank section, a second ...
1,600
340,983
341,857
16,754,360
1,654
A radio resource configuration method, a base station and a UE are provided. The radio resource configuration method includes: acquiring an arrival time of each data packet; acquiring a delivery time or a reception time of each data packet; calculating an average delay of downlink data packets within a time period or a...
1. A radio resource configuration method applied for a base station, comprising: acquiring an arrival time of each data packet, the arrival time comprising a time when the data packet arrives at a Service Data Adaptation Protocol (SDAP) layer, a time when the data packet arrives at a Packet Data Convergence Protocol (P...
A radio resource configuration method, a base station and a UE are provided. The radio resource configuration method includes: acquiring an arrival time of each data packet; acquiring a delivery time or a reception time of each data packet; calculating an average delay of downlink data packets within a time period or a...
1,600
340,984
341,858
16,754,359
1,765
A surface modifying composition for modifying a surface of a formed product made of high-density polyethylene or ultra-high molecular weight polyethylene, the composition comprising:
1. A surface modifying composition for modifying a surface of a formed product made of high-density polyethylene or ultra-high molecular weight polyethylene, the composition comprising: a copolymer having a unit of a first monomer having an aliphatic group having 10 or more carbon atoms and a unit of a second monomer h...
A surface modifying composition for modifying a surface of a formed product made of high-density polyethylene or ultra-high molecular weight polyethylene, the composition comprising:1. A surface modifying composition for modifying a surface of a formed product made of high-density polyethylene or ultra-high molecular w...
1,700
340,985
341,859
16,754,352
1,759
The present application describes apparatus (100) for colouring an additively manufactured polymer part, comprising a chamber (106) for locating at least one additively manufactured polymer part (105) to be coloured, a first reservoir (102) for containing dye pigment particles to be suspended in a gas, and fluidly coup...
1. Apparatus for colouring an additively manufactured polymer part, comprising: a chamber for locating at least one additively manufactured polymer part to be coloured; a first reservoir for containing dye pigment particles to be suspended in a gas, and fluidly coupled to the chamber; a second reservoir for containing ...
The present application describes apparatus (100) for colouring an additively manufactured polymer part, comprising a chamber (106) for locating at least one additively manufactured polymer part (105) to be coloured, a first reservoir (102) for containing dye pigment particles to be suspended in a gas, and fluidly coup...
1,700
340,986
341,860
16,841,678
2,835
Disclosed is system, method, and rack stand portion for the advantageous cooling of computer equipment. Computer equipment is disclosed for placement in racks paired with cartridges suited to retain and aid in the cooling of the computer equipment. In other embodiments multiple cartridges are made available for known c...
1. A server rack stand kit, said kit comprising: a vertical support post having a computer support surface, and having a post height and an interior cavity; wherein said vertical support post includes multiple computer support surface slots; a substantially-sealed commercial off-the-shelf (COTS) computer of a first typ...
Disclosed is system, method, and rack stand portion for the advantageous cooling of computer equipment. Computer equipment is disclosed for placement in racks paired with cartridges suited to retain and aid in the cooling of the computer equipment. In other embodiments multiple cartridges are made available for known c...
2,800
340,987
341,861
16,754,338
2,835
A surrounding information obtaining unit determines whether a first vehicle has traveled on a different road than a road on which a host vehicle travels, on the basis of information indicating roads and a facility present around the host vehicle and a travel state of the first vehicle. A difference checking unit checks...
1. A map updating device comprising: a processor to execute a program; and a memory to store the program which, when executed by the processor, performs processes of, obtaining information indicating roads and a facility present around a host vehicle and a travel state of a first vehicle; determining whether the first ...
A surrounding information obtaining unit determines whether a first vehicle has traveled on a different road than a road on which a host vehicle travels, on the basis of information indicating roads and a facility present around the host vehicle and a travel state of the first vehicle. A difference checking unit checks...
2,800
340,988
341,862
16,754,277
2,835
A machine for conveying objects, including: a base; a turret mounted to the base for rotation about an axis, the turret including a turret mounted track, and a turret shuttle with a gripper to grip an object, the turret shuttle mounted on the turret mounted track; a boom mounted to the turret, whereby turret rotation s...
1) A machine for conveying objects, the machine including: a) a base; b) a turret mounted to the base for rotation about an axis, the turret including: i) a turret mounted track extending between the base and a position proximate a boom mounting; and, ii) a turret shuttle with a gripper to grip an object, the turret sh...
A machine for conveying objects, including: a base; a turret mounted to the base for rotation about an axis, the turret including a turret mounted track, and a turret shuttle with a gripper to grip an object, the turret shuttle mounted on the turret mounted track; a boom mounted to the turret, whereby turret rotation s...
2,800
340,989
341,863
16,841,679
2,835
Disclosed is system, method, and rack stand portion for the advantageous cooling of computer equipment. When multiple instances of computer equipment are managed from a central authority, cooling, heating, and/or cessation of either can be controlled in a way that enhances efficiency. Impediments that control access ch...
1. A process for interacting with a server rack stand, said method comprising: in a server rack stand comprising an interior void bifurcated into a cool chamber and an exhaust chamber bearing a substantially-sealed computer server case having a conduit adapted to permit gaseous communication between said cool chamber a...
Disclosed is system, method, and rack stand portion for the advantageous cooling of computer equipment. When multiple instances of computer equipment are managed from a central authority, cooling, heating, and/or cessation of either can be controlled in a way that enhances efficiency. Impediments that control access ch...
2,800
340,990
341,864
16,841,700
2,828
A 3D memory device includes a substrate, stacked structures formed on the substrate, common source line (CSL) contacts, and NOR flash memories. The substrate has CSLs and memory cell regions alternately arranged along one direction in parallel. The stacked structures are located on the memory cell regions and include a...
1. A 3D memory device, comprising: a substrate having a plurality of common source lines (CSLs) and a plurality of memory cell regions alternately arranged along a first direction in parallel; a plurality of stacked structures formed on the plurality of memory cell regions of the substrate, and each of the stacked stru...
A 3D memory device includes a substrate, stacked structures formed on the substrate, common source line (CSL) contacts, and NOR flash memories. The substrate has CSLs and memory cell regions alternately arranged along one direction in parallel. The stacked structures are located on the memory cell regions and include a...
2,800
340,991
341,865
16,754,367
1,617
The present invention relates to hydrogel beads having liquid crystalline structured phase. Process for preparing crystalline hydrogel beads is also an object of the invention. Perfuming compositions and consumer products comprising or consisting of said crystalline beads, in particular perfumed consumer products in th...
1. An hydrogel bead obtainable by a process comprising the steps of: (i) preparing a continuous phase comprising water and a biopolymer; (ii) preparing an internal phase comprising a hydrophobic active ingredient, preferably a perfume oil or a flavor oil, (iii) mixing the continuous phase and the internal phase to form...
The present invention relates to hydrogel beads having liquid crystalline structured phase. Process for preparing crystalline hydrogel beads is also an object of the invention. Perfuming compositions and consumer products comprising or consisting of said crystalline beads, in particular perfumed consumer products in th...
1,600
340,992
341,866
16,841,684
1,617
A rod-type photonic crystal fiber amplifier includes a signal coupling lens, a first dichroic mirror, a first hollow pump coupling lens, and a rod-type photonic crystal fiber. The rod-type photonic crystal fiber comprises a core and a cladding, wherein signal light is coupled into the core of the rod-type photonic crys...
1. A rod-type photonic crystal fiber amplifier, comprising: a signal coupling lens, a first dichroic mirror, a first hollow pump coupling lens and a rod-type photonic crystal fiber, wherein the signal coupling lens is configured to focus a signal light to obtain an optical path, and the first dichroic mirror, the first...
A rod-type photonic crystal fiber amplifier includes a signal coupling lens, a first dichroic mirror, a first hollow pump coupling lens, and a rod-type photonic crystal fiber. The rod-type photonic crystal fiber comprises a core and a cladding, wherein signal light is coupled into the core of the rod-type photonic crys...
1,600
340,993
341,867
16,841,698
2,851
A method for adjusting a coil position includes: acquiring position offset indication information between a transmitting coil in a power transmitting device and a receiving coil in a power receiving device; wherein the power transmitting device is configured to wirelessly charge the power receiving device, and the posi...
1. A method for adjusting a coil position, applied to a power transmitting device, the method comprising: acquiring position offset indication information between a transmitting coil in the power transmitting device and a receiving coil in a power receiving device; wherein the power transmitting device is configured to...
A method for adjusting a coil position includes: acquiring position offset indication information between a transmitting coil in a power transmitting device and a receiving coil in a power receiving device; wherein the power transmitting device is configured to wirelessly charge the power receiving device, and the posi...
2,800
340,994
341,868
16,841,699
2,851
A method for adjusting a coil position includes: acquiring position offset indication information between a transmitting coil in a power transmitting device and a receiving coil in a power receiving device; wherein the power transmitting device is configured to wirelessly charge the power receiving device, and the posi...
1. A method for adjusting a coil position, applied to a power transmitting device, the method comprising: acquiring position offset indication information between a transmitting coil in the power transmitting device and a receiving coil in a power receiving device; wherein the power transmitting device is configured to...
A method for adjusting a coil position includes: acquiring position offset indication information between a transmitting coil in a power transmitting device and a receiving coil in a power receiving device; wherein the power transmitting device is configured to wirelessly charge the power receiving device, and the posi...
2,800
340,995
341,869
16,841,709
2,851
A foldable bed includes a first bed unit, a second bed unit rotatably connected to the first bed unit such that the bed is rotatable between a folded state and an unfolded state, and a stop unit arranged between the first bed unit and the second bed unit for preventing the first bed unit and the second bed unit from ro...
1. A foldable bed, comprising: a support member comprising a first support bracket and a second support bracket; and a platform for supporting a load, the platform comprising a first platform part supported on the first support bracket and a second platform part supported on the second support bracket, wherein the firs...
A foldable bed includes a first bed unit, a second bed unit rotatably connected to the first bed unit such that the bed is rotatable between a folded state and an unfolded state, and a stop unit arranged between the first bed unit and the second bed unit for preventing the first bed unit and the second bed unit from ro...
2,800
340,996
341,870
16,841,694
2,851
A method for fabricating semiconductor device includes the steps of: providing a substrate having a memory region and a periphery region; forming a first trench and a second trench in substrate on the memory region, in which a width of the second trench is greater than a width of the first trench; forming a first liner...
1. A method for fabricating semiconductor device, comprising: providing a substrate having a memory region and a periphery region; forming a first trench and a second trench in substrate on the memory region, wherein a width of the second trench is greater than a width of the first trench; forming a first liner in the ...
A method for fabricating semiconductor device includes the steps of: providing a substrate having a memory region and a periphery region; forming a first trench and a second trench in substrate on the memory region, in which a width of the second trench is greater than a width of the first trench; forming a first liner...
2,800
340,997
341,871
16,841,689
2,851
An electrostatic-image developing toner includes toner particles, layered compound particles, and a free oil. The mass ratio Ma/Mb of the content Ma of the layered compound particles to the content Mb of the free oil is 0.05 or more and 100 or less.
1. An electrostatic-image developing toner comprising: toner particles; layered compound particles; and a free oil, wherein a mass ratio Ma/Mb of a content Ma of the layered compound particles to a content Mb of the free oil is 0.05 or more and 100 or less. 2. The electrostatic-image developing toner according to claim...
An electrostatic-image developing toner includes toner particles, layered compound particles, and a free oil. The mass ratio Ma/Mb of the content Ma of the layered compound particles to the content Mb of the free oil is 0.05 or more and 100 or less.1. An electrostatic-image developing toner comprising: toner particles;...
2,800
340,998
341,872
16,841,717
2,851
Disclosed are methods and apparatuses for mitigating the formation of concentrated wake vortex structures generated from lifting or thrust-generating bodies and maneuvering control surfaces wherein the use of contour surface geometries promotes vortex-mixing of high and low flow fluids. The methods and apparatuses can ...
1. A lifting or thrust-generating body or control surface having geometry that promotes vortex-mixing for mitigating the formation of concentrated wake vortex structures generated by such body or surface, comprising: a lifting or thrust-generating body or control surface having oscillatory variations in chord length al...
Disclosed are methods and apparatuses for mitigating the formation of concentrated wake vortex structures generated from lifting or thrust-generating bodies and maneuvering control surfaces wherein the use of contour surface geometries promotes vortex-mixing of high and low flow fluids. The methods and apparatuses can ...
2,800
340,999
341,873
16,754,315
2,851
A washing machine and an operating method thereof are disclosed. A washing machine according to an embodiment of the present invention comprises: a washing tub; a touch screen for outputting a graphical object corresponding to a washing-related function which can be performed by the washing tub; a detergent supplying u...
1. A washing machine, comprising: a washing tub configured to receive laundry; a touch screen configured to output one or more graphic objects corresponding to an operation related to washing in the washing tub; a detergent supply that defines an inner space configured to accommodate a laundry detergent and that is con...
A washing machine and an operating method thereof are disclosed. A washing machine according to an embodiment of the present invention comprises: a washing tub; a touch screen for outputting a graphical object corresponding to a washing-related function which can be performed by the washing tub; a detergent supplying u...
2,800