Entry stringlengths 6 10 | Entry Name stringlengths 5 11 | Sequence stringlengths 2 35.2k | EC number stringlengths 7 118 ⌀ | Cofactor stringlengths 38 1.77k ⌀ | Gene Ontology (biological process) stringlengths 18 11.3k ⌀ | Gene Ontology (cellular component) stringlengths 17 1.75k ⌀ | Gene Ontology (molecular function) stringlengths 24 2.09k ⌀ | Pfam stringlengths 8 232 ⌀ | Gene3D stringlengths 10 250 ⌀ | Protein families stringlengths 9 237 ⌀ | Post-translational modification stringlengths 16 8.52k ⌀ | Subcellular location [CC] stringlengths 29 6.18k ⌀ | Catalytic activity stringlengths 64 35.7k ⌀ | Kinetics stringlengths 69 11.7k ⌀ | Pathway stringlengths 27 908 ⌀ | pH dependence stringlengths 64 955 ⌀ | Temperature dependence stringlengths 70 1.16k ⌀ | Function [CC] stringlengths 17 15.3k ⌀ | Organism stringlengths 8 196 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
P0C5D6 | SAPK3_ORYSJ | MEERYEALKELGAGNFGVARLVRDKRSKELVAVKYIERGKKIDENVQREIINHRSLRHPNIIRFKEVCLTPTHLAIVMEYAAGGELFEQICTAGRFSEDEARYFFQQLISGVSYCHSLEICHRDLKLENTLLDGSPTPRVKICDFGYSKSALLHSKPKSTVGTPAYIAPEVLSRKEYDGKVADVWSCGVTLYVMLVGSYPFEDPGDPRNFRKTISRILGVQYSIPDYVRVSSDCRRLLSQIFVADPSKRITIPEIKKHTWFLKNLPKEISEREKADYKDTDAAPPTQAVEEIMRIIQEAKVPGDMAAADPALLAELAELK... | 2.7.11.1 | null | abscisic acid-activated signaling pathway [GO:0009738]; intracellular signal transduction [GO:0035556]; phosphorylation [GO:0016310] | cytoplasm [GO:0005737]; nucleus [GO:0005634] | ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00069; | 1.10.510.10; | Protein kinase superfamily, Ser/Thr protein kinase family | PTM: Autophosphorylated in presence of Ca(2+). | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|Ref.3}. Nucleus {ECO:0000269|Ref.3}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: May play a role in signal transduction of hyperosmotic response. | Oryza sativa subsp. japonica (Rice) |
P0C5E2 | LRL12_ARATH | MNPSTPSLLYTSIFFYFTIIATQTLSLDPKFKACEPKSCGKGPQISYPFYLSGKQESFCGYPSFELTCDDEEKLPVLGISGEEYVIKNISYLTQSFQVVNSKASHDPCPRPLNNLTLHRTPFFVNPSHINFTILYNCSDHLLEDFRTYPLTCARNTSLLRSFGVFDRKKLGKEKQIASMSCQKLVDVPVLASNESDVMGMTYVEILKRGFVLNWTANSCFRCITSGGRCGTDQQEFVCLCPDGPKLHDTCTNGKNDKRRRVIVKVLIGASAAVVGLIAASIFWYVYHRRKTKSYRNSSALLPRNISSDPSAKSFDIEKAE... | 2.7.11.1 | null | cellular response to abscisic acid stimulus [GO:0071215]; cellular response to water deprivation [GO:0042631]; phosphorylation [GO:0016310]; photoperiodism, flowering [GO:0048573] | plasma membrane [GO:0005886] | ATP binding [GO:0005524]; polysaccharide binding [GO:0030247]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF13947;PF07714;PF14380; | 1.10.510.10; | Protein kinase superfamily, Ser/Thr protein kinase family | null | SUBCELLULAR LOCATION: [Isoform 1]: Cell membrane {ECO:0000269|PubMed:25510357}; Single-pass type I membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Isoform 2]: Membrane {ECO:0000255}; Single-pass type I membrane protein {ECO:0000305}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: Probable receptor-like serine/threonine-protein kinase involved in abscisic acid (ABA) signaling. Acts as a positive regulator of abiotic stress response. {ECO:0000269|PubMed:25533478}. | Arabidopsis thaliana (Mouse-ear cress) |
P0C5E3 | PALLD_RAT | PEEICTLVIAESFPEDAGIFTCSARNDYGSVTSTAQLVVTSANTENCSYDSMGEPNSDHFQHFPPPPPILETGSYELASQKPSEIQQVNTPNLGFNMAALQMQFNSAERETNGVHPSHGVNGLINGKAYGNKSPPTPAALLSPTKEPPPLLAKPKLGFPKKASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSANVFNIQEPEETAANQEYKVSSCEQRLISEIEYRLERSPVEESGDEVQEAEVPVENAAAPFFEMKLKHYKIFEGMPVTFTCRVAGSPKPKIYWFKDGKQISP... | null | null | actin cytoskeleton organization [GO:0030036]; cell migration [GO:0016477]; cellular response to hypoxia [GO:0071456]; epithelial cell morphogenesis [GO:0003382]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; keratinocyte development [GO:0003334]; neuron projection development [GO:0031175... | actin filament [GO:0005884]; axon [GO:0030424]; axonal growth cone [GO:0044295]; cytoskeleton [GO:0005856]; excitatory synapse [GO:0060076]; filopodium [GO:0030175]; focal adhesion [GO:0005925]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; plasma membrane ... | actin binding [GO:0003779]; axon guidance receptor activity [GO:0008046]; cytoskeletal protein binding [GO:0008092] | PF07679; | 2.60.40.10; | Myotilin/palladin family | PTM: Phosphorylated predominantly on serines and, to a lesser extent, on tyrosines. Phosphorylation at Ser-395 by PKB/AKT1 modulates cytoskeletal organization and cell motility (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000269|PubMed:16125169, ECO:0000269|PubMed:16868024}. Cell junction, focal adhesion {ECO:0000250|UniProtKB:Q8WX93}. Cytoplasm, myofibril, sarcomere, Z line {ECO:0000269|PubMed:11553711, ECO:0000269|PubMed:16125169}. Cell projection, ruffle {ECO:0000269|PubMed:16868024... | null | null | null | null | null | FUNCTION: Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization an... | Rattus norvegicus (Rat) |
P0C5E4 | PTPRQ_MOUSE | MDFLFFFLFSLIGTSESQVDVSGSFDDTVYDITLSSISATTYSSPVSRTLATNVSKPGPPVFLAGERVGSAGILLSWNTPPNPNGRIISYVVKYKEVCPWMQTAYTRVRAKPDSLEVLLTNLNPGTTYEIKVAAENSAGIGVFSDPFLFQTAESAPGKVVNLTVEALNYSAVNLIWYLPRQPNGKITSFKISVKHARSGIVVKDVSIKVEDLLSGKLPECNENSDSFLWSTTSPSPTLSRATPPLRTTHLSNTLARNKISSVWKEPISFVVTHLRPYTTYLFEVSAVTTEAGYIDSTIVRTPESVPEGPPQNCITGNVTG... | 3.1.3.-; 3.1.3.48 | null | dephosphorylation [GO:0016311]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; hematopoietic progenitor cell differentiation [GO:0002244]; inner ear morphogenesis [GO:0042472]; neuromuscular process controlling balance [GO:0050885]; regulation of fat cell differentiation [GO:0045... | apical plasma membrane [GO:0016324]; receptor complex [GO:0043235]; stereocilium base [GO:0120044]; stereocilium bundle [GO:0032421] | protein tyrosine phosphatase activity [GO:0004725] | PF00041;PF00102; | 2.60.40.10;3.90.190.10; | Protein-tyrosine phosphatase family, Receptor class 2A subfamily | null | SUBCELLULAR LOCATION: Cell projection, stereocilium {ECO:0000269|PubMed:24285636, ECO:0000269|PubMed:37952086}. Apical cell membrane {ECO:0000269|PubMed:24285636}; Single-pass type I membrane protein {ECO:0000255}. Basal cell membrane {ECO:0000250|UniProtKB:Q9UMZ3}; Single-pass type I membrane protein {ECO:0000255}. No... | CATALYTIC ACTIVITY: Reaction=H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate; Xref=Rhea:RHEA:10684, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620; EC=3.1.3.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU10044}; | null | null | null | null | FUNCTION: Phosphatidylinositol phosphatase required for auditory function. May act by regulating the level of phosphatidylinositol 4,5-bisphosphate (PIP2) level in the basal region of hair bundles. Can dephosphorylate a broad range of phosphatidylinositol phosphates, including phosphatidylinositol 3,4,5-trisphosphate a... | Mus musculus (Mouse) |
P0C5H5 | GAOX2_ORYSI | MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPEPFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHGVDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAF... | 1.14.11.- | COFACTOR: Name=Fe cation; Xref=ChEBI:CHEBI:24875; COFACTOR: Name=L-ascorbate; Xref=ChEBI:CHEBI:38290; | flower development [GO:0009908]; gibberellin biosynthetic process [GO:0009686]; response to light stimulus [GO:0009416]; unidimensional cell growth [GO:0009826] | null | gibberellin 20-oxidase activity [GO:0045544]; metal ion binding [GO:0046872] | PF03171;PF14226; | null | Iron/ascorbate-dependent oxidoreductase family, GA20OX subfamily | null | null | CATALYTIC ACTIVITY: Reaction=2 2-oxoglutarate + gibberellin A12 + H(+) + 3 O2 = 3 CO2 + gibberellin A9 + 2 H2O + 2 succinate; Xref=Rhea:RHEA:60772, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:16526, ChEBI:CHEBI:16810, ChEBI:CHEBI:30031, ChEBI:CHEBI:58627, ChEBI:CHEBI:73255; Evidence={ECO:000025... | null | null | null | null | FUNCTION: Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA53 to GA20 via a three-step oxidation at C-20 of the GA skeleton. {ECO:0000269|PubMed:11961544}. | Oryza sativa subsp. indica (Rice) |
P0C5H6 | TUTLA_RAT | MIWCLRLTILSLILSQGADGRRKPEVVSVVGRAGESAVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRLQTGASLQIEGLRVEDQGWYECRVLFLDQHSPEQDFANGSWVHLTVNSPPQFQETPPLVLEVKELEAVTLRCVALGSPQPYVTWKFRGQDLGKGQGQVQVRNGTLWIRRVERGSAGDYTCQASSTEGSVTHTTQLLVLGPPVIVVPPNNNTVNASQDVSLACRAEAYPANLTYSWFQDRINVFHISRLQSRVRILVDGSLWLQATQPDDAGHYTCVPSNGFPHPPSASAYLTVL... | null | null | dendrite development [GO:0016358]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; regulation of synapse organization [GO:0050807] | axon [GO:0030424]; dendrite [GO:0030425]; inhibitory synapse [GO:0060077]; neuron projection [GO:0043005]; plasma membrane [GO:0005886] | cell-cell adhesion mediator activity [GO:0098632] | PF00041;PF07679;PF13927; | 2.60.40.10; | Immunoglobulin superfamily, Turtle family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:15340156}; Single-pass type I membrane protein {ECO:0000269|PubMed:15340156}. Synapse {ECO:0000269|PubMed:15340156}. Note=Enriched at the excitatory synapses in mature neurons. | null | null | null | null | null | FUNCTION: Functions in dendrite outgrowth and synapse maturation. {ECO:0000269|PubMed:15340156, ECO:0000269|PubMed:15340157}. | Rattus norvegicus (Rat) |
P0C5I2 | GMPPB_PIG | MKALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALASAGVDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETAEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGKNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVCWRCRVGQWVRM... | 2.7.7.13 | null | GDP-mannose biosynthetic process [GO:0009298]; protein glycosylation [GO:0006486] | cytoplasm [GO:0005737] | GTP binding [GO:0005525]; mannose-1-phosphate guanylyltransferase (GTP) activity [GO:0004475] | PF00132;PF00483; | 2.160.10.10; | Transferase hexapeptide repeat family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9Y5P6}. | CATALYTIC ACTIVITY: Reaction=alpha-D-mannose 1-phosphate + GTP + H(+) = diphosphate + GDP-alpha-D-mannose; Xref=Rhea:RHEA:15229, ChEBI:CHEBI:15378, ChEBI:CHEBI:33019, ChEBI:CHEBI:37565, ChEBI:CHEBI:57527, ChEBI:CHEBI:58409; EC=2.7.7.13; Evidence={ECO:0000269|PubMed:11082198}; | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.2 mM for mannose-1-phosphate {ECO:0000269|PubMed:11082198}; KM=0.36 mM for GTP {ECO:0000269|PubMed:11082198}; KM=39 nM for GDP-mannose {ECO:0000269|PubMed:11082198}; Vmax=0.56 mmol/min/mg enzyme toward mannose-1-phosphate {ECO:0000269|PubMed:11082198}; Vmax=14 nm... | PATHWAY: Nucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; GDP-alpha-D-mannose from alpha-D-mannose 1-phosphate (GTP route): step 1/1. {ECO:0000269|PubMed:11082198}. | null | null | FUNCTION: Catalyzes the formation of GDP-mannose, an essential precursor of glycan moieties of glycoproteins and glycolipids. {ECO:0000269|PubMed:11082198}. | Sus scrofa (Pig) |
P0C5R9 | RNK_YEAST | MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAALVYLVFFVFCGFQVYLARRKPSIELR | null | null | endosomal lumen acidification [GO:0048388]; Golgi lumen acidification [GO:0061795]; proton transmembrane transport [GO:1902600]; vacuolar acidification [GO:0007035] | endoplasmic reticulum membrane [GO:0005789]; fungal-type vacuole membrane [GO:0000329]; Golgi membrane [GO:0000139]; proton-transporting V-type ATPase complex [GO:0033176]; vacuolar proton-transporting V-type ATPase complex [GO:0016471]; vacuolar proton-transporting V-type ATPase, V0 domain [GO:0000220] | proton-transporting ATPase activity, rotational mechanism [GO:0046961]; RNA endonuclease activity [GO:0004521] | null | null | null | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:30910982, ECO:0000305|PubMed:29526695}; Multi-pass membrane protein {ECO:0000269|PubMed:29526695, ECO:0000269|PubMed:30910982}. Vacuole membrane {ECO:0000269|PubMed:26928762, ECO:0000269|PubMed:30910982}; Multi-pass membrane protein {ECO:0000269|P... | null | null | null | null | null | FUNCTION: Accessory component of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:29526695). V-ATPase is responsible for acidifying and maintaining the pH of intracellu... | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
P0C5W1 | MAP1S_RAT | MAAVMAAPEPAEAPSSLLLLVVGGECGCPGLLAYVLEELERGVRSWEDVDPDVCSLDEQLKAFVSRHSATFSSIVKGQRSLHHRGETLETLVLLNPSDKSLCDELRNLLMDPAPHKLLVLAGPCLEETGELLLQTGGFSAHHFLQVLGDKEVQDALASAPAAPALTVSCPTFGDWALLGPAPGLRLRLNPPARLPSSEGLRAFLEYVAESLEPPSPFELLEPPATGGFLRLARPCCYVFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHAGADSLPGLNSLLRRKLAEREAAAGPQGQHEERLR... | null | null | apoptotic process [GO:0006915]; axonogenesis [GO:0007409]; brain development [GO:0007420]; dendrite development [GO:0016358]; metaphase chromosome alignment [GO:0051310]; microtubule anchoring at centrosome [GO:0034454]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; mito... | cell projection [GO:0042995]; centrosome [GO:0005813]; cytosol [GO:0005829]; dendrite [GO:0030425]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; microtubule cytoskeleton [GO:0015630]; microtubule organizing center [GO:0005815]; mitotic spindle microtubule [GO:1990498]; neuronal cell body [GO:0... | actin binding [GO:0003779]; actin filament binding [GO:0051015]; beta-tubulin binding [GO:0048487]; DNA binding [GO:0003677]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]; tubulin binding [GO:0015631] | null | null | MAP1A/MAP1B/MAP1S family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. Cytoplasm, cytosol {ECO:0000250}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:17658481}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:17658481}. Note=Detected in perinuclear punctate network corresponding to mitochondrial aggregates and in the nucleus in cells exhibi... | null | null | null | null | null | FUNCTION: Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles (By similar... | Rattus norvegicus (Rat) |
P0C5X8 | TTYH1_RAT | MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPPGAKSPPPGGGCVTWSCIAALLVGCAGIGIGFYGNSETSDGVSQLSSALQHANHTLSTIDDLVLETVERLGEAVRTELTTLEEVLSERVELVAATRGARRQAEAAAQHLQGLAFWQGVSLSPVQVAEDVTFVEEYRWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVVMTAMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDTYVLNLTQEETGISSDILNYYFLCNQAVSNPFQQRLTLSQR... | null | null | cell-cell adhesion [GO:0098609]; cell-substrate adhesion [GO:0031589]; chloride transport [GO:0006821]; filopodium assembly [GO:0046847]; L-glutamate transmembrane transport [GO:0015813]; mitotic cell cycle [GO:0000278] | chloride channel complex [GO:0034707]; filopodium membrane [GO:0031527]; filopodium tip [GO:0032433]; plasma membrane [GO:0005886]; smooth endoplasmic reticulum membrane [GO:0030868]; synapse [GO:0045202] | calcium ion binding [GO:0005509]; intracellular calcium activated chloride channel activity [GO:0005229]; volume-sensitive chloride channel activity [GO:0072320] | PF04906; | null | Tweety family | PTM: N-glycosylated. Contains high-mannose, hybrid and complex oligosaccharides. {ECO:0000250|UniProtKB:Q9H313}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17116230}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=chloride(in) = chloride(out); Xref=Rhea:RHEA:29823, ChEBI:CHEBI:17996; Evidence={ECO:0000250|UniProtKB:Q9D3A9}; CATALYTIC ACTIVITY: Reaction=L-glutamate(out) = L-glutamate(in); Xref=Rhea:RHEA:66336, ChEBI:CHEBI:29985; Evidence={ECO:0000250|UniProtKB:Q9D3A9}; PhysiologicalDirection=right-to-... | null | null | null | null | FUNCTION: Calcium-independent, swelling-dependent volume-regulated anion channel (VRAC-swell) which plays a pivotal role in the process of regulatory volume decrease (RVD) in the brain through the efflux of anions like chloride and organic osmolytes like glutamate. {ECO:0000250|UniProtKB:Q9D3A9}. | Rattus norvegicus (Rat) |
P0C5Y8 | ALS2_RAT | MDSKKKSSAEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVLQAALGVKHGVLLTEDGEVYSFGTLPWKSEAAEICPSSPLLESALVGHHVVTVATGSFHSGAVTESGVVYMWGENAAGQCAVANQQYVSEPSPVSISDSETSPLLAVRILQLACGEEHTLALSISREIWAWGTGCQLGLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPPQDLKPVPERCNQCSQLLITMTDKEDHVIISDSHCCPLGVTLSESQAEKHASTVTSPHPETLDGQGEVFENTVAEAELNMGSDQTTSGSAISAQQNIVG... | null | null | axonogenesis [GO:0007409]; behavioral fear response [GO:0001662]; endosomal transport [GO:0016197]; in utero embryonic development [GO:0001701]; locomotory behavior [GO:0007626]; lysosomal transport [GO:0007041]; neuromuscular junction development [GO:0007528]; neuron projection morphogenesis [GO:0048812]; positive reg... | axon [GO:0030424]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; early endosome [GO:0005769]; growth cone [GO:0030426]; intracellular membrane-bounded organelle [GO:0043231]; lamellipodium [GO:0030027]; membrane [GO:0016020]; neuronal cell bo... | GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]; identical protein binding [GO:0042802]; protein homodimerization activity [GO:0042803]; protein serine/threonine kinase activator activity [GO:0043539]; small GTPase binding [GO:0031267] | PF02493;PF00415;PF00621;PF02204; | 1.20.900.10;2.20.110.10;2.30.29.30;2.130.10.30;1.20.1050.80; | null | null | null | null | null | null | null | null | FUNCTION: May act as a GTPase regulator (By similarity). Controls survival and growth of spinal motoneurons. {ECO:0000250, ECO:0000269|PubMed:16802292}. | Rattus norvegicus (Rat) |
P0C5Y9 | H2AB1_HUMAN | MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED | null | null | heterochromatin organization [GO:0070828]; mRNA processing [GO:0006397]; nucleosome assembly [GO:0006334] | euchromatin [GO:0000791]; nucleosome [GO:0000786]; nucleus [GO:0005634] | nucleosomal DNA binding [GO:0031492]; protein heterodimerization activity [GO:0046982]; structural constituent of chromatin [GO:0030527] | null | 1.10.20.10; | Histone H2A family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:20008104, ECO:0000269|PubMed:24336483}. Chromosome {ECO:0000269|PubMed:20008104, ECO:0000269|PubMed:22795134, ECO:0000269|PubMed:24336483}. Note=Associated with the active X chromosome and with autosomes, while it is absent from the inactive X chromosome and excluded fr... | null | null | null | null | null | FUNCTION: Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing (PubMed:22795134). Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones there... | Homo sapiens (Human) |
P0C5Z0 | H2AB2_HUMAN | MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED | null | null | heterochromatin organization [GO:0070828]; mRNA processing [GO:0006397]; nucleosome assembly [GO:0006334] | euchromatin [GO:0000791]; nucleosome [GO:0000786]; nucleus [GO:0005634] | nucleosomal DNA binding [GO:0031492]; protein heterodimerization activity [GO:0046982]; structural constituent of chromatin [GO:0030527] | null | 1.10.20.10; | Histone H2A family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:20008104}. Chromosome {ECO:0000269|PubMed:20008104, ECO:0000269|PubMed:22795134}. Note=Associated with the active X chromosome and with autosomes, while it is absent from the inactive X chromosome and excluded from Barr bodies. {ECO:0000269|PubMed:20008104}. | null | null | null | null | null | FUNCTION: Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central ... | Homo sapiens (Human) |
P0C5Z8 | ATL_STAAU | MLGVINRMAKKFNYKLPSMVALTLVGSAVTAHQVQAAETTQDQTTNKNVLDSNKVKATTEQAKAEVKNPTQNISGTQVYQDPAIVQPKTANNKTGNAQVSQKVDTAQVNGDTRANQSATTNNTQPVAKSTSTTAPKTNTNVTNAGYSLVDDEDDNSEHQINPELIKSAAKPAALETQYKAAAPKAKTEATPKVTTFSASAQPRSVAATPKTSLPKYKPQVNSSINDYIRKNNLKAPKIEEDYTSYFPKYAYRNGVGRPEGIVVHDTANDRSTINGEISYMKNNYQNAFVHAFVDGDRIIETAPTDYLSWGVGAVGNPRFI... | 3.2.1.96; 3.5.1.28 | null | bacterial-type flagellum-dependent cell motility [GO:0071973]; cell wall organization [GO:0071555]; peptidoglycan catabolic process [GO:0009253] | extracellular region [GO:0005576] | amidase activity [GO:0004040]; mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity [GO:0033925]; N-acetylmuramoyl-L-alanine amidase activity [GO:0008745] | PF01510;PF01832;PF13457; | 1.10.530.10;2.30.30.170;3.40.80.10; | N-acetylmuramoyl-L-alanine amidase 2 family; Glycosyl hydrolase 73 family | PTM: Undergoes proteolytic processing to generate the two extracellular lytic enzymes, probably at the septal region on the cell surface. | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:8626282, ECO:0000269|PubMed:9139914, ECO:0000269|PubMed:9251058}. Note=Secreted, and then anchored on the cell surface at the peripheral cell wall above the completed septum (septal region), for the next cell division cycle. | CATALYTIC ACTIVITY: Reaction=Hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides.; EC=3.5.1.28; CATALYTIC ACTIVITY: Reaction=an N(4)-(oligosaccharide-(1->3)-[oligosaccharide-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-alpha-D-GlcNAc)-L-asparaginyl-[prote... | null | null | null | null | FUNCTION: Endohydrolysis of the di-N-acetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins containing the -[(Man)5(GlcNAc)2]-Asn structure. One N-acetyl-D-glucosamine residue remains attached to the protein; the rest of the oligosaccharide is released intact. Cleaves the peptidoglycan connecting the da... | Staphylococcus aureus |
P0C605 | KGP1_MOUSE | MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDS... | 2.7.11.12 | null | cell growth involved in cardiac muscle cell development [GO:0061049]; cerebellum development [GO:0021549]; cGMP-mediated signaling [GO:0019934]; collateral sprouting [GO:0048668]; dendrite development [GO:0016358]; forebrain development [GO:0030900]; negative regulation of glutamate secretion [GO:0014050]; negative reg... | acrosomal vesicle [GO:0001669]; cytoplasm [GO:0005737]; Golgi apparatus [GO:0005794]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; sarcolemma [GO:0042383] | ATP binding [GO:0005524]; calcium channel regulator activity [GO:0005246]; cGMP binding [GO:0030553]; cGMP-dependent protein kinase activity [GO:0004692]; identical protein binding [GO:0042802]; mitogen-activated protein kinase p38 binding [GO:0048273]; protein kinase activity [GO:0004672]; protein serine kinase activi... | PF00027;PF16808;PF00069; | 2.60.120.10;1.20.5.490;1.10.510.10; | Protein kinase superfamily, AGC Ser/Thr protein kinase family, cGMP subfamily | PTM: Autophosphorylation increases kinase activity. {ECO:0000250}.; PTM: 65 kDa monomer is produced by proteolytic cleavage. {ECO:0000250}. | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Note=Colocalized with TRPC7 in the plasma membrane. {ECO:0000250}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.12; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[p... | null | null | null | null | FUNCTION: Serine/threonine protein kinase that acts as a key mediator of the nitric oxide (NO)/cGMP signaling pathway. GMP binding activates PRKG1, which phosphorylates serines and threonines on many cellular proteins. Numerous protein targets for PRKG1 phosphorylation are implicated in modulating cellular calcium, but... | Mus musculus (Mouse) |
P0C606 | SGF29_RAT | MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADAEAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVAKPGDKVAARVKAVEGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRIIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHTPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK | null | null | negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of cell cycle [GO:0051726]; regulation of cell division [GO:0051302]; regulation of DNA repair [GO:0006282]; regulation of DNA-templated transcription [GO:0006355]; regulation of embryonic development [GO:0045995]; regulation of transcri... | ATAC complex [GO:0140672]; nucleus [GO:0005634]; SAGA complex [GO:0000124]; SAGA-type complex [GO:0070461] | methylated histone binding [GO:0035064]; methylation-dependent protein binding [GO:0140034] | PF07039; | 2.30.30.140; | SGF29 family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17334388}. | null | null | null | null | null | FUNCTION: Chromatin reader component of some histone acetyltransferase (HAT) SAGA-type complexes like the TFTC-HAT, ATAC or STAGA complexes (By similarity). SGF29 specifically recognizes and binds methylated 'Lys-4' of histone H3 (H3K4me), with a preference for trimethylated form (H3K4me3) (By similarity). In the SAGA-... | Rattus norvegicus (Rat) |
P0C618 | BNZA_PSEPU | MNQTDTSPIRLRRSWNTSEIEALFDEHAGRIDPRIYTDEDLYQLELERVFARSWLLLGHETQIRKPGDYITTYMGEDPVVVVRQKDASIAVFLNQCRHRGMRICRADAGNAKAFTCSYHGWAYDTAGNLVNVPYEAESFACLNKKEWSPLKARVETYKGLIFANWDENAVDLDTYLGEAKFYMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDMYHAGTTSHLSGILAGLPEDLEMADLAPPTVGKQYRASWGGHGSGFYVGDPNLMLAIMGPKVTSYWTEGPASEKAAERLGSVERGSKLMVEHMTVFPTCSF... | 1.14.12.11; 1.14.12.3 | COFACTOR: Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:190135; Evidence={ECO:0000255|PROSITE-ProRule:PRU00628}; Note=Binds 1 [2Fe-2S] cluster per subunit. {ECO:0000255|PROSITE-ProRule:PRU00628}; COFACTOR: Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; Note=Binds 1 Fe cation per subunit. {ECO:0000250}; | toluene catabolic process [GO:0042203]; xylene catabolic process [GO:0042184] | null | 2 iron, 2 sulfur cluster binding [GO:0051537]; benzene 1,2-dioxygenase activity [GO:0018619]; iron ion binding [GO:0005506]; toluene dioxygenase activity [GO:0018624] | PF00355;PF00848; | 2.102.10.10; | Bacterial ring-hydroxylating dioxygenase alpha subunit family | null | null | CATALYTIC ACTIVITY: Reaction=benzene + H(+) + NADH + O2 = cis-1,2-dihydrobenzene-1,2-diol + NAD(+); Xref=Rhea:RHEA:13813, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:16190, ChEBI:CHEBI:16716, ChEBI:CHEBI:57540, ChEBI:CHEBI:57945; EC=1.14.12.3; CATALYTIC ACTIVITY: Reaction=H(+) + NADH + O2 + toluene = (1S,2R)-3-me... | null | PATHWAY: Aromatic compound metabolism; benzene degradation; catechol from benzene: step 1/2.; PATHWAY: Xenobiotic degradation; toluene degradation.; PATHWAY: Xenobiotic degradation; xylene degradation. | null | null | FUNCTION: Catalyzes both the oxidation of benzene and toluene. | Pseudomonas putida (Arthrobacter siderocapsulatus) |
P0C625 | HBEAG_HBVA3 | MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSPSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076, ECO:0000269|PubMed:2585603}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076, ECO:0000269|PubMed:2585603}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype A2 subtype adw2 (strain Rutter 1979) (HBV-A) |
P0C627 | UBX2B_RAT | MAEGGGAEPEEQERRSSRPRPPSARDLQLALAELYEDEMKCKSSKPDRSTATAFKSPRTPPLRLYSGDQEYGGLHIAQPPTGKIVNELFKEAREHGAVPLNEATRSSSDDKAKSFTGGGYRLGSSFYKRSEYIYGENQLQDVQILLRLWSNGFSLDDGELRPYSDPTNAQFLESVKRGEIPLELQRLVHGSQVSLDMEDHQDQEYIKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAAVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRILDVRDFIVQSRPEFATTDFILVTSFPSKELTDESVTLQDAD... | null | null | autophagosome assembly [GO:0000045]; establishment of mitotic spindle orientation [GO:0000132]; Golgi organization [GO:0007030]; membrane fusion [GO:0061025]; negative regulation of protein localization to centrosome [GO:1904780]; nuclear membrane reassembly [GO:0031468]; positive regulation of mitotic centrosome separ... | cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; spindle pole centrosome [GO:0031616] | ubiquitin binding [GO:0043130] | PF08059;PF00789; | 3.30.420.210; | NSFL1C family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17141156}. Cytoplasm, cytosol {ECO:0000269|PubMed:17141156}. Endoplasmic reticulum {ECO:0000269|PubMed:17141156}. Golgi apparatus {ECO:0000269|PubMed:17141156}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:Q0KL01}. Note=Local... | null | null | null | null | null | FUNCTION: Adapter protein required for Golgi and endoplasmic reticulum biogenesis. Involved in Golgi and endoplasmic reticulum maintenance during interphase and in their reassembly at the end of mitosis. The complex formed with VCP has membrane fusion activity; membrane fusion activity requires USO1-GOLGA2 tethering an... | Rattus norvegicus (Rat) |
P0C644 | VIP1_RAT | MWSLTANEDEDESATAHFFLGAGDEGLGTCGIGMRTGESDSELLEDEEDEVPPEPQIIVGICAMTKKSKSKPMTQILERLCRFDYLTVVILGEDVILNEPVENWPPCHCLISFHSKGFPLDKAVAYSKLRNPFLINDLTMQYYIQDRREVYRILQEEGIDLPRYAVLNRDPACPEECNLIEGEDQVEVNGAVFPKPFVEKPVSAEDHNVYIYYPSSAGGGSQRLFRKIGSRSSVYSPESSVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVMLTAMEKLVARKVCVAFKQTVCG... | 2.7.4.24 | null | inositol metabolic process [GO:0006020]; inositol phosphate biosynthetic process [GO:0032958]; phosphorylation [GO:0016310] | cytosol [GO:0005829]; plasma membrane [GO:0005886] | ATP binding [GO:0005524]; diphosphoinositol-pentakisphosphate kinase activity [GO:0033857]; inositol heptakisphosphate kinase activity [GO:0000829]; inositol hexakisphosphate 1-kinase activity [GO:0052723]; inositol hexakisphosphate 3-kinase activity [GO:0052724]; inositol hexakisphosphate 5-kinase activity [GO:0000832... | PF00328;PF18086; | 3.40.50.11950;3.30.470.20;3.40.50.1240; | Histidine acid phosphatase family, VIP1 subfamily | null | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q6PFW1}. Cell membrane {ECO:0000250|UniProtKB:Q6PFW1}. Note=Relocalizes to the plasma membrane upon activation of the PtdIns 3-kinase pathway. {ECO:0000250|UniProtKB:Q6PFW1}. | CATALYTIC ACTIVITY: Reaction=1D-myo-inositol hexakisphosphate + ATP = 1-diphospho-1D-myo-inositol 2,3,4,5,6-pentakisphosphate + ADP; Xref=Rhea:RHEA:37459, ChEBI:CHEBI:30616, ChEBI:CHEBI:58130, ChEBI:CHEBI:74946, ChEBI:CHEBI:456216; EC=2.7.4.24; Evidence={ECO:0000250|UniProtKB:Q6PFW1}; PhysiologicalDirection=left-to-rig... | null | null | null | null | FUNCTION: Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respecti... | Rattus norvegicus (Rat) |
P0C684 | HBSAG_DHBV3 | MGQHPAKSMDVRRIEGGELLLNQLAGRMIPKGTLTWSGKFPTIDHVLDHVQTMEEINTLQQQGAWPAGAGRRVGLSNPAPQEIPQPQWTPEEDQKAREAFRRYQEERPPETTTIPPTSPTQWKLQPGDDPLLGNQSLLETHPLYQTEPAVPVIKTPPLKKKMSGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPHYAGSCPWGCPGFLWTYLRLFIIFLLILLVAAGLLYLTDNGSTILGKLQWASVSALFSSISSLLPSDPKSLVALTFGLSLIWMTSSSATQTLVTLTQLAT... | null | null | membrane fusion involved in viral entry into host cell [GO:0039663]; symbiont entry into host cell [GO:0046718]; virion attachment to host cell [GO:0019062] | membrane [GO:0016020]; viral envelope [GO:0019031]; virion membrane [GO:0055036] | null | PF00695; | null | Avihepadnavirus major surface antigen family | PTM: Myristoylation contributes importantly to DHBV infectivity. It is most likely required for an early step of the life cycle involving the entry or uncoating of virus particles.; PTM: Phosphorylated on pre-S domain for about 50% of L proteins, the L chains with internal pre-S region (Li-HBsAg). | SUBCELLULAR LOCATION: Virion membrane. | null | null | null | null | null | FUNCTION: The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specifici... | Duck hepatitis B virus (strain Germany/DHBV-3) (DHBV) |
P0C691 | DPOL_DHBV3 | MPQPLKQSLDQSKWLREAEKQLRVLENLVDSNLEEEKLKPQLSMGEDVQSPGKGEPLHPNVRAPLSHVVRAVTTDLPRLGNKLPARHHLGKLSGLYQMKGCTFNPEWKVPDISDTHFDLEVINECPSRNWKYLTPAKFWPKSISYFPVQAGVKPKYPDNVMQHESIVGKYLTRLYEAGILYKRISKHLVTFKGQPYNWEQQHLVNQHQIPDGATSSKINGRQENRRRRTPIKSTCRQNDTKRDSDMVGQVSNNRSRIRPCANNGGDKHPPATGSLACWGRKASRVIKSGSSRDSSASVDSRRRSKGPRGFSTLPRRETTG... | 2.7.7.49; 2.7.7.7; 3.1.26.4 | null | DNA replication [GO:0006260] | null | DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523] | PF00336;PF00242;PF00078; | 3.30.70.270;3.10.10.10; | Hepadnaviridae P protein family | null | null | CATALYTIC ACTIVITY: Reaction=a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1); Xref=Rhea:RHEA:22508, Rhea:RHEA-COMP:17339, Rhea:RHEA-COMP:17340, ChEBI:CHEBI:33019, ChEBI:CHEBI:61560, ChEBI:CHEBI:173112; EC=2.7.7.7; Evidence={ECO:0000255|PROSITE-ProRule:PRU00405}; CATALYTIC ACTIVITY: Reaction=a... | null | null | null | null | FUNCTION: Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3... | Duck hepatitis B virus (strain Germany/DHBV-3) (DHBV) |
P0C692 | HBEAG_HBVA2 | MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype A2 subtype adw (isolate Japan/Nishioka/1983) (HBV-A) |
P0C699 | HBEAG_HBVB1 | MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALKSPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLWWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype B1 subtype adw (isolate Japan/pJDW233/1988) (HBV-B) |
P0C6B8 | SVEP1_RAT | MWTRLAFCCWALALVSGWTNFQPMAPSLNFSFRLFPEASPGALGRLAVPPRSGEEEAVGSKVERLGRTFRSRVRRLRELSDRLELVFLVDESSSVGQTNFLNELKFVRKLLSDFPVVSTATRVAIVTFSSKNNVVARVDYISTSRAHQHKCALLSREIPAITYRGGGTYTMGAFQQAAQILRHSRENSTKVIFLITDGYSNGGDPRPIAASLRDFGVEIFTFGIWQGNIRELNDMASTPKEEHCYLLHSFEEFEALARRALHEDLPSGSFIQEDMAHCSYLCEAGRDCCDRMASCKCGTHTGQFECICEKGYYGKGLQYE... | null | null | epidermis development [GO:0008544]; gene expression [GO:0010467]; lymph circulation [GO:0003017]; lymph vessel development [GO:0001945]; lymph vessel morphogenesis [GO:0036303]; negative regulation of complement activation, classical pathway [GO:0045959]; negative regulation of vasoconstriction [GO:0045906]; positive r... | cell periphery [GO:0071944]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; membrane [GO:0016020]; nucleus [GO:0005634] | calcium ion binding [GO:0005509]; chromatin binding [GO:0003682]; integrin binding [GO:0005178]; integrin binding involved in cell-matrix adhesion [GO:0098640] | PF00008;PF07645;PF07699;PF02494;PF00354;PF00084;PF00092; | 2.60.120.200;2.10.70.10;2.10.25.10;2.10.50.10;3.40.50.410; | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:A2AVA0}. Nucleus {ECO:0000250|UniProtKB:Q4LDE5}. Cytoplasm {ECO:0000250|UniProtKB:Q4LDE5}. Membrane {ECO:0000250|UniProtKB:Q4LDE5}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q4LDE5}. | null | null | null | null | null | FUNCTION: Required for morphological development, cell alignment and migration of lymphatic endothelial cells during embryonic development, potentially via modulation of ANGPT2-TIE1 signaling and subsequent activation of FOXC2 transcription (By similarity). Required for embryonic lymphatic vascular development, via med... | Rattus norvegicus (Rat) |
P0C6E3 | VM2B1_AGKBI | QRYNPYKYIELFLVVDNRMVTKYNGDLDKIKTRIYELVNILNEIYRPLYIRVALVGIEFWCNKDLINVKSASSVTLASFANWRESVLPNRTSHDNAQLLTAIVFNRGVIGSAYPAGMCDPNRSVGTVQDHSEINLQVAITMAHEIGHNLGMGHDNNSCTCGGYSCIMLPALSDQPSKYFSNCSYIQYRDFIMNQDPQCILNEPSGTDIVSPPVCGNDILEVGEECDCGCPRNCQDPCCNAATCKKYSWVQCESGECCDQCRFKGAGTECRRAMGDDPGGRCTGQSADCPRN | 3.4.24.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; | proteolysis [GO:0006508] | extracellular region [GO:0005576]; plasma membrane [GO:0005886] | metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; toxin activity [GO:0090729] | PF00200;PF01421; | 3.40.390.10;4.10.70.10; | Venom metalloproteinase (M12B) family, P-II subfamily, P-IIc sub-subfamily | PTM: Glycosylated; glycans contain fucose, galactosamine, glucosamine, galactose, and mannose. Sialylated; 75% of the hemorrhagic activity of native bilitoxin-1 is lost upon removal of the sialic acid moieties of bilitoxin-1. {ECO:0000269|PubMed:10871038}. | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: This hemorrhagic toxin hydrolyzes the Aalpha-chain (FGA) and more slowly the Bbeta-chain (FGB) of fibrin and fibrinogen. Also hydrolyzes casein. It lacks platelet aggregation inhibitory activity. After intramuscular injection, it acts rapidly to disrupt the capillary endothelium without damaging the intercell... | Agkistrodon bilineatus (Cantil) (Tropical moccasin) |
P0C6E4 | VM2JN_PROJR | MIQVLLVTVCLAVFPYQGSSIILESGNVNDYEVVYPRKVTALPKRAVQQKYEDAMQYEFKVNGEPVVLHLEKNKGLFSEDYSETHYSPDGREITTYPSVEDHCYYHGRIHNDADSTASISACDGLKGYFKLQGETYLIEPLKLPDSEAHAVYKYENIEKEDEAPKMCGVTQNWESDESIKKASQLYLTPEQQRFPQRYVKLAIVVDYGMYTKYNRDSDKITVRVHEMVNHITEMYRPLNIDITLSLLDVWSEKDLITVQSDSDVTLEVFGDWRESVLLKRRSHDCAHLLTDTKLNDNTIGVAYKKGMCDPKLSVGLVQDY... | 3.4.24.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; | proteolysis [GO:0006508] | extracellular region [GO:0005576]; plasma membrane [GO:0005886] | metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; toxin activity [GO:0090729] | PF00200;PF01562;PF01421; | 3.40.390.10;4.10.70.10; | Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: [Snake venom metalloproteinase]: Impairs hemostasis in the envenomed animal. {ECO:0000250}.; FUNCTION: [Disintegrin jerdonatin]: Inhibits ADP- and collagen-induced human platelet aggregation with IC(50) of 123 and 135 nM, respectively. Inhibits sperm-egg binding in a concentration-dependent manner, but has no... | Protobothrops jerdonii (Jerdon's pitviper) (Trimeresurus jerdonii) |
P0C6E8 | VM3G1_TRIGA | KMCGVTQNWESYESTKKASQLNLTPEQQRFPQRYIKLGIFVDHGMYTKYSGNSERITKRVHQMINNINMMCRALNIVTTLSLLEIWSEKDLITVQASAPTTLTLFGAWRETVLLNRTSHDHAQLLTATIFNGNVIGRAPVGGMCDPKRSVAIVRDHNAIVFVVAVTMTHEMGHNLGNHHDEDKCNCNTCIMSKVLSRQPSKYFSECSKDYYQTFLTNHNFQCILNAPLRTDTVSTPVSGNELLEAGEDCDCGSPANPCCDAATCKLRPGAQCGEGLCCDQCRFTSAGTECRAARSECDIAESCAGQSADCPTDDFHRNGQ... | 3.4.24.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; | apoptotic process [GO:0006915]; proteolysis [GO:0006508] | extracellular region [GO:0005576]; plasma membrane [GO:0005886] | metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; toxin activity [GO:0090729] | PF08516;PF00200;PF01421; | 3.40.390.10;4.10.70.10; | Venom metalloproteinase (M12B) family, P-III subfamily, P-IIIb sub-subfamily | PTM: The N-terminus of the metalloproteinase is blocked. | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: [Snake venom metalloproteinase graminelysin]: Cleaves the alpha chain of fibrinogen (FGA) preferentially and cleaves the beta chain (FGB) either on longer incubation or at high concentrations. Induces apoptosis of endothelial cells (prior to cell detachment). {ECO:0000269|PubMed:11463342, ECO:0000269|PubMed:1... | Trimeresurus gramineus (Bamboo pit viper) (Indian green tree viper) |
P0C6E9 | NANH_VIBCH | MRFKNVKKTALMLAMFGMATSSNAALFDYNATGDTEFDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGWRMTTEMKVLSGGMITNYYANGTQRVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYHKFELVFLPGSNPSASFYFDGKLIRDNIQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQGDVIFRGPDRIPSIVASSVTPGVVTAFAEKRVGGGDPGALSNTNDIITRTSRDGGITWDTELNLTEQINVSDEFDFSDPRPIYDPSSNTVLVSYARWPTDAAQNGD... | 3.2.1.18 | COFACTOR: Name=Ca(2+); Xref=ChEBI:CHEBI:29108; | ganglioside catabolic process [GO:0006689]; oligosaccharide catabolic process [GO:0009313] | cytoplasm [GO:0005737]; extracellular region [GO:0005576]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020] | exo-alpha-(2->3)-sialidase activity [GO:0052794]; exo-alpha-(2->6)-sialidase activity [GO:0052795]; exo-alpha-(2->8)-sialidase activity [GO:0052796]; exo-alpha-sialidase activity [GO:0004308]; sialic acid binding [GO:0033691] | PF13088;PF09264; | 2.120.10.10;2.60.120.200; | Glycosyl hydrolase 33 family | null | SUBCELLULAR LOCATION: Secreted. | CATALYTIC ACTIVITY: Reaction=Hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.; EC=3.2.1.18; | null | null | null | null | FUNCTION: Cleaves the terminal sialic acid (N-acetyl neuraminic acid) from carbohydrate chains in glycoproteins providing free sialic acid which can be used as carbon and energy sources. Sialidases have been suggested to be pathogenic factors in microbial infections. Facilitates cholera toxin binding to host intestinal... | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
P0C6F1 | DYH2_MOUSE | MASKAEKKRKVAGRGGARAGRVVRAPQSTAGPGATEASLLPDGQEPEPESGKEDSVLGLQAFASWRLTPALHGEANTPPTLLHPQPLFHRRLTTLNLILSCSRAGTRDLALKPFFLSRTMLTGLADATWTGEHDMVLEHFVQDPAVPALTIFIDPVFGLKLELGMPVQTQNQIVYFIRQAPVPITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKSWPESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRC... | null | null | cilium movement [GO:0003341]; cilium movement involved in cell motility [GO:0060294]; cilium-dependent cell motility [GO:0060285]; inner dynein arm assembly [GO:0036159] | 9+2 motile cilium [GO:0097729]; axonemal dynein complex [GO:0005858]; axoneme [GO:0005930]; cilium [GO:0005929]; dynein complex [GO:0030286]; inner dynein arm [GO:0036156]; microtubule [GO:0005874]; motile cilium [GO:0031514]; sperm flagellum [GO:0036126] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569] | PF12774;PF12775;PF12780;PF12781;PF17857;PF18198;PF08385;PF08393;PF17852;PF18199;PF03028;PF12777; | 1.10.287.2620;1.10.472.130;1.10.8.1220;1.10.8.710;1.20.1270.280;1.20.58.1120;1.20.920.20;1.20.920.30;3.10.490.20;6.10.140.1060;1.20.140.100;3.20.180.20;3.40.50.300;1.10.8.720; | Dynein heavy chain family | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, cilium axoneme {ECO:0000269|PubMed:30060180}. Cytoplasm, cytoskeleton, flagellum axoneme {ECO:0000250|UniProtKB:Q9P225}. | null | null | null | null | null | FUNCTION: As part of the axonemal inner dynein arm complex plays a central role in ciliary beat (PubMed:30060180). Expressed in sperm flagellum, it is required for sperm motility (By similarity). Dyneins are microtubule-based molecular motors possessing ATPase activities that can convert the chemical energy of ATP into... | Mus musculus (Mouse) |
P0C6F2 | POL_HV1LW | MGARASVLSGGKLDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEECRSLYNTVATLYCVHQRIEIKDTKEALDKIKEEQNKSKKKAQQAAADTGHSSQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTET... | 2.7.7.-; 2.7.7.49; 2.7.7.7; 3.1.-.-; 3.1.13.2; 3.1.26.13; 3.4.23.16 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 2 magnesium ions for reverse transcriptase polymerase activity. {ECO:0000250}; COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 2 magnesium ions for ribonuclease H (RNase H) activity. Substrate-binding is ... | DNA integration [GO:0015074]; DNA recombination [GO:0006310]; establishment of integrated proviral latency [GO:0075713]; proteolysis [GO:0006508]; symbiont entry into host cell [GO:0046718]; symbiont-mediated suppression of host gene expression [GO:0039657]; viral genome integration into host DNA [GO:0044826]; viral pe... | host cell [GO:0043657]; host cell nucleus [GO:0042025]; host cell plasma membrane [GO:0020002]; host multivesicular body [GO:0072494]; membrane [GO:0016020]; viral nucleocapsid [GO:0019013]; virion membrane [GO:0055036] | aspartic-type endopeptidase activity [GO:0004190]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; exoribonuclease H activity [GO:0004533]; lipid binding [GO:0008289]; RNA stem-loop binding [GO:0035613]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity... | PF00540;PF19317;PF00552;PF02022;PF00075;PF00665;PF00077;PF00078;PF06815;PF06817;PF00098; | 1.10.10.200;1.10.1200.30;3.30.70.270;2.40.70.10;3.10.10.10;1.10.375.10;1.10.150.90;2.30.30.10;3.30.420.10;1.20.5.760;4.10.60.10; | null | PTM: [Gag-Pol polyprotein]: Specific enzymatic cleavages by the viral protease yield mature proteins. The protease is released by autocatalytic cleavage. The polyprotein is cleaved during and after budding, this process is termed maturation. Proteolytic cleavage of p66 RT removes the RNase H domain to yield the p51 RT ... | SUBCELLULAR LOCATION: [Gag-Pol polyprotein]: Host cell membrane; Lipid-anchor. Host endosome, host multivesicular body. Note=These locations are linked to virus assembly sites. The main location is the cell membrane, but under some circumstances, late endosomal compartments can serve as productive sites for virion asse... | CATALYTIC ACTIVITY: Reaction=Specific for a P1 residue that is hydrophobic, and P1' variable, but often Pro.; EC=3.4.23.16; Evidence={ECO:0000255|PROSITE-ProRule:PRU00275}; CATALYTIC ACTIVITY: Reaction=Endohydrolysis of RNA in RNA/DNA hybrids. Three different cleavage modes: 1. sequence-specific internal cleavage of RN... | null | null | null | null | FUNCTION: [Gag-Pol polyprotein]: Mediates, with Gag polyprotein, the essential events in virion assembly, including binding the plasma membrane, making the protein-protein interactions necessary to create spherical particles, recruiting the viral Env proteins, and packaging the genomic RNA via direct interactions with ... | Human immunodeficiency virus type 1 group M subtype B (isolate LW123) (HIV-1) |
P0C6F5 | R1A_BC279 | MESLALGVSEKTHVQLSLPVLQVRDVLVRGFGDSVEEALAEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDAQGTNHGYKVVELVAELDGIQYGRSGTTLGVLVPHVGETPVAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGVELGTDPIEDYEQNWNTKHGGGVLRELIRELNGGAFTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVWFTERSEKSYERQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVATPQECNDMHLSTL... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO... | PF16251;PF11501;PF12379;PF12124;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate imm... | Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005) |
P0C6F6 | R1A_BC512 | MASNHISLAFANDEEISAIGFGSVEEAVSYYSDAAVNGFDQCRFVSLGLQDAVVGVEDDDVVMLITGVTQLRAYLGTFGDRPLNLRGWLLFSNCNYFLEELDLVFGRCGGTTIPVDQFMCGADGAPVIQEGDWTFMDYFQDSNQFTLNGITYVKAWDVDRKPNDYAKQNVTCIRRITYITDHRHVLADGTTMKTARHPKVNKSVVLDSPFDQIYKEVGSPFMGNGSTFVEMLKDPAFFHALITCECGRSEWTVGDWKGYNSLCCNIKCKPITIVTPKAVPGAVVITKAGIGAGLKCYNNVFLKHIIDLVVPGTNLGWGVW... | 3.4.19.12; 3.4.22.- | null | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity [GO:0039548]; viral genome replication... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PLP1) and papain-like proteinase 2 (PLP2) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cell... | Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005) |
P0C6F7 | R1A_BC133 | MLSKAGVTTQGARGKYRAELYNEKRSDHVACTVPLCDTEDMASKLTPWFEDGETAFNQVSSILKEKGKILFVPMHMQRAMKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDHVGAAMMRTTLNVKPLGMFFPYDSSLETGEHTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQNLLKKLIGGDCIPVDQYMCGKNGKPIADYAKIVAKEGLTTLADIEVDVKSRMDSDRFIVLNKKLYRVVWNVTRRNVPYSKQTAFTVVSVIQCDDKESVPEHTFTIGSQILMVSPLKATNNKNFNLKQRLLHTFY... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO... | PF16251;PF11501;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.40.220.20;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: [Papain-like protease nsp3]: Responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate immune induct... | Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005) |
P0C6F8 | R1A_BCHK3 | MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAELDGIQFGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGVVTRYVDNNFCGPDGYPLECIKDFLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVWFTERSEKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVATPQECNDMHLSTL... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO... | PF16251;PF11501;PF12379;PF12124;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate imm... | Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3) |
P0C6G7 | HBEAG_HBVB2 | MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype B2 (isolate Indonesia/pIDW420/1988) (HBV-B) |
P0C6G9 | HBEAG_HBVB4 | MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype B/C subtype adw (isolate Okinawa/pODW282/1998) (HBV-B) |
P0C6H2 | HBEAG_HBVC0 | MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype C (isolate Vietnam/3270/2000) (HBV-C) |
P0C6H3 | HBEAG_HBVC1 | MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSVGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype C subtype adr (isolate Japan/Nishioka/1983) (HBV-C) |
P0C6H5 | HBEAG_HBVC3 | MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C) |
P0C6I1 | HBEAG_HBVD5 | MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRHVCLCWGDLMNLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRQRGRTIRRRTPSPRRRRSQSPRRRRSQSRESQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype D subtype ayw (isolate Australia/AustKW/1991) (HBV-D) |
P0C6I5 | HBEAG_HBVF6 | MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFSFLASDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Hepatitis B virus genotype F2 subtype adw4q (isolate Senegal/9203) (HBV-F) |
P0C6J0 | HBEAG_WMHBV | MHLFHLCLIILCSCPTVQASKLCLGWLLGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESSDHCSPHHTALRQTVLCWGELMSLASWVGTNLEDPAARELVVSYVNDNMGLKVRQLLWFHISCLTFGRETVLEYLVSFWVWIRTPPAYRPPNAPILSTLPETTVVRRRRPSGRRTPSPRRRRSQSPRRRRSQSPASSC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Woolly monkey hepatitis B virus (isolate Louisville) (WMHBV) |
P0C6J2 | HBEAG_WHV1 | MYLFHLCLVFACVPCPTVQASKLCLGWLWGMDIDPYKEFGSSYQLLNFLPLDFFPDLNALVDTATALYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTIIVNHVNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPILSTLPEHTVIRRRGGARASRSPRRRTPSPRRRRSQSPRRRRSQSPSANC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Woodchuck hepatitis B virus (isolate 1) (WHV) |
P0C6J3 | HBEAG_WHV2 | MYLFHLCLVFACVPCPTFQASKLCLGWLWGMDIDPYKEFGSSYQLLNFLPLDFFPDLNALVDTATALYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTIIVNHVNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFVVWIRTPAPYRPPNAPILSTLPEHTVIRRGGARASRSPRRRTPSPRRRRSQSPRRRRSQSPSANC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Woodchuck hepatitis B virus (isolate 2) (WHV) |
P0C6J4 | HBEAG_WHV3 | MYLFHLCLVFACVPCPTFQASKLCLGWLWGMDIDPYKEFGSSYQLLNFLPLDFFPDLNALVDTATALYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTIIVNHVNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPILSTLPEHTVIRRRGGARASRSPRRRTPSPRRRRSQSPRRRRSQSPSANC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Woodchuck hepatitis B virus (isolate 59) (WHV) |
P0C6J5 | HBEAG_WHV4 | MYLFHLCLVFACVPCPTFQASKLCLGWLWGMDIDPYKEFGSSYQLLNFLPLDFFPDLNALVDTATALYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTIIVNHVNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPILSTLPEHTVIRRRGGARASRSPRRRTPSPRRRRSQSPRRRRSQSPSANC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Woodchuck hepatitis B virus (isolate 7) (WHV) |
P0C6J6 | HBEAG_WHV5 | MYLFHLCLVFACVPCPTFQASKLCLGWLWGMDIDPYKEFGSSYQLLNFLPLDFFPDLNALVDTATALYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTIIVNHVNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPILSTLPEHTVIRRRGGARASRSPRRRTPSPRRRRSQSPRRRRSQSPSANC | null | null | microtubule-dependent intracellular transport of viral material towards nucleus [GO:0075521]; symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732]; virus-mediated perturbation of host defense response [GO:0019049] | extracellular region [GO:0005576]; host cell [GO:0043657]; host cell cytoplasm [GO:0030430]; host cell nucleus [GO:0042025]; T=4 icosahedral viral capsid [GO:0039619] | DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198] | PF08290;PF00906; | 1.10.4090.10; | Orthohepadnavirus precore antigen family | PTM: Phosphorylated. {ECO:0000255|HAMAP-Rule:MF_04076}.; PTM: Cleaved by host furin. {ECO:0000255|HAMAP-Rule:MF_04076}. | SUBCELLULAR LOCATION: Secreted {ECO:0000255|HAMAP-Rule:MF_04076}. Host nucleus {ECO:0000255|HAMAP-Rule:MF_04076}. | null | null | null | null | null | FUNCTION: May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells. This immune regulation may predispose to chronicity during perinatal infections and prevent severe liver injury duri... | Woodchuck hepatitis B virus (isolate 8) (WHV) |
P0C6L3 | SHDAG_HDVD3 | MSRPEGRKNRGGREEVLEQWVSGRKKLEELERDLRKVKKKIKKLEDEHPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPSRGGFTDKERQDHRRRKALENKRKQLSAGGKNLSKEEEEELRRLTEEDERRERRIAGPQVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFTRTGEGLDIRGSQGFP | null | null | symbiont entry into host cell [GO:0046718]; viral penetration into host nucleus [GO:0075732] | host cell [GO:0043657]; host cell nucleus [GO:0042025]; virion component [GO:0044423] | RNA binding [GO:0003723] | PF01517; | 4.10.220.40; | Hepatitis delta antigen family | PTM: Phosphorylated at serines and threonines by host MAPK1/3, PKR, and CK2. {ECO:0000269|PubMed:10559375, ECO:0000269|PubMed:12060652, ECO:0000269|PubMed:18632853}.; PTM: Acetylation modulates nuclear localization. Neo-synthesized genomic RNA migrates from the nucleus to the cytoplasm, where they interact with S-HDAg,... | SUBCELLULAR LOCATION: Virion {ECO:0000269|PubMed:1731113}. Host nucleus {ECO:0000269|PubMed:1731113}. | null | null | null | null | null | FUNCTION: Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then act... | Hepatitis delta virus genotype I (isolate D380) (HDV) |
P0C6P7 | FEM1B_RAT | MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIMKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELEAIRQD... | null | null | apoptotic process [GO:0006915]; branching involved in prostate gland morphogenesis [GO:0060442]; epithelial cell maturation [GO:0002070]; epithelial cell maturation involved in prostate gland development [GO:0060743]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein ubiquitination... | Cul2-RING ubiquitin ligase complex [GO:0031462]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] | death receptor binding [GO:0005123]; metal ion binding [GO:0046872]; ubiquitin ligase-substrate adaptor activity [GO:1990756] | PF00023;PF12796; | 1.25.40.20; | Fem-1 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15601915}. Nucleus {ECO:0000250|UniProtKB:Q9UK73}. Note=In the nucleus, the protein level increased slightly after camptothecin (CPT) treatment. Associated with chromatin. {ECO:0000250|UniProtKB:Q9UK73}. | null | null | PATHWAY: Protein modification; protein ubiquitination. {ECO:0000250|UniProtKB:Q9UK73}. | null | null | FUNCTION: Substrate-recognition component of a Cul2-RING (CRL2) E3 ubiquitin-protein ligase complex of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation. The C-degron recognized by the De... | Rattus norvegicus (Rat) |
P0C6R9 | VM3A_BOTAL | IISPPVCGNELLEVGEECDCGTPENCQNXCCDAATCKLKSGSQCGHXDCCEQCKFTKSGTECRASMSECDPAEHCTGQSXXCXXDVFHKNGQPCLDNYGYCYNGNCPIMYHAQCYALFGADVYEAEDSCFKDNQKGNYYGYCRKENXXXXXCXXXDVKCGRLYCKDNSPKQNNPCKMFYSNDDEHKGNVLPGTKCE | 3.4.24.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; | angiogenesis [GO:0001525]; cell differentiation [GO:0030154]; chemotaxis [GO:0006935]; proteolysis [GO:0006508] | extracellular region [GO:0005576]; plasma membrane [GO:0005886] | metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; toxin activity [GO:0090729] | PF08516;PF00200; | 4.10.70.10; | Venom metalloproteinase (M12B) family, P-III subfamily, P-IIIb sub-subfamily | PTM: The N-terminus of alternagin is blocked. | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: [Zinc metalloproteinase-disintegrin-like alternagin]: hemorrhagic protease that acts as a potent inhibitor of collagen-induced adhesion by blockage of alpha-2/beta-1 (ITGA2/ITGB1) integrin. Cleaves at Leu-|-Met bonds (PubMed:11368322). {ECO:0000269|PubMed:11368322}.; FUNCTION: Disintegrin alternagin-C: potent... | Bothrops alternatus (Urutu) (Rhinocerophis alternatus) |
P0C6S4 | VM2TO_ERIMA | QEEPCATGPCCRRCKFKRAGKVCRVARGDWNDDYCTGKSCDCPKNPWNG | null | null | null | extracellular region [GO:0005576] | toxin activity [GO:0090729] | null | 4.10.70.10; | Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:8042985}. | null | null | null | null | null | FUNCTION: Is a potent inhibitor of ADP-induced platelet aggregation. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) receptor on the platelet surface. Binds with the same high affinity to resting and activated platelets. Also binds the alpha-4/beta-1 (ITGA4/ITGB1) integrin. Is a potent inhibitor of human and murine ... | Eristicophis macmahoni (Leaf-nosed viper) |
P0C6S7 | ANS1B_RAT | MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGYTALHHAALNGHKDIVLKLLQFEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRVNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYLEGVGRSVVLEEEHAQEDTAQETRLSSPAQSPSQKT... | null | null | chemical synaptic transmission, postsynaptic [GO:0099565]; ephrin receptor signaling pathway [GO:0048013]; postsynapse to nucleus signaling pathway [GO:0099527]; receptor localization to synapse [GO:0097120]; regulation of synaptic plasticity by receptor localization to synapse [GO:1900383] | Cajal body [GO:0015030]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; glutamatergic synapse [GO:0098978]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; postsynaptic density [GO:0014069]; postsynaptic density, intracellular component [GO:0099092]; presynaptic cytosol [GO:0099523]; Schaffer collateral - CA1... | ephrin receptor binding [GO:0046875] | PF12796;PF00640;PF00536; | 1.25.40.20;2.30.29.30;1.10.150.50; | null | PTM: Nuclear translocation of isoform 3 requires an NMDAR-dependent proteolytic cleavage. A 35 kDa N-terminal form shuttles to the nucleus. {ECO:0000269|PubMed:17334360}. | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}.; SUBCELLULAR LOCATION: [Isoform 2]: Nucleus.; SUBCELLULAR LOCATION: [Isoform 3]: Postsynaptic density. Cell projection, dendritic spine. Nucleus. Nucleus, Cajal body. Note=The synaptic localization requires DLG4 interaction. Translocation to the nucleus in response to stim... | null | null | null | null | null | FUNCTION: Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells. {ECO:0000269|PubMed:17334360}.; FUNCTION: Isoform 3 can regulate global protein synthesis by altering nucleolar numbers. {ECO:0000269|PubMed:17334360}. | Rattus norvegicus (Rat) |
P0C6T3 | PRR7_RAT | MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV | null | null | adaptive immune response [GO:0002250]; alpha-beta T cell differentiation [GO:0046632]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:2001269]; postsynapse to nucleus signaling pathway [GO:0099527]; regulatio... | cytosol [GO:0005829]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; neuron projection [GO:0043005]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; postsynaptic density membrane [GO:0098839]; post... | long-chain fatty acid binding [GO:0036041]; protein tyrosine kinase binding [GO:1990782]; protein-containing complex binding [GO:0044877]; ubiquitin-like protein ligase binding [GO:0044389] | null | null | null | PTM: Palmitoylated. {ECO:0000250|UniProtKB:Q8TB68}.; PTM: Tyrosine phosphorylated, possibly by SRC. {ECO:0000250|UniProtKB:Q8TB68}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:Q8TB68}; Single-pass type III membrane protein {ECO:0000305}. Postsynaptic cell membrane {ECO:0000269|PubMed:15629447}; Single-pass type III membrane protein {ECO:0000305}. Postsynaptic density membrane {ECO:0000269|PubMed:15629447, ECO:0000269|PubMed:27458189}... | null | null | null | null | null | FUNCTION: Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner (PubMed:27458189). Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity of transcription factor JUN (PubMed:27458189). Might play a red... | Rattus norvegicus (Rat) |
P0C6T4 | R1A_BCHK4 | MLSKASVTTQGARGKYRAELYNEKRSDHVACTVPLCDTDDMACKLTPWFEDGETAFNQVSSILKEKGKILFVPMHMQRAMKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDQVGAAMMRTTLNAKPLGMFFPYDSSLETGEYTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQNLLKKLIGGDCIPIDQYMCGKNGKPIADYAKIVAKEGLTTLADIEVDVKSRMDSDRFIVLNKKLYRVVWNVTRRNVPYPKQTAFTIVSVVQCDDKDSVPEHTFTIGSQILMVSPLKATNNKNFNLKQRLLYTFY... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO... | PF16251;PF11501;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.40.220.20;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: [Non-structural protein 3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1};... | null | null | null | null | FUNCTION: The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate imm... | Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004) |
P0C6T5 | R1A_BCHK5 | MSFVAGVAPQGARGKYRAELNTEKRTDHVSLKASLCDAGDLVLKISPWFMDGESAYKHVSEQLSKGSKLLFVPQTLKGFIRHLPGPRVYLVERLTGGTYSDPFMVNQLAYQNAAGEGVIGTTLQGKRVGMFFPFDADLVTGEFQFLLRKKGFGGNRFRDAPWDYNWTPYSDLMDALEADPCGKYSQSLLKKLVGGDFTPIDQYMCGKNGKPIAEFAALMASEGITKLADVEAEVKSRTDSDRYIVFKNKLYRIVWNVQRKDVAYSKQSAFTMNSIVQLDTMEDVPRHSFTIGSEIQVIAPSTAVQANGHLNLKQRLLYAF... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO... | PF16251;PF11501;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.250.2820;1.10.150.420;3.40.220.10;1.10.1840.10;3.40.220.20;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate imm... | Bat coronavirus HKU5 (BtCoV) (BtCoV/HKU5/2004) |
P0C6T6 | R1A_BCHK9 | MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTPEPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVRYGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDPGPDVGPYLDFPDNCCPTKPKAKRGGDVYLSDQYGFDNNGILVEPVMKLLGVIKSDFTLEQLLAALGKYRTEDGYDLPDGYVKVAIKVGRKAVPVLKQSIFTVVGVTEQLVPGYYYPFSTSSVVEHTKPTRGGPVGKTVEAVMLSLYGTNNYNPATPVARLKCSYCDYYGW... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO:0008270] | PF16251;PF11501;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.40.220.20;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate imm... | Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9) |
P0C6T7 | R1A_BCRP3 | MESLVLGINEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKSGTCGIVELEKGVLPQPEQPYVFIKRSDAQGTDHGHRVRELVAELDGVQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGVLRELTRELNGGALTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCRDHGHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVATPQECNNMHLSTL... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; single-stranded RNA binding [GO:0003727]; zinc ion binding [GO... | PF16251;PF11501;PF12379;PF12124;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate imm... | Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3) |
P0C6T8 | R1A_CVBEN | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV) |
P0C6T9 | R1A_CVBLU | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV) |
P0C6U0 | R1A_CVBM | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Bovine coronavirus (strain Mebus) (BCoV) (BCV) |
P0C6U1 | R1A_CVBQ | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIAPWVMYLRKCGEKGAYIKDYKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Bovine coronavirus (strain Quebec) (BCoV) (BCV) |
P0C6U2 | R1A_CVH22 | MACNRVTLAVASDSEISANGCSTIAQAVRRYSEAASNGFRACRFVSLDLQDCIVGIADDTYVMGLHGNQTLFCNIMKFSDRPFMLHGWLVFSNSNYLLEEFDVVFGKRGGGNVTYTDQYLCGADGKPVMSEDLWQFVDHFGENEEIIINGHTYVCAWLTKRKPLDYKRQNNLAIEEIEYVHGDALHTLRNGSVLEMAKEVKTSSKVVLSDALDKLYKVFGSPVMTNGSNILEAFTKPVFISALVQCTCGTKSWSVGDWTGFKSSCCNVISNKLCVVPGNVKPGDAVITTQQAGAGIKYFCGMTLKFVANIEGVSVWRVIA... | 3.4.19.12; 3.4.22.- | null | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity [GO:0039548]; viral genome replication... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.30.30.1000;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed. {ECO:0000269|PubMed:11431476, ECO:0000269|PubMed:11842254, ECO:0000269|PubMed:9847320}. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PLP1) and papain-like proteinase 2 (PLP2) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cell... | Human coronavirus 229E (HCoV-229E) |
P0C6U3 | R1A_CVHN1 | MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDIFVHEDLHVVEVLTKTAVKSGTAILIKSPLHSLGGFPKGYVMGLFRSYKTKRYVVHHLSMTTSTTNFGEDFLGWIVPFGFMPSYVHKWFQFCRLYIEESDLIISNFKFDDYDFSVEDAYAEVHAEPKGKYSQKAYALLRQYRGIKPVLFVDQYGCDYSGKLADCLQAYGHYSLQDMRQKQSVWLANCDFDIVVAWHVVRDSRFVMRLQTIATICGIKYVAQPTEDVVDGDVVIREPVHLLS... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) |
P0C6U4 | R1A_CVHN2 | MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDIFVHEDLHVVEVLTKTAVKSGTAILIKSPLHSLGGFPKGYVMGLFRSYKTKRYVVHHLSMTTSTTNFGEDFLGWIVPFGFMPSYVHKWFQFCRLYIEESDLIISNFKFDDYDFSVEDAYAEVHAEPKGKYSQKAYALLRQYRGIKPVLFVDQYGCDYSGKLADCLQAYGHYSLQDMRQKQSVWLANCDFDIVVAWHVVRDSRFVMRLQTIATICGIKYVAQPTEDVVDGAVVIREPVHLLS... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Human coronavirus HKU1 (isolate N2) (HCoV-HKU1) |
P0C6U5 | R1A_CVHN5 | MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDIFVHEDLHVVEVLTKTAVKSGTAILIKSPLHSLGGFPKGYVMGLFRSYKTKRYVVHHLSMTTSTTNFGEDFFGWIVPFGFMPSYVHKWFQFCRLYIEESDLIISNFKFDDYDFSVEAAYAEVHAEPKGKYSQKAYALLRQYRGIKPVLFVDQYGCDYSGKLADCLQAYGHYSLQDMRQKQSVWLANCDFDIVVAWHVVRDSRFVMRLQTIATICGIKYVAQPTEDVVDGDVVIREPVHLLS... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) |
P0C6U6 | R1A_CVHNL | MFYNQVTLAVASDSEISGFGFAIPSVAVRTYSEAAAQGFQACRFVAFGLQDCVTGINDDDYVIALTGTNQLCAKILPFSDRPLNLRGWLIFSNSNYVLQDFDVVFGHGAGSVVFVDKYMCGFDGKPVLPKNMWEFRDYFNNNTDSIVIGGVTYQLAWDVIRKDLSYEQQNVLAIESIHYLGTTGHTLKSGCKLTNAKPPKYSSKVVLSGEWNAVYRAFGSPFITNGMSLLDIIVKPVFFNAFVKCNCGSESWSVGAWDGYLSSCCGTPAKKLCVVPGNVVPGDVIITSTSAGCGVKYYAGLVVKHITNITGVSLWRVTAV... | 3.4.19.12; 3.4.22.- | null | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity [GO:0039548]; viral genome replication... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PLP1) and papain-like proteinase 2 (PLP2) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cell... | Human coronavirus NL63 (HCoV-NL63) |
P0C6U7 | R1A_CVHOC | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDMICSTTAQKLETDGICPENHVMVDCRRLLKQECCVQSSLIREIVMNASPYHLEVLLQDALQSREAVLVTTPLGMSLEACYVRGCNPKGWTMGLFRRRSVCNTGRCTVNKHVAYQLYMIDPAGVCLGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKRGEKGAYNKDHGCGGFGHVYDFKVEDAYDQVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGSLADGLEAYADKTLQEMKALFPTWSQELPFDVIVAWHVVRDPRYVMRLQSAATICSVA... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Human coronavirus OC43 (HCoV-OC43) |
P0C6U8 | R1A_SARS | MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTL... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | COFACTOR: [Papain-like protease nsp3]: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:16306590}; | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | double membrane vesicle viral factory outer membrane [GO:0062243]; host cell endoplasmic reticulum [GO:0044165]; host cell endosome [GO:0044174]; host cell Golgi apparatus [GO:0044177]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0002151]; identical protein binding [GO:0042802]; K48-linked deubiquitinase activity [GO:1990380]; K63-linked deubiquitinase activity [GO:0061578]; lyas... | PF16251;PF11501;PF12379;PF12124;PF11633;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: [Isoform Replicase polyprotein 1a]: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (PubMed:12917450, PubMed:15331731, PubMed:15564471, PubMed:16306590, PubMed:32083638). 3C-like proteinase nsp5 liberates nsps 6-11 from the polyprotein (PubMed:32083638). Papain-like and 3C-like prot... | SUBCELLULAR LOCATION: [Non-structural protein 2]: Host cytoplasm {ECO:0000250|UniProtKB:P0DTD1}. Host endosome {ECO:0000250|UniProtKB:P0DTD1}.; SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein. Host cytoplasm {ECO:0000269|PubMed:23943763}.; SUBCELLULAR LOCATION... | CATALYTIC ACTIVITY: [3C-like proteinase nsp5]: Reaction=TSAVLQ-|-SGFRK-NH2 and SGVTFQ-|-GKFKK the two peptides corresponding to the two self-cleavage sites of the SARS 3C-like proteinase are the two most reactive peptide substrates. The enzyme exhibits a strong preference for substrates containing Gln at P1 position an... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.15 mM for peptide TSAVLQSGFRK-NH(2) {ECO:0000269|PubMed:14561748}; KM=0.58 mM for peptide SGVTFQGKFKK {ECO:0000269|PubMed:14561748}; KM=1.44 mM for peptide ATVRLQAGNAT {ECO:0000269|PubMed:14561748}; Note=The kinetic parameters are studied for the 3C-like proteina... | null | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0 for 3C-like proteinase activity. {ECO:0000269|PubMed:14561748}; | null | FUNCTION: [Isoform Replicase polyprotein 1a]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {ECO:0000305}.; FUNCTION: [Host translation inhibitor nsp1]: Inhibits host translation by interacting with the 40S... | Severe acute respiratory syndrome coronavirus (SARS-CoV) |
P0C6U9 | R1A_CVM2 | MAKMGKYGLGFKWAPEFPWMLPNASEKLGSPERSEEDGFCPSAAQEPKTKGKTLINHVRVDCSRLPALECCVQSAIIRDIFVDEDPLNVEASTMMALQFGSAVLVKPSKRLSIQAWAKLGVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCLGNGRFIGWFVPVTAIPAYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPKGKYSRKAYALLKGYRGVKSILFLDQYGCDYTGRLAKGLEDYGDCTLEEMKELFPVWCDSLDNEVVVAWHVDRDPRAVMRLQTLATIRSI... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signa... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Murine coronavirus (strain 2) (MHV-2) (Murine hepatitis virus) |
P0C6V0 | R1A_CVMA5 | MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRVNCSRLPALECCVQSAIIRDIFVDEDPQKVEASTMMALQFGSAVLVKPSKRLSIQAWTNLGVLPKTAAMGLFKRVCLCNTRECSCDAHVAFHLFTVQPDGVCLGNGRFIGWFVPVTAIPEYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPKGKYSCKAYALLKGYRGVKPILFVDQYGCDYTGCLAKGLEDYGDLTLSEMKELFPVWRDSLDSEVLVAWHVDRDPRAAMRLQTLATVRCI... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; self proteolysis [GO:0097264]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor ... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) |
P0C6V1 | R1A_CVMJH | MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRVDCSRLPALECCVQSAIIRDIFVDEDPQKVEASTMMALQFGSAVLVKPSKRLSVQAWAKLGVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCLGNGRFIGWFVPVTAIPEYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPRGKYSCKAYALLRGYRGVKPILFVDQYGCDYTGCLAKGLEDYGDLTLSEMKELSPVWRDSLDNEVVVAWHVDRDPRAVMRLQTLATVRSI... | 2.7.7.50; 3.4.19.12; 3.4.22.-; 3.4.22.69 | null | induction by virus of host autophagy [GO:0039520]; methylation [GO:0032259]; self proteolysis [GO:0097264]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor ... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; methyltransferase activity [GO:0008168]; omega peptidase activity [GO:0008242]; RNA-dependent RNA polymerase activity [GO:0003968]; single-stranded RNA binding [GO:0003727]; zinc io... | PF11963;PF16251;PF09401;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF01831;PF05409; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;3.40.50.11020;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:0000... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0DTC1}... | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PL1-PRO) and papain-like proteinase 2 (PL2-PRO) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains fro... | Murine coronavirus (strain JHM) (MHV-JHM) (Murine hepatitis virus) |
P0C6V2 | R1A_CVPPU | MSSKQFKILVNEDYQVNVPSLPIRDVLQEIKYCYRNGFEGYVFVPEYCRDLVDCDRKDHYVIGVLGNGVSDLKPVLLTEPSVMLQGFIVRANCNGVLEDFDLKIARTGRGAIYVDQYMCGADGKPVIEGDFKDYFGDEDIIEFEGEEYHCAWTTVRDEKPLNQQTLFTIQEIQYNLDIPHKLPNCATRHVAPPVKKNSKIVLSEDYKKLYDIFGSPFMGNGDCLSKCFDTLHFIAATLRCPCGSESSGVGDWTGFKTACCGLSGKVKGVTLGDIKPGDAVVTSMSAGKGVKFFANCVLQYAGDVEGVSIWKVIKTFTVDE... | 3.4.19.12; 3.4.22.- | null | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity [GO:0039548]; viral genome replication... | host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF16688;PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;3.10.20.540;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.30.30.1000;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO is autocatalytically processed. {ECO:0000269|PubMed:11842254}. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; | null | null | null | null | FUNCTION: The papain-like proteinase 1 (PLP1) and papain-like proteinase 2 (PLP2) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cell... | Porcine transmissible gastroenteritis coronavirus (strain Purdue) (TGEV) |
P0C6V3 | R1A_IBVB | MASSLKQGVSPKPRDVILVSKDIPEQLCDALFFYTSHNPKDYADAFAVRQKFDRSLQTGKQFKFETVCGLFLLKGVDKITPGVPAKVLKATSKLADLEDIFGVSPLARKYRELLKTACQWSLTVEALDVRAQTLDEIFDPTEILWLQVAAKIHVSSMAMRRLVGEVTAKVMDALGSNLSALFQIVKQQIARIFQKALAIFENVNELPQRIAALKMAFAKCARSITVVVVERTLVVKEFAGTCLASINGAVAKFFEELPNGFMGSKIFTTLAFFKEAAVRVVENIPNAPRGTKGFEVVGNAKGTQVVVRGMRNDLTLLDQK... | 3.4.19.12; 3.4.22.- | COFACTOR: [Papain-like protease]: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250|UniProtKB:P0C6U8}; | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; viral genome replication [GO:0019079]; viral protein processing [GO:0019082] | host cell endoplasmic reticulum membrane [GO:0044167]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type endopeptidase activity [GO:0004197]; lyase activity [GO:0016829]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF17896;PF05409; | 1.10.8.1190;2.60.120.1680;6.10.250.2820;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: [Isoform Replicase polyprotein 1a]: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (By similarity). 3C-like proteinase nsp5 liberates nsps 6-16 from the polyprotein (By similarity). Papain-like and 3C-like proteinases are autocatalytically processed. {ECO:0000250|UniProtKB:P0C6U8}.... | SUBCELLULAR LOCATION: [Papain-like protease]: Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P0C6Y3}; Multi-pass membrane protein {ECO:0000305}. Host cytoplasm {ECO:0000250|UniProtKB:P0C6U8}. Note=Gammacoronaviruses induce membrane zippering to form zippered endoplasmic reticulum (zER). {ECO:0000250|UniProt... | CATALYTIC ACTIVITY: [Papain-like protease]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0C6U8}; | null | null | null | null | FUNCTION: [Isoform Replicase polyprotein 1a]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {ECO:0000305}.; FUNCTION: [Non-structural protein 2]: May play a role in the modulation of host cell survival sign... | Avian infectious bronchitis virus (strain Beaudette) (IBV) |
P0C6V4 | R1A_IBVBC | MASSLKQGVSPKPRDVILVSKDIPEQLCDALFFYTSHNPKDYADAFAVRQKFDRSLQTGKQFKFETVCGLFLLKGVDKITPGVPAKVLKATSKLADLEDIFGVSPLARKYRELLKTACQWSLTVEALDVRAQTLDEIFDPTEILWLQVAAKIHVSSMAMRRLVGEVTAKVMDALGSNLSALFQIVKQQIARIFQKALAIFENVNELPQRIAALKMAFAKCARSITVVVVERTLVVKEFAGTCLASINGAVAKFFEELPNGFMGSKIFTTLAFFKEAAVRVVENIPNAPRGTKGFEVVGNAKGTQVVVRGMRNDLTLLDQK... | 3.4.19.12; 3.4.22.- | COFACTOR: [Papain-like protease]: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250|UniProtKB:P0C6U8}; | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; viral genome replication [GO:0019079]; viral protein processing [GO:0019082] | host cell endoplasmic reticulum membrane [GO:0044167]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type endopeptidase activity [GO:0004197]; lyase activity [GO:0016829]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF17896;PF05409; | 1.10.8.1190;2.60.120.1680;6.10.250.2820;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: [Isoform Replicase polyprotein 1a]: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (By similarity). 3C-like proteinase nsp5 liberates nsps 6-16 from the polyprotein (By similarity). Papain-like and 3C-like proteinases are autocatalytically processed. {ECO:0000250|UniProtKB:P0C6U8}.... | SUBCELLULAR LOCATION: [Papain-like protease]: Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P0C6Y3}; Multi-pass membrane protein {ECO:0000305}. Host cytoplasm {ECO:0000250|UniProtKB:P0C6U8}. Note=Gammacoronaviruses induce membrane zippering to form zippered endoplasmic reticulum (zER). {ECO:0000250|UniProt... | CATALYTIC ACTIVITY: [Papain-like protease]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0C6U8}; | null | null | null | null | FUNCTION: [Isoform Replicase polyprotein 1a]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {ECO:0000305}.; FUNCTION: [Non-structural protein 2]: May play a role in the modulation of host cell survival sign... | Avian infectious bronchitis virus (strain Beaudette CK) (IBV) |
P0C6V5 | R1A_IBVM | MASSLKQGVSPKLRDVILVSKDIPEQLCDALFFYTSHNPKDYADAFAVRQKFDRNLQTGKQFKFETVCGLFLLKGVDKITPGVPAKVLKATSKLADLEDIFGVSPFARKYRELLKTACQWSLTVETLDARAQTLDEIFDPTEILWLQVAAKIQVSAMAMRRLVGEVTAKVMDALGSNMSALFQIFKQQIVRIFQKALAIFENVSELPQRIAALKMAFAKCAKSITVVVMERTLVVREFAGTCLASINGAVAKFFEELPNGFMGAKIFTTLAFFREAAVKIVDNIPNAPRGTKGFEVVGNAKGTQVVVRGMRNDLTLLDQK... | 3.4.19.12; 3.4.22.- | COFACTOR: [Papain-like protease]: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250|UniProtKB:P0C6U8}; | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; viral genome replication [GO:0019079]; viral protein processing [GO:0019082] | host cell endoplasmic reticulum membrane [GO:0044167]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type endopeptidase activity [GO:0004197]; lyase activity [GO:0016829]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF17896;PF05409; | 1.10.8.1190;2.60.120.1680;6.10.250.2820;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: [Isoform Replicase polyprotein 1a]: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (By similarity). 3C-like proteinase nsp5 liberates nsps 6-16 from the polyprotein (By similarity). Papain-like and 3C-like proteinases are autocatalytically processed. {ECO:0000250|UniProtKB:P0C6U8}.... | SUBCELLULAR LOCATION: [Papain-like protease]: Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P0C6Y3}; Multi-pass membrane protein {ECO:0000305}. Host cytoplasm {ECO:0000250|UniProtKB:P0C6U8}. Note=Gammacoronaviruses induce membrane zippering to form zippered endoplasmic reticulum (zER). {ECO:0000250|UniProt... | CATALYTIC ACTIVITY: [Papain-like protease]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P0C6U8}; | null | null | null | null | FUNCTION: [Isoform Replicase polyprotein 1a]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {ECO:0000305}.; FUNCTION: [Non-structural protein 2]: May play a role in the modulation of host cell survival sign... | Avian infectious bronchitis virus (strain M41) (IBV) |
P0C6V6 | R1A_PEDV7 | MASNHVTLAFANDAEISAFGFCTASEAVSYYSEAAASGFMQCRFVSLDLADTVEGLLPEDYVMVVIGTTKLSAYVDTFGSRPRNICGWLLFSNCNYFLEELELTFGRRGGNIVPVDQYMCGADGKPVLQESEWEYTDFFADSEDGQLNIAGITYVKAWIVERSDVSYASQNLTSIKSITYCSTYEHTFLDGTAMKVARTPKIKKNVVLSEPLATIYREIGSPFVDNGSDARSIIRRPVFLHAFVKCKCGSYHWTVGDWTSYVSTCCGFKCKPVLVASCSAMPGSVVVTRAGAGTGVKYYNNMFLRHVADIDGLAFWRILK... | 2.7.7.50; 3.4.19.12; 3.4.22.- | null | induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity [GO:0039548]; viral genome replication... | host cell endoplasmic reticulum [GO:0044165]; host cell membrane [GO:0033644]; host cell nucleus [GO:0042025]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] | PF09401;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF01661;PF05409; | 1.10.8.1190;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;1.10.8.370;3.30.70.3540;2.40.10.250;2.40.10.10; | Coronaviruses polyprotein 1ab family | PTM: [Replicase polyprotein 1a]: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Non-structural protein 1]: Host cytoplasm {ECO:0000269|PubMed:26773386}. Host nucleus {ECO:0000269|PubMed:26773386}.; SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000250|UniProtKB:P0C6X7}; Multi-pass membrane protein {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION:... | CATALYTIC ACTIVITY: [Papain-like protease nsp3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; CATALYTIC ACTIVITY: [RNA-capping enzyme... | null | null | null | null | FUNCTION: [Non-structural protein 1]: Plays a role in the inhibition of host interferon and pro-inflammatory cytokines production. Suppresses host RELA/p65 activation by blocking NFKBIA phosphorylation (PubMed:28715653). Targets also the RLR pathway downstream of the IRF3 activation by targeting host CREBBP to proteaso... | Porcine epidemic diarrhea virus (strain CV777) (PEDV) |
P0C6V7 | R1AB_BEV | MSTSSSILDIPSKMFRILKNNTRETEQHLSSSTLDLISKSQLLAQCFDTQEIMASLSKTVRSILESQNLEHKSTLTPYNSSQSLQLLVMNTSCTQFKWTTGSTSSVKALLEKELCRGLVPLNDITPKSNYVELSLLTPSILIGNETSTTTTLPEIPLDMEQSIISCVENTLLKEVQALSGQESCQEYFLSANYQSLIPPQVLLNLMKMSSVVDLSPLTLPNTRLWLKLSPFHGGTSVSYATQIKGYANCARREEKCLKNRLTKKQKNQEKGSFDARSVITLGGKMYRYKVVVLRCEDQSDNLSELQFEPQVEYTMDMVPH... | 2.1.1.-; 2.7.7.48; 3.1.-.-; 3.1.13.-; 3.4.21.-; 3.6.4.12; 3.6.4.13 | null | DNA-templated transcription [GO:0006351]; proteolysis [GO:0006508]; viral RNA genome replication [GO:0039694] | host cell membrane [GO:0033644]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type peptidase activity [GO:0008234]; endonuclease activity [GO:0004519]; mRNA (nucleoside-2'-O-)-methyltransferase activity [GO:0004483]; RNA binding [GO:00037... | PF13245;PF05213;PF19215;PF01661;PF00680; | 3.90.1140.10;3.40.220.10;3.40.50.300;2.40.10.10;3.40.50.150; | null | PTM: Specific enzymatic cleavages in vivo by its own protease yield mature proteins. 3CL-PRO is autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Non-structural protein 1]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 2]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; CATALYTIC ACTIVITY: Reaction=ATP + H2... | null | null | null | null | FUNCTION: The 3C-like serine proteinase is responsible for the majority of cleavages.; FUNCTION: The helicase which contains a zinc finger structure displays RNA and DNA duplex-unwinding activities with 5' to 3' polarity. {ECO:0000250}.; FUNCTION: The exoribonuclease acts on both ssRNA and dsRNA in a 3' to 5' direction... | Berne virus (BEV) |
P0C6V8 | R1AB_BRV1 | MSKTSRELTNETELHLCSSTLDLISKSQLLAQCLGTPQNLVSLSKMVPSILESPTLEPRYTSTHSSSLQSLQLLALNTSSTLYKWTTGSISKLRGHLERELCRGLVPLNDFIPKGNYVELSLMIPSVLTGQGTSTTTTLQEMCSDMVQSCIKSMETDLLKGVLALKDQTSCQEYFLSANYQSLIPPQPLVNAMRMSSVVDLSPLILENTRLLLKLSPFHGGTSVSYTSMIREFVDCSRRDEKCLKRRLTKKQKRQEEGSFDANKVITLGGKMYRYRVVILKCSDEVDDLIGFDGKVGEFDYNFENVPHCWRDLVKRRCLI... | 2.1.1.-; 2.7.7.48; 3.1.-.-; 3.1.13.-; 3.4.21.-; 3.4.22.-; 3.6.4.12; 3.6.4.13 | null | DNA-templated transcription [GO:0006351]; proteolysis [GO:0006508]; viral RNA genome replication [GO:0039694] | host cell membrane [GO:0033644]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type peptidase activity [GO:0008234]; endonuclease activity [GO:0004519]; mRNA (nucleoside-2'-O-)-methyltransferase activity [GO:0004483]; RNA binding [GO:00037... | PF13245;PF05213;PF19215;PF01661;PF00680; | 3.90.1140.10;3.40.220.10;3.40.50.300;3.40.50.150; | null | PTM: Specific enzymatic cleavages in vivo by its own protease yield mature proteins. 3CL-PRO is autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Non-structural protein 1]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 2]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; CATALYTIC ACTIVITY: Reaction=ATP + H2... | null | null | null | null | FUNCTION: The 3C-like serine proteinase is responsible for the majority of cleavages. {ECO:0000250}.; FUNCTION: The helicase which contains a zinc finger structure displays RNA and DNA duplex-unwinding activities with 5' to 3' polarity. {ECO:0000250}.; FUNCTION: The exoribonuclease acts on both ssRNA and dsRNA in a 3' ... | Breda virus 1 (BRV-1) |
P0C6V9 | R1AB_BC279 | MESLALGVSEKTHVQLSLPVLQVRDVLVRGFGDSVEEALAEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDAQGTNHGYKVVELVAELDGIQYGRSGTTLGVLVPHVGETPVAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGVELGTDPIEDYEQNWNTKHGGGVLRELIRELNGGAFTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVWFTERSEKSYERQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVATPQECNDMHLSTL... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF16251;PF11501;PF12379;PF12124;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005) |
P0C6W0 | R1AB_BC512 | MASNHISLAFANDEEISAIGFGSVEEAVSYYSDAAVNGFDQCRFVSLGLQDAVVGVEDDDVVMLITGVTQLRAYLGTFGDRPLNLRGWLLFSNCNYFLEELDLVFGRCGGTTIPVDQFMCGADGAPVIQEGDWTFMDYFQDSNQFTLNGITYVKAWDVDRKPNDYAKQNVTCIRRITYITDHRHVLADGTTMKTARHPKVNKSVVLDSPFDQIYKEVGSPFMGNGSTFVEMLKDPAFFHALITCECGRSEWTVGDWKGYNSLCCNIKCKPITIVTPKAVPGAVVITKAGIGAGLKCYNNVFLKHIIDLVVPGTNLGWGVW... | 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activ... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; m... | PF13087;PF13604;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: [Non-structural protein 3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; CATALYTIC ACTIVITY: [RNA-directed RNA po... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.; FU... | Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005) |
P0C6W1 | R1AB_BC133 | MLSKAGVTTQGARGKYRAELYNEKRSDHVACTVPLCDTEDMASKLTPWFEDGETAFNQVSSILKEKGKILFVPMHMQRAMKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDHVGAAMMRTTLNVKPLGMFFPYDSSLETGEHTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQNLLKKLIGGDCIPVDQYMCGKNGKPIADYAKIVAKEGLTTLADIEVDVKSRMDSDRFIVLNKKLYRVVWNVTRRNVPYSKQTAFTVVSVIQCDDKESVPEHTFTIGSQILMVSPLKATNNKNFNLKQRLLHTFY... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF13604;PF16251;PF11501;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [Helicase nsp13]: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.12; CATALYTIC ACTIVITY: [Helicase nsp13]: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, C... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005) |
P0C6W2 | R1AB_BCHK3 | MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAELDGIQFGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGVVTRYVDNNFCGPDGYPLECIKDFLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVWFTERSEKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVATPQECNDMHLSTL... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF16251;PF11501;PF12379;PF12124;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3) |
P0C6W3 | R1AB_BCHK4 | MLSKASVTTQGARGKYRAELYNEKRSDHVACTVPLCDTDDMACKLTPWFEDGETAFNQVSSILKEKGKILFVPMHMQRAMKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDQVGAAMMRTTLNAKPLGMFFPYDSSLETGEYTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQNLLKKLIGGDCIPIDQYMCGKNGKPIADYAKIVAKEGLTTLADIEVDVKSRMDSDRFIVLNKKLYRVVWNVTRRNVPYPKQTAFTIVSVVQCDDKDSVPEHTFTIGSQILMVSPLKATNNKNFNLKQRLLYTFY... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF13604;PF16251;PF11501;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004) |
P0C6W4 | R1AB_BCHK5 | MSFVAGVAPQGARGKYRAELNTEKRTDHVSLKASLCDAGDLVLKISPWFMDGESAYKHVSEQLSKGSKLLFVPQTLKGFIRHLPGPRVYLVERLTGGTYSDPFMVNQLAYQNAAGEGVIGTTLQGKRVGMFFPFDADLVTGEFQFLLRKKGFGGNRFRDAPWDYNWTPYSDLMDALEADPCGKYSQSLLKKLVGGDFTPIDQYMCGKNGKPIAEFAALMASEGITKLADVEAEVKSRTDSDRYIVFKNKLYRIVWNVQRKDVAYSKQSAFTMNSIVQLDTMEDVPRHSFTIGSEIQVIAPSTAVQANGHLNLKQRLLYAF... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF13604;PF16251;PF11501;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.250.2820;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus HKU5 (BtCoV) (BtCoV/HKU5/2004) |
P0C6W5 | R1AB_BCHK9 | MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTPEPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVRYGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDPGPDVGPYLDFPDNCCPTKPKAKRGGDVYLSDQYGFDNNGILVEPVMKLLGVIKSDFTLEQLLAALGKYRTEDGYDLPDGYVKVAIKVGRKAVPVLKQSIFTVVGVTEQLVPGYYYPFSTSSVVEHTKPTRGGPVGKTVEAVMLSLYGTNNYNPATPVARLKCSYCDYYGW... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF13604;PF16251;PF11501;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9) |
P0C6W6 | R1AB_BCRP3 | MESLVLGINEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKSGTCGIVELEKGVLPQPEQPYVFIKRSDAQGTDHGHRVRELVAELDGVQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGVLRELTRELNGGALTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCRDHGHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVATPQECNNMHLSTL... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; G-quadruplex RNA binding [GO:0... | PF13087;PF16251;PF11501;PF12379;PF12124;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3) |
P0C6W7 | R1AB_CVBEN | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV) |
P0C6W8 | R1AB_CVBLU | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV) |
P0C6W9 | R1AB_CVBM | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bovine coronavirus (strain Mebus) (BCoV) (BCV) |
P0C6X0 | R1AB_CVBQ | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDIVCSTTAQKLETGGICPENHVMVDCRRLLKQECCVQSSLIREIVMNTRPYDLEVLLQDALQSREAVLVTPPLGMSLEACYVRGCNPNGWTMGLFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFGAGQFVGWVIPLAFMPVQSRKFIAPWVMYLRKCGEKGAYIKDYKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPFDVTVAWHVVRDPRYVMRLQSASTIRSVA... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Bovine coronavirus (strain Quebec) (BCoV) (BCV) |
P0C6X1 | R1AB_CVH22 | MACNRVTLAVASDSEISANGCSTIAQAVRRYSEAASNGFRACRFVSLDLQDCIVGIADDTYVMGLHGNQTLFCNIMKFSDRPFMLHGWLVFSNSNYLLEEFDVVFGKRGGGNVTYTDQYLCGADGKPVMSEDLWQFVDHFGENEEIIINGHTYVCAWLTKRKPLDYKRQNNLAIEEIEYVHGDALHTLRNGSVLEMAKEVKTSSKVVLSDALDKLYKVFGSPVMTNGSNILEAFTKPVFISALVQCTCGTKSWSVGDWTGFKSSCCNVISNKLCVVPGNVKPGDAVITTQQAGAGIKYFCGMTLKFVANIEGVSVWRVIA... | 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activ... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; m... | PF13087;PF13604;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed. {ECO:0000269|PubMed:11431476, ECO:0000269|PubMed:11842254, ECO:0000269|PubMed:9847320}. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: [Non-structural protein 3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; CATALYTIC ACTIVITY: [RNA-directed RNA po... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.; FU... | Human coronavirus 229E (HCoV-229E) |
P0C6X2 | R1AB_CVHN1 | MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDIFVHEDLHVVEVLTKTAVKSGTAILIKSPLHSLGGFPKGYVMGLFRSYKTKRYVVHHLSMTTSTTNFGEDFLGWIVPFGFMPSYVHKWFQFCRLYIEESDLIISNFKFDDYDFSVEDAYAEVHAEPKGKYSQKAYALLRQYRGIKPVLFVDQYGCDYSGKLADCLQAYGHYSLQDMRQKQSVWLANCDFDIVVAWHVVRDSRFVMRLQTIATICGIKYVAQPTEDVVDGDVVIREPVHLLS... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; CATALYTIC ACTIVITY: [Helicase nsp13]: Reaction=AT... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) |
P0C6X3 | R1AB_CVHN2 | MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDIFVHEDLHVVEVLTKTAVKSGTAILIKSPLHSLGGFPKGYVMGLFRSYKTKRYVVHHLSMTTSTTNFGEDFLGWIVPFGFMPSYVHKWFQFCRLYIEESDLIISNFKFDDYDFSVEDAYAEVHAEPKGKYSQKAYALLRQYRGIKPVLFVDQYGCDYSGKLADCLQAYGHYSLQDMRQKQSVWLANCDFDIVVAWHVVRDSRFVMRLQTIATICGIKYVAQPTEDVVDGAVVIREPVHLLS... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; CATALYTIC ACTIVITY: [Helicase nsp13]: Reaction=AT... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Human coronavirus HKU1 (isolate N2) (HCoV-HKU1) |
P0C6X4 | R1AB_CVHN5 | MIKTSKYGLGFKWAPEFRWLLPDAAEELASPMKSDEGGLCPSTGQAMESVGFVYDNHVKIDCRCILGQEWHVQSNLIRDIFVHEDLHVVEVLTKTAVKSGTAILIKSPLHSLGGFPKGYVMGLFRSYKTKRYVVHHLSMTTSTTNFGEDFFGWIVPFGFMPSYVHKWFQFCRLYIEESDLIISNFKFDDYDFSVEAAYAEVHAEPKGKYSQKAYALLRQYRGIKPVLFVDQYGCDYSGKLADCLQAYGHYSLQDMRQKQSVWLANCDFDIVVAWHVVRDSRFVMRLQTIATICGIKYVAQPTEDVVDGDVVIREPVHLLS... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane; Multi-pass membrane protein. Host cytoplasm {ECO:0000250|UniProtKB:P0C6X7}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane; Multi-pass membrane protein. Host cytoplasm. Note=Localizes in virally-induced cytoplasmic double-membrane ves... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; CATALYTIC ACTIVITY: [Helicase nsp13]: Reaction=AT... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) |
P0C6X5 | R1AB_CVHNL | MFYNQVTLAVASDSEISGFGFAIPSVAVRTYSEAAAQGFQACRFVAFGLQDCVTGINDDDYVIALTGTNQLCAKILPFSDRPLNLRGWLIFSNSNYVLQDFDVVFGHGAGSVVFVDKYMCGFDGKPVLPKNMWEFRDYFNNNTDSIVIGGVTYQLAWDVIRKDLSYEQQNVLAIESIHYLGTTGHTLKSGCKLTNAKPPKYSSKVVLSGEWNAVYRAFGSPFITNGMSLLDIIVKPVFFNAFVKCNCGSESWSVGAWDGYLSSCCGTPAKKLCVVPGNVVPGDVIITSTSAGCGVKYYAGLVVKHITNITGVSLWRVTAV... | 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activ... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; m... | PF13087;PF13604;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed. | SUBCELLULAR LOCATION: [Non-structural protein 3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00003... | CATALYTIC ACTIVITY: [Non-structural protein 3]: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; CATALYTIC ACTIVITY: [RNA-directed RNA po... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Human coronavirus NL63 (HCoV-NL63) |
P0C6X6 | R1AB_CVHOC | MSKINKYGLELHWAPEFPWMFEDAEEKLDNPSSSEVDMICSTTAQKLETDGICPENHVMVDCRRLLKQECCVQSSLIREIVMNASPYHLEVLLQDALQSREAVLVTTPLGMSLEACYVRGCNPKGWTMGLFRRRSVCNTGRCTVNKHVAYQLYMIDPAGVCLGAGQFVGWVIPLAFMPVQSRKFIVPWVMYLRKRGEKGAYNKDHGCGGFGHVYDFKVEDAYDQVHDEPKGKFSKKAYALIRGYRGVKPLLYVDQYGCDYTGSLADGLEAYADKTLQEMKALFPTWSQELPFDVIVAWHVVRDPRYVMRLQSAATICSVA... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; m... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Human coronavirus OC43 (HCoV-OC43) |
P0C6X7 | R1AB_SARS | MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTL... | 2.1.1.-; 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.4.22.69; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Papain-like protease nsp3]: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:16306590}; COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000269|PubMed:16828802}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000269|PubMed:16828802};... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | double membrane vesicle viral factory outer membrane [GO:0062243]; host cell endoplasmic reticulum [GO:0044165]; host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell endosome [GO:0044174]; host cell Golgi apparatus [GO:0044177]; host cell perinuclear region of cytoplasm [GO:0044220]; m... | 3'-5'-RNA exonuclease activity [GO:0000175]; 5'-3' DNA helicase activity [GO:0043139]; 5'-3' RNA helicase activity [GO:0032574]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [G... | PF13087;PF16251;PF11501;PF12379;PF12124;PF11633;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19212;PF19211;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.30.150;3.40.220.10;1.10.1840.10;3.30.160.820;3.40.220.20;3.40.220.30;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: [Isoform Replicase polyprotein 1ab]: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins (PubMed:12917450, PubMed:15331731, PubMed:15564471, PubMed:16306590, PubMed:32083638). 3C-like proteinase nsp5 liberates nsps 6-16 from the polyprotein (PubMed:32083638). Papain-like and 3C-like pro... | SUBCELLULAR LOCATION: [Non-structural protein 2]: Host cytoplasm {ECO:0000250|UniProtKB:P0DTD1}. Host endosome {ECO:0000250|UniProtKB:P0DTD1}.; SUBCELLULAR LOCATION: [Papain-like protease nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein. Host cytoplasm {ECO:0000269|PubMed:23943763}.; SUBCELLULAR LOCATION... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539, E... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.15 mM for peptide TSAVLQSGFRK-NH(2) {ECO:0000269|PubMed:14561748}; KM=0.58 mM for peptide SGVTFQGKFKK {ECO:0000269|PubMed:14561748}; KM=1.44 mM for peptide ATVRLQAGNAT {ECO:0000269|PubMed:14561748}; Note=The kinetic parameters are studied for the 3C-like proteina... | null | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0 for 3C-like proteinase activity. {ECO:0000269|PubMed:14561748}; | null | FUNCTION: [Isoform Replicase polyprotein 1ab]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {ECO:0000305}.; FUNCTION: [Host translation inhibitor nsp1]: Inhibits host translation by interacting with the 40... | Severe acute respiratory syndrome coronavirus (SARS-CoV) |
P0C6X8 | R1AB_CVM2 | MAKMGKYGLGFKWAPEFPWMLPNASEKLGSPERSEEDGFCPSAAQEPKTKGKTLINHVRVDCSRLPALECCVQSAIIRDIFVDEDPLNVEASTMMALQFGSAVLVKPSKRLSIQAWAKLGVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCLGNGRFIGWFVPVTAIPAYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPKGKYSRKAYALLKGYRGVKSILFLDQYGCDYTGRLAKGLEDYGDCTLEEMKELFPVWCDSLDNEVVVAWHVDRDPRAVMRLQTLATIRSI... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [Non-structural protein 10]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProtKB:P0DTD... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Murine coronavirus (strain 2) (MHV-2) (Murine hepatitis virus) |
P0C6X9 | R1AB_CVMA5 | MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRVNCSRLPALECCVQSAIIRDIFVDEDPQKVEASTMMALQFGSAVLVKPSKRLSIQAWTNLGVLPKTAAMGLFKRVCLCNTRECSCDAHVAFHLFTVQPDGVCLGNGRFIGWFVPVTAIPEYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPKGKYSCKAYALLKGYRGVKPILFVDQYGCDYTGCLAKGLEDYGDLTLSEMKELFPVWRDSLDSEVLVAWHVDRDPRAAMRLQTLATVRCI... | 2.1.1.56; 2.1.1.57; 2.7.7.48; 2.7.7.50; 3.1.13.-; 3.4.19.12; 3.4.22.-; 3.6.4.12; 3.6.4.13; 4.6.1.- | COFACTOR: [Uridylate-specific endoribonuclease nsp15]: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P0C6X7}; Note=Likely affects Nsp15 binding to RNA. {ECO:0000250|UniProtKB:P0C6X7}; COFACTOR: [RNA-directed RNA polymerase nsp12]: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProt... | DNA-templated transcription [GO:0006351]; induction by virus of host autophagy [GO:0039520]; proteolysis [GO:0006508]; symbiont-mediated degradation of host mRNA [GO:0039595]; symbiont-mediated perturbation of host protein ubiquitination [GO:0039648]; symbiont-mediated suppression of host ISG15-protein conjugation [GO:... | host cell endoplasmic reticulum-Golgi intermediate compartment [GO:0044172]; host cell membrane [GO:0033644]; host cell perinuclear region of cytoplasm [GO:0044220]; membrane [GO:0016020] | 3'-5'-RNA exonuclease activity [GO:0000175]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; endonuclease activity [GO:0004519]; lyase activity [GO:0016829]; mRNA (nucleoside-2'-O-)-methyltransferase a... | PF13087;PF13604;PF11963;PF16251;PF06471;PF06460;PF09401;PF20631;PF20633;PF20632;PF19215;PF19216;PF19219;PF19218;PF16348;PF19217;PF19213;PF08716;PF08717;PF08710;PF08715;PF06478;PF01661;PF01831;PF05409;PF00680; | 1.10.8.1190;2.60.120.1680;3.10.20.350;3.10.20.540;3.40.50.11580;6.10.140.2090;1.10.150.420;3.40.220.10;1.10.1840.10;3.30.160.820;1.10.8.370;3.30.70.3540;3.40.50.300;2.40.10.250;3.40.50.11020;2.40.10.10;3.40.50.150; | Coronaviruses polyprotein 1ab family | PTM: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: [Papain-like proteinase nsp3]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 4]: Host membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Non-structural protein 6]: Host membrane {ECO:00... | CATALYTIC ACTIVITY: [RNA-directed RNA polymerase nsp12]: Reaction=a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1); Xref=Rhea:RHEA:21248, Rhea:RHEA-COMP:14527, Rhea:RHEA-COMP:17342, ChEBI:CHEBI:33019, ChEBI:CHEBI:61557, ChEBI:CHEBI:140395; EC=2.7.7.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU00539}; ... | null | null | null | null | FUNCTION: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. {EC... | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.