Entry stringlengths 6 10 | Entry Name stringlengths 5 11 | Sequence stringlengths 2 35.2k | EC number stringlengths 7 118 ⌀ | Cofactor stringlengths 38 1.77k ⌀ | Gene Ontology (biological process) stringlengths 18 11.3k ⌀ | Gene Ontology (cellular component) stringlengths 17 1.75k ⌀ | Gene Ontology (molecular function) stringlengths 24 2.09k ⌀ | Pfam stringlengths 8 232 ⌀ | Gene3D stringlengths 10 250 ⌀ | Protein families stringlengths 9 237 ⌀ | Post-translational modification stringlengths 16 8.52k ⌀ | Subcellular location [CC] stringlengths 29 6.18k ⌀ | Catalytic activity stringlengths 64 35.7k ⌀ | Kinetics stringlengths 69 11.7k ⌀ | Pathway stringlengths 27 908 ⌀ | pH dependence stringlengths 64 955 ⌀ | Temperature dependence stringlengths 70 1.16k ⌀ | Function [CC] stringlengths 17 15.3k ⌀ | Organism stringlengths 8 196 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
P01216 | GLHA_MOUSE | MDYYRKYAAVILVMLSMFLHILHSLPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS | null | null | cellular response to hormone stimulus [GO:0032870]; developmental growth [GO:0048589]; follicle-stimulating hormone secretion [GO:0046884]; G protein-coupled receptor signaling pathway [GO:0007186]; gonad development [GO:0008406]; luteinizing hormone secretion [GO:0032275]; negative regulation of organ growth [GO:00466... | extracellular space [GO:0005615]; follicle-stimulating hormone complex [GO:0016914] | follicle-stimulating hormone activity [GO:0016913] | PF00236; | 2.10.90.10; | Glycoprotein hormones subunit alpha family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01215}. | null | null | null | null | null | FUNCTION: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. {ECO:0... | Mus musculus (Mouse) |
P01218 | GLHA_SHEEP | MDYYRKYAAAILAILSLFLQILHSFPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS | null | null | G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of steroid biosynthetic process [GO:0010893]; regulation of signaling receptor activity [GO:0010469]; thyroid hormone generation [GO:0006590] | extracellular space [GO:0005615]; follicle-stimulating hormone complex [GO:0016914] | follicle-stimulating hormone activity [GO:0016913] | PF00236; | 2.10.90.10; | Glycoprotein hormones subunit alpha family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01215}. | null | null | null | null | null | FUNCTION: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. {ECO:0... | Ovis aries (Sheep) |
P01222 | TSHB_HUMAN | MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV | null | null | anatomical structure morphogenesis [GO:0009653]; cell-cell signaling [GO:0007267]; G protein-coupled receptor signaling pathway [GO:0007186]; response to calcium ion [GO:0051592]; response to estrogen [GO:0043627]; response to vitamin A [GO:0033189] | cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615] | hormone activity [GO:0005179] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Indispensable for the control of thyroid structure and metabolism. | Homo sapiens (Human) |
P01223 | TSHB_BOVIN | MTATFLMSMIFGLACGQAMSFCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYMVGFSI | null | null | G protein-coupled receptor signaling pathway [GO:0007186] | cytoplasm [GO:0005737]; extracellular space [GO:0005615] | hormone activity [GO:0005179] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Indispensable for the control of thyroid structure and metabolism. | Bos taurus (Bovine) |
P01225 | FSHB_HUMAN | MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE | null | null | female gamete generation [GO:0007292]; female pregnancy [GO:0007565]; follicle-stimulating hormone signaling pathway [GO:0042699]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of bone resorption [GO:0045780]; positive regulation of cell migration [GO:0030335]; positive regulation of ce... | cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; follicle-stimulating hormone complex [GO:0016914] | follicle-stimulating hormone activity [GO:0016913] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:2494176}. Note=Efficient secretion requires dimerization with CGA. {ECO:0000269|PubMed:2494176}. | null | null | null | null | null | FUNCTION: Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways (PubMed:24692546, PubMed:2494176). Follitropin is... | Homo sapiens (Human) |
P01229 | LSHB_HUMAN | MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL | null | null | cell-cell signaling [GO:0007267]; G protein-coupled receptor signaling pathway [GO:0007186]; hormone-mediated signaling pathway [GO:0009755]; male gonad development [GO:0008584]; ovulation [GO:0030728]; progesterone biosynthetic process [GO:0006701]; signal transduction [GO:0007165] | cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi lumen [GO:0005796]; pituitary gonadotropin complex [GO:0061696] | hormone activity [GO:0005179]; signaling receptor binding [GO:0005102] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. | Homo sapiens (Human) |
P01231 | LSHB_SHEEP | MEMLQGLLLWLLLGVAGVWASRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCLSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL | null | null | estradiol secretion [GO:0035938]; G protein-coupled receptor signaling pathway [GO:0007186]; ovulation [GO:0030728] | cytoplasm [GO:0005737]; extracellular space [GO:0005615] | hormone activity [GO:0005179] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The LH alpha 3/LH beta 3 heterodimer was shown to have potent renotropic and weak gonadotropic activity. {ECO:0000269|PubMed:2456202}. | Ovis aries (Sheep) |
P01232 | LSHB_PIG | MEMLQGLLLWLLLSVAGVWASRGPLRPLCRPINATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELSFASIRLPGCPPGVDPTVSFPVALSCHCGPCRLSSSDCGGPRAQPLACDRPLLPGLLFL | null | null | G protein-coupled receptor signaling pathway [GO:0007186]; ovulation [GO:0030728] | cytoplasm [GO:0005737]; extracellular space [GO:0005615] | hormone activity [GO:0005179] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. | Sus scrofa (Pig) |
P01235 | GTHB2_CYPCA | MGTPVKILVVRNHILFSVVVLLAVAQSSYLPPCEPVNETVAVEKEGCPKCLVLQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFLVY | null | null | G protein-coupled receptor signaling pathway [GO:0007186]; ovulation [GO:0030728]; positive regulation of androgen secretion [GO:2000836]; positive regulation of estradiol secretion [GO:2000866]; positive regulation of gene expression [GO:0010628] | cytoplasm [GO:0005737]; extracellular space [GO:0005615] | follicle-stimulating hormone receptor binding [GO:0031762]; hormone activity [GO:0005179]; lutropin-choriogonadotropic hormone receptor binding [GO:0031775]; protein heterodimerization activity [GO:0046982] | PF00007; | 2.10.90.10; | Glycoprotein hormones subunit beta family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Involved in gametogenesis and steroidogenesis. | Cyprinus carpio (Common carp) |
P01236 | PRL_HUMAN | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC | null | null | cell surface receptor signaling pathway [GO:0007166]; female pregnancy [GO:0007565]; lactation [GO:0007595]; mammary gland development [GO:0030879]; negative regulation of angiogenesis [GO:0016525]; negative regulation of endothelial cell proliferation [GO:0001937]; positive regulation of canonical NF-kappaB signal tra... | endosome lumen [GO:0031904]; extracellular region [GO:0005576]; extracellular space [GO:0005615] | hormone activity [GO:0005179]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Prolactin acts primarily on the mammary gland by promoting lactation. | Homo sapiens (Human) |
P01237 | PRL_RAT | MNSQVSARKAGTLLLLMMSNLLFCQNVQTLPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC | null | null | cell population proliferation [GO:0008283]; cellular response to hormone stimulus [GO:0032870]; circadian rhythm [GO:0007623]; epithelial cell proliferation [GO:0050673]; female pregnancy [GO:0007565]; lactation [GO:0007595]; mammary gland development [GO:0030879]; maternal behavior [GO:0042711]; multicellular organism... | extracellular region [GO:0005576]; extracellular space [GO:0005615]; secretory granule [GO:0030141] | hormone activity [GO:0005179]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Prolactin acts primarily on the mammary gland by promoting lactation. | Rattus norvegicus (Rat) |
P01238 | PRL_PIG | MDNRGSSQKGSLLLLLLLVSNLFLCKSVASLPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC | null | null | cellular response to hypoxia [GO:0071456]; female pregnancy [GO:0007565]; lactation [GO:0007595]; mammary gland development [GO:0030879]; negative regulation of estrogen biosynthetic process [GO:1904077]; negative regulation of hydrogen peroxide biosynthetic process [GO:0010730]; negative regulation of nitric oxide bio... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Prolactin acts primarily on the mammary gland by promoting lactation. | Sus scrofa (Pig) |
P01239 | PRL_BOVIN | MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC | null | null | biosynthetic process [GO:0009058]; blastocyst formation [GO:0001825]; cell surface receptor signaling pathway [GO:0007166]; female pregnancy [GO:0007565]; inflammatory response [GO:0006954]; lactation [GO:0007595]; long-day photoperiodism [GO:0048571]; mammary gland development [GO:0030879]; negative regulation of apop... | cytosol [GO:0005829]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum membrane [GO:0005789]; extracellular space [GO:0005615] | hormone activity [GO:0005179]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Prolactin acts primarily on the mammary gland by promoting lactation. | Bos taurus (Bovine) |
P01240 | PRL_SHEEP | MDSKGSAQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC | null | null | biosynthetic process [GO:0009058]; blastocyst formation [GO:0001825]; cell surface receptor signaling pathway [GO:0007166]; female pregnancy [GO:0007565]; lactation [GO:0007595]; negative regulation of apoptotic process [GO:0043066]; negative regulation of luteinizing hormone secretion [GO:0033685]; negative regulation... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Prolactin acts primarily on the mammary gland by promoting lactation, mammogenesis, mitogenesis and osmoregulation. | Ovis aries (Sheep) |
P01241 | SOMA_HUMAN | MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF | null | null | animal organ development [GO:0048513]; bone maturation [GO:0070977]; cytokine-mediated signaling pathway [GO:0019221]; growth hormone receptor signaling pathway [GO:0060396]; positive regulation of activation of Janus kinase activity [GO:0010536]; positive regulation of glucose transmembrane transport [GO:0010828]; pos... | endosome lumen [GO:0031904]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; growth hormone receptor complex [GO:0070195] | cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; growth hormone activity [GO:0070186]; growth hormone receptor binding [GO:0005131]; hormone activity [GO:0005179]; metal ion binding [GO:0046872]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. | Homo sapiens (Human) |
P01242 | SOM2_HUMAN | MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF | null | null | animal organ development [GO:0048513]; growth hormone receptor signaling pathway [GO:0060396]; positive regulation of growth [GO:0045927]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; response to nutrient level... | endosome lumen [GO:0031904]; extracellular region [GO:0005576]; extracellular space [GO:0005615] | growth factor activity [GO:0008083]; growth hormone receptor binding [GO:0005131]; hormone activity [GO:0005179] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. | Homo sapiens (Human) |
P01244 | SOMA_RAT | MAADSQTPWLLTFSLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF | null | null | animal organ development [GO:0048513]; bone maturation [GO:0070977]; cellular response to alkaline pH [GO:0071469]; cellular response to insulin stimulus [GO:0032869]; cellular response to thyroid hormone stimulus [GO:0097067]; cytokine-mediated signaling pathway [GO:0019221]; female pregnancy [GO:0007565]; growth horm... | collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; growth hormone receptor complex [GO:0070195]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; secretory granule [GO:0030141]; trans-Golgi network [GO:0005802] | cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; growth hormone activity [GO:0070186]; growth hormone receptor binding [GO:0005131]; hormone activity [GO:0005179]; metal ion binding [GO:0046872]; prolactin receptor binding [GO:0005148] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. | Rattus norvegicus (Rat) |
P01246 | SOMA_BOVIN | MMAAGPRTSLLLAFALLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF | null | null | animal organ development [GO:0048513]; cell population proliferation [GO:0008283]; growth hormone receptor signaling pathway [GO:0060396]; insulin secretion [GO:0030073]; negative regulation of apoptotic process [GO:0043066]; negative regulation of fatty acid biosynthetic process [GO:0045717]; negative regulation of ge... | extracellular space [GO:0005615] | growth factor activity [GO:0008083]; growth hormone activity [GO:0070186]; growth hormone receptor binding [GO:0005131]; hormone activity [GO:0005179]; metal ion binding [GO:0046872] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. | Bos taurus (Bovine) |
P01248 | SOMA_PIG | MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF | null | null | animal organ development [GO:0048513]; growth hormone receptor signaling pathway [GO:0060396]; positive regulation of growth [GO:0045927]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of tyrosine phosphoryla... | extracellular space [GO:0005615] | growth factor activity [GO:0008083]; growth hormone activity [GO:0070186]; growth hormone receptor binding [GO:0005131]; hormone activity [GO:0005179]; metal ion binding [GO:0046872] | PF00103; | 1.20.1250.10; | Somatotropin/prolactin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. | Sus scrofa (Pig) |
P01256 | CALCA_RAT | MGFLKFSPFLVVSILLLYQACGLQAVPLRSTLESSPGMAATLSEEEARLLLAALVQNYMQMKVRELEQEQEAEGSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; artery vasodilation involved in baroreceptor response to increased systemic arterial blood pressure [GO:0001984]; calcitonin gene-related peptide receptor signaling pathway [GO:1990408]; cell adhesion [GO:0007155]; cellular response... | axon [GO:0030424]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; neuronal dense core vesicle [GO:0098992]; terminal bouton [GO:0043195] | calcitonin receptor binding [GO:0031716]; identical protein binding [GO:0042802]; neuropeptide hormone activity [GO:0005184]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102] | PF00214; | 6.10.250.2190; | Calcitonin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. | Rattus norvegicus (Rat) |
P01257 | CALC_RAT | MGFLKFSPFLVVSILLLYQACGLQAVPLRSTLESSPGMATLSEEEARLLAALVQNYMQMKVRELEQEEEQEAEGSSLDSPRSKRCGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAPGKKRDMAKDLETNHHPYFGN | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; artery vasodilation involved in baroreceptor response to increased systemic arterial blood pressure [GO:0001984]; calcitonin gene-related peptide receptor signaling pathway [GO:1990408]; cell adhesion [GO:0007155]; cellular response... | axon [GO:0030424]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; neuronal dense core vesicle [GO:0098992]; terminal bouton [GO:0043195] | calcitonin receptor binding [GO:0031716]; identical protein binding [GO:0042802]; neuropeptide hormone activity [GO:0005184]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102] | PF00214; | null | Calcitonin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. | Rattus norvegicus (Rat) |
P01258 | CALC_HUMAN | MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN | null | null | activation of protein kinase activity [GO:0032147]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; artery vasodilation involved in baroreceptor response to increased systemic arterial blood pressure [GO:0001984]; cellular response to nerve growth factor stimulus [GO:1990090]; ce... | extracellular region [GO:0005576]; extracellular space [GO:0005615]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; neuronal cell body [GO:0043025]; neuronal dense core vesicle [GO:0098992]; terminal bouton [GO:0043195] | calcitonin receptor binding [GO:0031716]; hormone activity [GO:0005179]; identical protein binding [GO:0042802] | PF00214; | null | Calcitonin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.; FUNCTION: Katacalcin is a potent plasma calcium-lowering peptide. | Homo sapiens (Human) |
P01266 | THYG_HUMAN | MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTKCEVERFTATSFGHPYVPSCR... | null | null | hormone biosynthetic process [GO:0042446]; iodide transport [GO:0015705]; regulation of myelination [GO:0031641]; signal transduction [GO:0007165]; thyroid gland development [GO:0030878]; thyroid hormone generation [GO:0006590] | extracellular region [GO:0005576]; extracellular space [GO:0005615] | hormone activity [GO:0005179]; identical protein binding [GO:0042802] | PF00135;PF07699;PF00086; | 3.40.50.1820;4.10.800.10;2.10.50.10; | Type-B carboxylesterase/lipase family | PTM: Iodinated on tyrosine residues by TPO (PubMed:2760035, PubMed:32025030). There are 4 pairs of iodinated tyrosines used for coupling: acceptor Tyr-24 is coupled to donor Tyr-149 or Tyr-234, acceptor Tyr-2573 is coupled to donor Tyr-2540, acceptor Tyr-2766 in monomer 1 is coupled to donor Tyr-2766 in monomer 2 and a... | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11082042, ECO:0000269|PubMed:19509106, ECO:0000269|PubMed:8626858}. Note=Secreted into the thyroid follicle lumen (PubMed:19509106). Localizes to colloid globules, a structure formed in the thyroid follicle lumen consisting of cross-linked TG arranged in concentric lay... | null | null | null | null | null | FUNCTION: Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (PubMed:17532758, PubMed:32025030). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen ... | Homo sapiens (Human) |
P01267 | THYG_BOVIN | MALALWVFGLLDLICLASANIFEYQVDAQPLRPCELQRERAFLKREDYVPQCAEDGSFQTVQCGKDGASCWCVDADGREVPGSRQPGRPAACLSFCQLQKQQILLSSYINSTATSYLPQCQDSGDYSPVQCDLRRRQCWCVDAEGMEVYGTRQQGRPARCPRSCEIRNRRLLHGVGDRSPPQCSPDGAFRPVQCKLVNTTDMMIFDLVHSYSRFPDAFVTFSSFRSRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDLASTFAETTLYRILQRRFLAVQLVISGRFRCPTKCEVERFAATSFRHPYVPSCH... | null | null | hormone biosynthetic process [GO:0042446]; thyroid hormone generation [GO:0006590] | extracellular space [GO:0005615] | histone binding [GO:0042393]; hormone activity [GO:0005179] | PF00135;PF07699;PF00086; | 3.40.50.1820;4.10.800.10;2.10.50.10; | Type-B carboxylesterase/lipase family | PTM: Iodinated on tyrosine residues by TPO (By similarity). There are 4 pairs of iodinated tyrosines used for coupling: acceptor Tyr-24 is coupled to donor Tyr-149 or Tyr-234, acceptor Tyr-2574 is coupled to donor Tyr-2541, acceptor Tyr-2767 in monomer 1 is coupled to donor Tyr-2767 in monomer 2 and acceptor Tyr-1310 i... | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:O08710}. Note=Secreted into the thyroid follicle lumen. Localizes to colloid globules, a structure formed in the thyroid follicle lumen consisting of cross-linked TG arranged in concentric layers. {ECO:0000250|UniProtKB:O08710}. | null | null | null | null | null | FUNCTION: Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (By similarity). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling (By similarity). Following TG re-internalization ... | Bos taurus (Bovine) |
P01268 | PTHY_BOVIN | MMSAKDMVKVMIVMLAICFLARSDGKSVKKRAVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGASIAYRDGSSQRPRKKEDNVLVESHQKSLGEADKADVDVLIKAKPQ | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; bone mineralization [GO:0030282]; cell-cell signaling [GO:0007267]; homeostasis of number of cells within a tissue [GO:0048873]; intracellular calcium ion homeostasis [GO:0006874]; magnesium ion homeostasis [GO:0010960]; negative re... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; parathyroid hormone receptor binding [GO:0031856]; peptide hormone receptor binding [GO:0051428]; type 1 parathyroid hormone receptor binding [GO:0031857] | PF01279; | null | Parathyroid hormone family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). {ECO:0000250}. | Bos taurus (Bovine) |
P01269 | PTHY_PIG | MMSAKDTVKVMVVMLAICFLARSDGKPIKKRSVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNFVALGASIVHRDGGSQRPRKKEDNVLVESHQKSLGEADKAAVDVLIKAKPQ | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; bone mineralization [GO:0030282]; cell-cell signaling [GO:0007267]; homeostasis of number of cells within a tissue [GO:0048873]; intracellular calcium ion homeostasis [GO:0006874]; magnesium ion homeostasis [GO:0010960]; negative re... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; parathyroid hormone receptor binding [GO:0031856]; peptide hormone receptor binding [GO:0051428]; type 1 parathyroid hormone receptor binding [GO:0031857] | PF01279; | null | Parathyroid hormone family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). {ECO:0000250}. | Sus scrofa (Pig) |
P01270 | PTHY_HUMAN | MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ | null | null | activation of phospholipase C activity [GO:0007202]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; bone mineralization [GO:0030282]; bone resorption [GO:0045453]; cAMP metabolic process [GO:0046058]; cell-cell signaling [GO:0007267]; G protein-coupled receptor signaling pathway... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | hormone activity [GO:0005179]; parathyroid hormone receptor binding [GO:0031856]; peptide hormone receptor binding [GO:0051428]; receptor ligand activity [GO:0048018]; type 1 parathyroid hormone receptor binding [GO:0031857] | PF01279; | null | Parathyroid hormone family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. {ECO:0000269|PubMed:21076856}. | Homo sapiens (Human) |
P01272 | GLUC_BOVIN | MKSLYFVAGLFVMLVQGSWQRSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVNIVEELRRRHADGSFSDEMNTVLDSLATRDFINWLLQTKITDRK | null | null | adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]; glucose homeostasis [GO:0042593]; lactate biosynthetic process [GO:0019249]; lipid biosynthetic process [GO:0008610]; negative regulation of apoptotic process [GO:0043066]; positive regulation of gluconeogenesis [GO:0045722]; positi... | extracellular space [GO:0005615] | glucagon receptor binding [GO:0031769]; hormone activity [GO:0005179] | PF00123; | 6.10.250.590; | Glucagon family | PTM: Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-te... | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01275}.; SUBCELLULAR LOCATION: [Glucagon-like peptide 1]: Secreted {ECO:0000250|UniProtKB:P01275}. | null | null | null | null | null | FUNCTION: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maint... | Bos taurus (Bovine) |
P01274 | GLUC_PIG | MKTIYFVAGLFVMLVQGSWQRSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVTIVEELRRRHADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL | null | null | adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]; glucose homeostasis [GO:0042593]; negative regulation of apoptotic process [GO:0043066]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]; protein kinase A signaling [GO:0010737... | extracellular space [GO:0005615] | glucagon receptor binding [GO:0031769]; hormone activity [GO:0005179] | PF00123; | 6.10.250.590; | Glucagon family | PTM: Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-te... | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01275}.; SUBCELLULAR LOCATION: [Glucagon-like peptide 1]: Secreted {ECO:0000250|UniProtKB:P01275}. | null | null | null | null | null | FUNCTION: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maint... | Sus scrofa (Pig) |
P01275 | GLUC_HUMAN | MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]; cellular response to glucagon stimulus [GO:0071377]; feeding behavior [GO:0007631]; G protein-coupled receptor signaling pathway [GO:0007186]; g... | endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; secretory granule lumen [GO:0034774] | glucagon receptor binding [GO:0031769]; hormone activity [GO:0005179]; identical protein binding [GO:0042802]; signaling receptor binding [GO:0005102] | PF00123; | 6.10.250.590; | Glucagon family | PTM: Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-te... | SUBCELLULAR LOCATION: Secreted {ECO:0000305}.; SUBCELLULAR LOCATION: [Glucagon-like peptide 1]: Secreted {ECO:0000269|PubMed:22037645}. | null | null | null | null | null | FUNCTION: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maint... | Homo sapiens (Human) |
P01282 | VIP_HUMAN | MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; body fluid secretion [GO:0007589]; epinephrine secretion [GO:0048242]; G protein-coupled receptor signaling pathway [GO:0007186]; learning or memory [GO:0007611]; mRNA stabilization [GO:0048255]; negative regulation of apoptotic pro... | extracellular region [GO:0005576]; neuron projection [GO:0043005] | hormone activity [GO:0005179]; neuropeptide hormone activity [GO:0005184]; peptide hormone receptor binding [GO:0051428] | PF00123; | 6.10.250.590; | Glucagon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder. {ECO:0000269|PubMed:15013843}.; FUNCTION: PHM and PHV also cause vasodilation. PHM-27 is a potent agonist of the calcitonin... | Homo sapiens (Human) |
P01283 | VIP_RAT | MESRSKPQFLAILTLFSVLFSQSLAWPLYGPPSSVRLDDRLQFEGAGDPDQVSLKADSDILQNALAENDTPYYDVSRNARHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGDSPDFLEELEK | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; epinephrine secretion [GO:0048242]; learning or memory [GO:0007611]; mRNA stabilization [GO:0048255]; negative regulation of apoptotic process [GO:0043066]; negative regulation of potassium ion transport [GO:0043267]; negative regul... | extracellular region [GO:0005576]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025] | hormone activity [GO:0005179]; neuropeptide hormone activity [GO:0005184]; peptide hormone receptor binding [GO:0051428]; signaling receptor binding [GO:0005102] | PF00123; | 6.10.250.590; | Glucagon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; FUNCTION: PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin (By similarity)... | Rattus norvegicus (Rat) |
P01284 | VIP_PIG | HADGVFTSDFSRLLGQLSAKKYLESLIXXXXXXXXXXXXXXXXXHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR | null | null | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; epinephrine secretion [GO:0048242]; learning or memory [GO:0007611]; mRNA stabilization [GO:0048255]; negative regulation of apoptotic process [GO:0043066]; negative regulation of potassium ion transport [GO:0043267]; negative regul... | extracellular region [GO:0005576]; neuron projection [GO:0043005] | hormone activity [GO:0005179]; neuropeptide hormone activity [GO:0005184]; peptide hormone receptor binding [GO:0051428] | PF00123; | 6.10.250.590; | Glucagon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; FUNCTION: PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin (By similarity)... | Sus scrofa (Pig) |
P01286 | SLIB_HUMAN | MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG | null | null | adenohypophysis development [GO:0021984]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cell-cell signaling [GO:0007267]; growth hormone secretion [GO:0030252]; multicellular organism growth [GO:0035264]; positive regulation of cell population proliferation [GO:0008284]; positi... | extracellular region [GO:0005576]; extracellular space [GO:0005615]; perikaryon [GO:0043204]; terminal bouton [GO:0043195] | growth hormone-releasing hormone activity [GO:0016608]; growth hormone-releasing hormone receptor binding [GO:0031770]; neuropeptide hormone activity [GO:0005184]; peptide hormone receptor binding [GO:0051428] | PF00123; | null | Glucagon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. | Homo sapiens (Human) |
P01289 | TKN1_BOVIN | MKILVAVAVIFFISTQLSAEEIGANDDFNYWSDWSDSDQIKEEMPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQLSHKRHKTDSFVGLMGKRALNSVAYERSVMQDYERRRK | null | null | chemical synaptic transmission [GO:0007268]; inflammatory response [GO:0006954]; neuropeptide signaling pathway [GO:0007218]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; response to pain [GO:0048265]; sensory perception of pain [GO:0019233]; tachykinin receptor signaling pathway [GO:0007217... | axon [GO:0030424]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; neuronal cell body [GO:0043025]; synapse [GO:0045202] | substance P receptor binding [GO:0031835] | PF02202; | null | Tachykinin family | PTM: [Substance P]: The substance P form is cleaved at Pro-59 by the prolyl endopeptidase FAP (seprase) activity (in vitro). Substance P is also cleaved and degraded by Angiotensin-converting enzyme (ACE) and neprilysin (MME). {ECO:0000250|UniProtKB:P20366}. | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. | Bos taurus (Bovine) |
P01297 | NMB_PIG | MTLRARGARLLGGLLFFTLLAAGAAPLSWDLPEPRSRAGKIRVHPRGNLWATGHFMGKKSLEPPNPSLLGTTHHISLRDQRLQLSHDLLRILLQKKALGLSLSGPASHTPYRRLLVQTLEK | null | null | antiviral innate immune response [GO:0140374]; Leydig cell proliferation [GO:0160024]; negative regulation of interleukin-6 production [GO:0032715]; neuropeptide signaling pathway [GO:0007218]; positive regulation of interferon-alpha production [GO:0032727]; positive regulation of osteoclast proliferation [GO:0090290];... | extracellular space [GO:0005615]; neuron projection [GO:0043005] | neuromedin B receptor binding [GO:0031710]; neuropeptide hormone activity [GO:0005184] | PF02044; | null | Bombesin/neuromedin-B/ranatensin family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q9CR53}. Cell projection, neuron projection {ECO:0000250|UniProtKB:Q9CR53}. Note=In neurons of the retrotrapezoid nucleus//parafacial respiratory group, expressed on neuron projections which project into the pre-Botzinger complex. {ECO:0000250|UniProtKB:Q9CR53}. | null | null | null | null | null | FUNCTION: Stimulates smooth muscle contraction (PubMed:6882442). Induces sighing by acting directly on the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during respiratory activity (By similarity). Contributes to the induction of sneezing following... | Sus scrofa (Pig) |
P01298 | PAHO_HUMAN | MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL | null | null | feeding behavior [GO:0007631]; neuropeptide signaling pathway [GO:0007218]; protein secretion [GO:0009306] | cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615] | G protein-coupled receptor binding [GO:0001664]; hormone activity [GO:0005179]; neuropeptide hormone activity [GO:0005184]; neuropeptide Y receptor binding [GO:0031841] | PF00159; | 6.10.250.900; | NPY family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:7493937, ECO:0000269|PubMed:7592911, ECO:0000269|PubMed:828120}. | null | null | null | null | null | FUNCTION: [Pancreatic polypeptide]: Hormone secreted by pancreatic cells that acts as a regulator of pancreatic and gastrointestinal functions probably by signaling through the G protein-coupled receptor NPY4R2. {ECO:0000269|PubMed:7493937, ECO:0000269|PubMed:7592911}. | Homo sapiens (Human) |
P01303 | NPY_HUMAN | MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW | null | null | adult feeding behavior [GO:0008343]; central nervous system neuron development [GO:0021954]; cerebral cortex development [GO:0021987]; chemical synaptic transmission [GO:0007268]; feeding behavior [GO:0007631]; G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger [GO:0007187]; int... | extracellular region [GO:0005576]; extracellular space [GO:0005615]; GABA-ergic synapse [GO:0098982]; Golgi apparatus [GO:0005794]; neuronal dense core vesicle [GO:0098992] | calcium channel regulator activity [GO:0005246]; G protein-coupled receptor activity [GO:0004930]; neuropeptide hormone activity [GO:0005184]; neuropeptide Y receptor binding [GO:0031841]; signaling receptor binding [GO:0005102] | PF00159; | 6.10.250.900; | NPY family | PTM: The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). {ECO:0000269|PubMed:21314817}. | SUBCELLULAR LOCATION: Secreted. Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle {ECO:0000250|UniProtKB:P07808}. | null | null | null | null | null | FUNCTION: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. | Homo sapiens (Human) |
P01308 | INS_HUMAN | MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN | null | null | activation of protein kinase B activity [GO:0032148]; acute-phase response [GO:0006953]; alpha-beta T cell activation [GO:0046631]; cell-cell signaling [GO:0007267]; cognition [GO:0050890]; fatty acid homeostasis [GO:0055089]; G protein-coupled receptor signaling pathway [GO:0007186]; glucose homeostasis [GO:0042593]; ... | endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; endosome lumen [GO:0031904]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi lumen [GO:0005796]; Golgi membrane [GO:0000139]; secretory granule lumen [GO:0034774]; transport v... | hormone activity [GO:0005179]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159]; protease binding [GO:0002020] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Homo sapiens (Human) |
P01315 | INS_PIG | MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAENPQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN | null | null | glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; glycoprotein biosynthetic process [GO:0009101]; insulin receptor signaling pathway [GO:0008286]; lactate biosynthetic process [GO:0019249]; lipid biosynthetic process [GO:0008610]; lipoprotein biosynthetic process [GO:0042158]; negative regulatio... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Sus scrofa (Pig) |
P01317 | INS_BOVIN | MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN | null | null | estradiol secretion [GO:0035938]; feeding behavior [GO:0007631]; glucose homeostasis [GO:0042593]; glucose import in response to insulin stimulus [GO:0044381]; glucose metabolic process [GO:0006006]; negative regulation of apoptotic process [GO:0043066]; negative regulation of appetite [GO:0032099]; negative regulation... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Bos taurus (Bovine) |
P01322 | INS1_RAT | MALWMRFLPLLALLVLWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN | null | null | cellular response to glucose stimulus [GO:0071333]; cellular response to oxygen-containing compound [GO:1901701]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; insulin receptor signaling pathway [GO:0008286]; positive regulation of protein secretion [GO:0050714]; receptor internalization [GO... | cytosol [GO:0005829]; extracellular space [GO:0005615] | hormone activity [GO:0005179]; insulin receptor binding [GO:0005158] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Rattus norvegicus (Rat) |
P01323 | INS2_RAT | MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN | null | null | acute-phase response [GO:0006953]; alpha-beta T cell activation [GO:0046631]; ER overload response [GO:0006983]; fatty acid homeostasis [GO:0055089]; G protein-coupled receptor signaling pathway [GO:0007186]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; insulin processing [GO:0030070]; insu... | cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular space [GO:0005615]; nucleus [GO:0005634]; secretory granule [GO:0030141]; sno(s)RNA-containing ribonucleoprotein complex [GO:0005732] | hormone activity [GO:0005179]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159]; protease binding [GO:0002020]; zinc ion binding [GO:0008270] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Rattus norvegicus (Rat) |
P01325 | INS1_MOUSE | MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN | null | null | cellular response to glucose stimulus [GO:0071333]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; glucose transmembrane transport [GO:1904659]; insulin receptor signaling pathway [GO:0008286]; positive regulation of protein secretion [GO:0050714]; receptor internalization [GO:0031623]; respo... | collagen-containing extracellular matrix [GO:0062023]; cytosol [GO:0005829]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; secretory granule lumen [GO:0034774] | hormone activity [GO:0005179]; insulin receptor binding [GO:0005158]; receptor ligand activity [GO:0048018]; transmembrane receptor protein tyrosine kinase activator activity [GO:0030297] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Mus musculus (Mouse) |
P01326 | INS2_MOUSE | MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN | null | null | ER overload response [GO:0006983]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; glucose transmembrane transport [GO:1904659]; insulin processing [GO:0030070]; insulin receptor signaling pathway [GO:0008286]; intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress [... | collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; secretory granule [GO:0030141]; secretory granule lumen [GO:0034774]; sno(s)RNA-contai... | hormone activity [GO:0005179]; insulin receptor binding [GO:0005158]; receptor ligand activity [GO:0048018]; transmembrane receptor protein tyrosine kinase activator activity [GO:0030297]; zinc ion binding [GO:0008270] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Mus musculus (Mouse) |
P01329 | INS_CAVPO | MALWMHLLTVLALLALWGPNTGQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELEDPQVEQTELGMGLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN | null | null | acute-phase response [GO:0006953]; alpha-beta T cell activation [GO:0046631]; fatty acid homeostasis [GO:0055089]; G protein-coupled receptor signaling pathway [GO:0007186]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; insulin receptor signaling pathway [GO:0008286]; negative regulation of ... | extracellular space [GO:0005615] | hormone activity [GO:0005179]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159]; protease binding [GO:0002020] | PF00049; | 1.10.100.10; | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Cavia porcellus (Guinea pig) |
P01344 | IGF2_HUMAN | MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK | null | null | animal organ morphogenesis [GO:0009887]; embryonic placenta development [GO:0001892]; embryonic placenta morphogenesis [GO:0060669]; exocrine pancreas development [GO:0031017]; genomic imprinting [GO:0071514]; glucose metabolic process [GO:0006006]; in utero embryonic development [GO:0001701]; insulin receptor signalin... | extracellular region [GO:0005576]; extracellular space [GO:0005615]; platelet alpha granule lumen [GO:0031093] | growth factor activity [GO:0008083]; hormone activity [GO:0005179]; insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159]; integrin binding [GO:0005178]; protein serine/threonine kinase activator activity [GO:0043539]; receptor ligand activity [GO:0048018]; transmembrane recept... | PF08365;PF00049; | 1.10.100.10; | Insulin family | PTM: O-glycosylated with core 1 or possibly core 8 glycans. Thr-96 is a minor glycosylation site compared to Thr-99. {ECO:0000269|PubMed:1569071, ECO:0000269|PubMed:19838169, ECO:0000269|PubMed:22171320, ECO:0000269|PubMed:23234360}.; PTM: Proteolytically processed by PCSK4, proIGF2 is cleaved at Arg-128 and Arg-92 to ... | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:16040806}. | null | null | null | null | null | FUNCTION: The insulin-like growth factors possess growth-promoting activity (By similarity). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in ad... | Homo sapiens (Human) |
P01346 | IGF2_RAT | MGIPVGKSMLVLLISLAFALCCIAAYRPSETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRLRRGLPALLRARRGRMLAKELEAFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ | null | null | animal organ morphogenesis [GO:0009887]; cellular response to mechanical stimulus [GO:0071260]; embryonic placenta development [GO:0001892]; embryonic placenta morphogenesis [GO:0060669]; exocrine pancreas development [GO:0031017]; female pregnancy [GO:0007565]; glucose metabolic process [GO:0006006]; in utero embryoni... | extracellular space [GO:0005615] | growth factor activity [GO:0008083]; hormone activity [GO:0005179]; insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159]; integrin binding [GO:0005178]; protein serine/threonine kinase activator activity [GO:0043539]; receptor ligand activity [GO:0048018]; transmembrane recept... | PF08365;PF00049; | 1.10.100.10; | Insulin family | PTM: Proteolytically processed by PCSK4, proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2. {ECO:0000250|UniProtKB:P01344}. | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01344, ECO:0000250|UniProtKB:P09535}. | null | null | null | null | null | FUNCTION: The insulin-like growth factors possess growth-promoting activity (By similarity). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in ad... | Rattus norvegicus (Rat) |
P01347 | REL1_RAT | MSSRLLLQLLGFWLFLSQPCRARVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLALSQEEPAPLARQATAEVVPSFINKDAEPFDMTLKCLPNLSEERKAALSEGRAPFPELQQHAPALSDSVVSLEGFKKTFHNQLGEAEDGGPPELKYLGSDAQSRKKRQSGALLSEQCCHIGCTRRSIAKLC | null | null | adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]; developmental growth [GO:0048589]; mammary gland morphogenesis [GO:0060443]; negative regulation of apoptotic process [GO:0043066]; nipple development [GO:0060618]; prostate gland growth [GO:0060736]; regulation of apoptotic process... | extracellular region [GO:0005576] | hormone activity [GO:0005179]; signaling receptor binding [GO:0005102] | PF00049; | null | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. | Rattus norvegicus (Rat) |
P01348 | RELX_PIG | MPRLFSYLLGVWLLLSQLPREIPGQSTNDFIKACGRELVRLWVEICGSVSWGRTALSLEEPQLETGPPAETMPSSITKDAEILKMMLEFVPNLPQELKATLSERQPSLRELQQSASKDSNLNFEEFKKIILNRQNEAEDKSLLELKNLGLDKHSRKKRLFRMTLSEKCCQVGCIRKDIARLC | null | null | blastocyst growth [GO:0001832]; flagellated sperm motility [GO:0030317]; oocyte maturation [GO:0001556]; positive regulation of acrosome reaction [GO:2000344]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of glucose import [GO:0046326] | extracellular region [GO:0005576] | hormone activity [GO:0005179] | PF00049; | null | Insulin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. | Sus scrofa (Pig) |
P01350 | GAST_HUMAN | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN | null | null | G protein-coupled receptor signaling pathway [GO:0007186]; response to food [GO:0032094]; signal transduction [GO:0007165] | extracellular region [GO:0005576]; extracellular space [GO:0005615] | hormone activity [GO:0005179] | PF00918; | null | Gastrin/cholecystokinin family | PTM: Two different processing pathways probably exist in antral G-cells. In the dominant pathway progastrin is cleaved at three sites resulting in two major bioactive gastrins, gastrin-34 and gastrin-17. In the putative alternative pathway, progastrin may be processed only at the most C-terminal dibasic site resulting ... | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine. | Homo sapiens (Human) |
P01355 | CCKN_RAT | MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS | null | null | axonogenesis [GO:0007409]; cholecystokinin signaling pathway [GO:0038188]; digestion [GO:0007586]; eating behavior [GO:0042755]; memory [GO:0007613]; negative regulation of appetite [GO:0032099]; negative regulation of behavioral fear response [GO:2000986]; negative regulation of eating behavior [GO:1903999]; neuron mi... | axon [GO:0030424]; axon hillock [GO:0043203]; axon initial segment [GO:0043194]; dendrite [GO:0030425]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; GABA-ergic synapse [GO:0098982]; neuronal cell body [GO:0043025]; perikaryon [GO:0043204]; terminal bouton [GO:0043195] | hormone activity [GO:0005179]; neuropeptide hormone activity [GO:0005184]; peptide hormone receptor binding [GO:0051428]; receptor ligand activity [GO:0048018] | PF00918; | null | Gastrin/cholecystokinin family | PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins.; PTM: Sulfation of Tyr-97 is essential for receptor activation. {ECO:0000269|PubMed:8208365, ECO:0000269|Ref.5}. | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P09240}. | null | null | null | null | null | FUNCTION: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. {ECO:0000303|PubMed:12479974}. | Rattus norvegicus (Rat) |
P01362 | ELH1_APLCA | MKRPNNRPTNTMSLILCLTLSSLCVSSQSASVHGKNFATNRAVKSSSPFVVLSPDDNVVSMSGENGYRSALREAFDKSSRDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDLRAPRLRFYSLRKRAAGGMEQSEGQNPETESHSRRKRSVLTPSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKGKRSSGVSLLTSNKDEEQRELLKAISNLLD | null | null | neuropeptide signaling pathway [GO:0007218] | extracellular region [GO:0005576] | hormone activity [GO:0005179] | PF02323; | null | Molluscan ELH family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string.; FUNCTION: Alpha-BCP de... | Aplysia californica (California sea hare) |
P01374 | TNFB_HUMAN | MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL | null | null | apoptotic process [GO:0006915]; cell-cell signaling [GO:0007267]; defense response to Gram-positive bacterium [GO:0050830]; humoral immune response [GO:0006959]; lymph node development [GO:0048535]; negative regulation of fibroblast proliferation [GO:0048147]; positive regulation of apoptotic process [GO:0043065]; posi... | extracellular space [GO:0005615]; plasma membrane [GO:0005886] | cytokine activity [GO:0005125]; signaling receptor binding [GO:0005102]; tumor necrosis factor receptor binding [GO:0005164] | PF00229; | 2.60.120.40; | Tumor necrosis factor family | null | SUBCELLULAR LOCATION: Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated. | null | null | null | null | null | FUNCTION: Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM (PubMed:9462508). In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. {ECO:0000269|PubMed:946250... | Homo sapiens (Human) |
P01375 | TNFA_HUMAN | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL | null | null | activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; antiviral innate immune response [GO:0140374]; astrocyte activation [GO:0048143]; calcium-mediated signaling [GO:0019722]; cellular response to amino acid stimulus [GO:0071230]; cellular response to amyloid-beta [GO:1904646];... | cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; membrane raft [GO:0045121]; neuronal cell body [GO:0043025]; phagocytic cup [GO:0001891]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037] | cytokine activity [GO:0005125]; death receptor agonist activity [GO:0038177]; identical protein binding [GO:0042802]; protease binding [GO:0002020]; transcription cis-regulatory region binding [GO:0000976]; tumor necrosis factor receptor binding [GO:0005164] | PF00229; | 2.60.120.40; | Tumor necrosis factor family | PTM: The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secre... | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:16829952}; Single-pass type II membrane protein {ECO:0000269|PubMed:16829952}.; SUBCELLULAR LOCATION: [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; SUBCELLULAR LOCATION: [Tumor necrosis factor, soluble form]: Secreted {EC... | null | null | null | null | null | FUNCTION: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain c... | Homo sapiens (Human) |
P01391 | 3L21_NAJKA | IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP | null | null | null | extracellular region [GO:0005576] | acetylcholine receptor inhibitor activity [GO:0030550]; ion channel regulator activity [GO:0099106]; toxin activity [GO:0090729] | null | 2.10.60.10; | Snake three-finger toxin family, Long-chain subfamily, Type II alpha-neurotoxin sub-subfamily | PTM: In homodimer alpha-cobratoxin, selective reduction of Cys(26)-Cys(30) in one subunit does not affect the activity against the alpha-7/CHRNA7 nAChR, whereas its reduction in both subunits almost prevents alpha-7/CHRNA7 nAChR recognition. On the contrary, reduction of one or both Cys(26)-Cys(30) disulfide bonds in t... | SUBCELLULAR LOCATION: Secreted {ECO:0000269|Ref.1}. | null | null | null | null | null | FUNCTION: Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta/CHRNA1-CHRNB1-CHRNG-CHRND) nAChR (tested on Torpedo californica, Kd=0.2-4.5 nM) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (Kd=13-105 nM) (PubMed:18381281, PubMed:22223648, PubMed:9305882). Also inhibits GABA(A) chann... | Naja kaouthia (Monocled cobra) (Naja siamensis) |
P01398 | 3LKB_BUNMU | MKTLLLTLVVVTIVCLDLGYTRTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH | null | null | null | extracellular region [GO:0005576] | acetylcholine receptor inhibitor activity [GO:0030550]; ion channel regulator activity [GO:0099106]; toxin activity [GO:0090729] | null | 2.10.60.10; | Snake three-finger toxin family, Long-chain subfamily, Kappa-neurotoxin sub-subfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:3986193}. | null | null | null | null | null | FUNCTION: Postsynaptic neurotoxin that binds and inhibits neuronal nicotinic acetylcholine receptors (nAChR) with high affinity (IC(50)<100 nM). Is a selective, and slowly reversible antagonist of alpha-3/CHRNA3-containing and some alpha-4/CHRNA4-containing AChRs. {ECO:0000269|PubMed:3986193, ECO:0000303|PubMed:9027980... | Bungarus multicinctus (Many-banded krait) |
P01445 | 3SA7A_NAJKA | LKCNKLIPLAYKTCPAGKNLCYKMFMVSNKTVPVKRGCIDVCPKNSLLVKYVCCNTDRCN | null | null | killing of cells of another organism [GO:0031640] | extracellular region [GO:0005576]; membrane [GO:0016020]; other organism cell membrane [GO:0044218] | toxin activity [GO:0090729] | null | 2.10.60.10; | Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:33915327, ECO:0000269|PubMed:7210030}. Target cell membrane {ECO:0000250|UniProtKB:P60301}. | null | null | null | null | null | FUNCTION: Monomer: shows cytolytic activity. {ECO:0000269|PubMed:18381281}.; FUNCTION: Heterodimer: has no cytolytic activity, but retains most of the alpha-cobratoxin capacity to compete with alpha-bungarotoxin for binding to Torpedo and alpha-7/CHRNA7 nicotinic acetylcholine receptors (nAChRs) as well as to Lymnea st... | Naja kaouthia (Monocled cobra) (Naja siamensis) |
P01446 | 3SA3_NAJKA | LKCNKLIPLAYKTCPAGKNLCYKMFMVSNKTVPVKRGCIDACPKNSLLVKYVCCNTDRCN | null | null | killing of cells of another organism [GO:0031640]; modulation of process of another organism [GO:0035821] | extracellular region [GO:0005576]; membrane [GO:0016020]; other organism cell membrane [GO:0044218] | toxin activity [GO:0090729] | null | 2.10.60.10; | Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily | PTM: May be regulated by glycosylation. {ECO:0000269|PubMed:15128311}. | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:33263003, ECO:0000269|PubMed:33915327, ECO:0000269|PubMed:7210030}. Target cell membrane {ECO:0000250|UniProtKB:P60301}. | null | null | null | null | null | FUNCTION: Heterodimer: has no cytolytic activity, but retains most of the alpha-cobratoxin capacity to compete with alpha-bungarotoxin for binding to Torpedo and alpha-7/CHRNA7 nicotinic acetylcholine receptors (nAChRs) as well as to Lymnea stagnalis acetylcholine-binding protein. {ECO:0000269|PubMed:18381281}.; FUNCTI... | Naja kaouthia (Monocled cobra) (Naja siamensis) |
P01484 | SCX2_ANDAU | MNYLVMISLALLFVTGVESVKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCHGR | null | null | defense response [GO:0006952] | extracellular region [GO:0005576] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF00537; | 3.30.30.10; | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily | PTM: The amidation of His-83 is not necessary for toxicity. {ECO:0000269|PubMed:15725394}. | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:4342910}. | null | null | null | null | null | FUNCTION: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels (PubMed:23685008). It is active on rat brain Nav1.2/S... | Androctonus australis (Sahara scorpion) |
P01485 | SCX3_BUTOC | LVMAGVESVKDGYIVDDRNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKVPDHVRTKGPGRCN | null | null | defense response [GO:0006952] | extracellular region [GO:0005576] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF00537; | 3.30.30.10; | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily | PTM: When the toxin is not amidated, there are 75% loss of toxicity to mice, and total incapacity to bind rat brain synaptosomes. {ECO:0000269|PubMed:15062995}. | SUBCELLULAR LOCATION: Secreted {ECO:0000269|Ref.2}. | null | null | null | null | null | FUNCTION: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. Is active against mammals and binds with high affinity to rat brain synaptosomes. {ECO:0000269|PubMed:15062995}. | Buthus occitanus tunetanus (Common European scorpion) (Buthus tunetanus) |
P01489 | SCX4_LEIQU | GVRDAYIADDKNCVYTCGSNSYCNTECTKNGAESGYCQWLGKYGNACWCIKLPDKVPIRIPGKCR | null | null | defense response [GO:0006952] | extracellular region [GO:0005576] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF00537; | 3.30.30.10; | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily | PTM: The recombinant toxin which is used for activity tests is not amidated (PubMed:37501371). However, C-terminal amidation does not appear to play an important role in activity, since the non-amidated recombinant toxin and the native toxin (which is amidated) show similar activities on all sodium channels tested. {EC... | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:37501371, ECO:0000269|Ref.1}. | null | null | null | null | null | FUNCTION: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. Both native and recombinant (non-amidated) toxins inhibit inactivation of Nav1.2/SCN2A (EC(50)=31.2-36.6 nM), Nav1.6/SCN8A (EC(50)=6.9-8.9 ... | Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion) |
P01492 | SCX1_CENSC | MNSLLIITACFALVGTVWAKEGYLVKKSDGCKYDCFWLGKNEHCDTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCGKK | null | null | defense response [GO:0006952] | extracellular region [GO:0005576] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF00537; | 3.30.30.10; | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:4460885}. | null | null | null | null | null | FUNCTION: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing (By similarity). Induces immediate paralysis in crickets after injection, wi... | Centruroides sculpturatus (Arizona bark scorpion) |
P01500 | APAM_APIME | MISMLRCIYLFLSVILITSYFVTPVMPCNCKAPETALCARRCQQHG | null | null | modulation of process of another organism [GO:0035821]; negative regulation of inward rectifier potassium channel activity [GO:1903609]; negative regulation of potassium ion transmembrane transport [GO:1901380]; negative regulation of potassium ion transmembrane transporter activity [GO:1901017] | extracellular region [GO:0005576] | inward rectifier potassium channel inhibitor activity [GO:0070320]; potassium channel inhibitor activity [GO:0019870]; toxin activity [GO:0090729] | PF17454; | null | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:5601655, ECO:0000269|Ref.4}. | null | null | null | null | null | FUNCTION: Toxin with unique selectivity to KCa2 channels (PubMed:10696100, PubMed:11212219, PubMed:11533126, PubMed:17142458, PubMed:20562108, PubMed:32560481, PubMed:36188602, PubMed:6122211, PubMed:9287325, PubMed:9459560). Potently blocks human, rat and mouse KCa2.2/KCNN2/SK2 channels (IC(50)=27-140 pM), and moderat... | Apis mellifera (Honeybee) |
P01501 | MEL_APIME | MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALISWIKRKRQQG | null | null | killing of cells of another organism [GO:0031640]; localization [GO:0051179]; monoatomic ion transport [GO:0006811] | extracellular region [GO:0005576]; other organism cell membrane [GO:0044218]; pore complex [GO:0046930] | lipid binding [GO:0008289]; molecular function inhibitor activity [GO:0140678]; porin activity [GO:0015288]; protein kinase inhibitor activity [GO:0004860]; toxin activity [GO:0090729] | PF01372; | null | Melittin family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20403370, ECO:0000269|PubMed:20472009, ECO:0000269|PubMed:5592400}. Target cell membrane {ECO:0000269|PubMed:11509361, ECO:0000269|PubMed:456586, ECO:0000269|PubMed:6269667}. Note=Alpha-helical peptides form toroidal pores in the prey. {ECO:0000269|PubMed:11509361, ECO... | null | null | null | null | null | FUNCTION: Melittin: Main toxin of bee venom with strong antimicrobial activity and hemolytic activity (PubMed:24512991, PubMed:4057243, PubMed:5139482, PubMed:5794226). It has enhancing effects on bee venom phospholipase A2 activity (PubMed:4371280). This amphipathic toxin binds to negatively charged membrane surface a... | Apis mellifera (Honeybee) |
P01521 | CA1_CONMA | GRCCHPACGKNYSC | null | null | null | extracellular region [GO:0005576]; host cell postsynaptic membrane [GO:0035792] | acetylcholine receptor inhibitor activity [GO:0030550]; ion channel regulator activity [GO:0099106]; toxin activity [GO:0090729] | null | null | Conotoxin A superfamily | PTM: Amidated; synthetic peptide with a C-terminus free is 6-fold less active than the amidated peptide. {ECO:0000269|PubMed:10529206}. | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:7149738}. | null | null | null | null | null | FUNCTION: Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them (PubMed:10529206). Specifically blocks mammalian nAChR at the alpha-1/delta binding site (PubMed:10529206). Shows very low potency in blocking the alpha-1/gamma binding site (PubMed... | Conus magus (Magical cone) |
P01522 | O16A_CONGE | MKLTCVVIVAVLLLTACQLITADDSRGTQKHRALGSTTELSLSTRCKSPGSSCSPTSYNCCRSCNPYTKRCYG | null | null | null | extracellular region [GO:0005576]; host cell presynaptic membrane [GO:0044231] | calcium channel regulator activity [GO:0005246]; ion channel inhibitor activity [GO:0008200]; toxin activity [GO:0090729] | PF02950; | null | Conotoxin O1 superfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:6509012}. | null | null | null | null | null | FUNCTION: [Omega-conotoxin GVIA]: Omega-conotoxins act at presynaptic membranes, they bind and block voltage-gated calcium channels (Cav). This toxin blocks N-type calcium channels (Cav2.2/CACNA1B) with a high potency (it displaces [125I]GVIA with an IC(50)=3.7-38 pM) (PubMed:10938268, PubMed:11724570). {ECO:0000269|Pu... | Conus geographus (Geography cone) (Nubecula geographus) |
P01523 | CM3A_CONGE | MMSKLGVLLTICLLLFPLTALPMDGDEPANRPVERMQDNISSEQYPLFEKRRDCCTPPKKCKDRQCKPQRCCAGR | null | null | null | extracellular region [GO:0005576] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF05374; | null | Conotoxin M superfamily | PTM: Hydroxylated; hydroxylations improve the ability to block Nav1.4/SCN4A sodium channels but does not affect folding. {ECO:0000269|PubMed:1991506, ECO:0000269|PubMed:2069951}. | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:6852238}. | null | null | null | null | null | FUNCTION: Mu-conotoxins block voltage-gated sodium channels (Nav). This toxin potently blocks rat Nav1.4/SCN4A (IC(50)= 19-110 nM) (PubMed:10627583, PubMed:1326324, PubMed:1654319, PubMed:21652775, PubMed:30360356). It also moderately blocks rNav1.1/SCN1A (Kd=260 nM), rNav1.2/SCN2A (IC(50)=2.7-17.8 uM), and mNav1.6/SCN... | Conus geographus (Geography cone) (Nubecula geographus) |
P01525 | NXB4_CERLA | ASATWGAAYPACENNCRKKYDLCIRCQGKWAGKRGKCAAHCIIQKNNCKGKCKKE | null | null | null | extracellular region [GO:0005576] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF07822; | 1.10.287.120; | Worm B-toxin family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: This toxin increases the excitability of nerves by delaying the inactivation of the voltage-gated sodium channel (Nav). Only acts on some crustacean. Is more abundant, but 15-fold less toxic than neurotoxin B-II. | Cerebratulus lacteus (Milky ribbon worm) (Micrura lactea) |
P01531 | NA1B_ANTXA | GVPCLCDSDGPRPRGNTLSGILWFYPSGCPSGWHNCKAHGPNIGWCCKK | null | null | regulation of signal transduction [GO:0009966] | extracellular region [GO:0005576]; nematocyst [GO:0042151] | sodium channel regulator activity [GO:0017080]; toxin activity [GO:0090729] | PF00706; | 2.20.20.10; | Sea anemone sodium channel inhibitory toxin family, Type I subfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. | null | null | null | null | null | FUNCTION: Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. This toxin has the highest affinity of all anemone toxins for the mammalian sodium channel, whereas its paralog Anthopleurin-A retains the greatest capacity to discriminate between cardiac (Nav1.5/SCN5A) a... | Anthopleura xanthogrammica (Giant green sea anemone) (Actinia xanthogrammica) |
P01535 | STX3_ANESU | RSCCPCYWGGCPWGQNCYPEGCSGPKV | null | null | null | extracellular region [GO:0005576]; nematocyst [GO:0042151] | sodium channel inhibitor activity [GO:0019871]; toxin activity [GO:0090729] | PF08098; | null | Sea anemone short toxin (type III) family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. | null | null | null | null | null | FUNCTION: Specific arthropod (crab and insect) toxin that inhibits inactivation of voltage-gated sodium channels. It competes well with the site-3 toxin LqhalphaIT (from the scorpion L.quinquestriatus (AC P17728)) on binding to cockroach neuronal membranes (Ki=21.4 nM), and inhibits the inactivation of D.melanogaster c... | Anemonia sulcata (Mediterranean snakelocks sea anemone) |
P01555 | CHTA_VIBCH | MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL | 2.4.2.- | null | localization [GO:0051179]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531] | catalytic complex [GO:1902494]; extracellular space [GO:0005615]; periplasmic space [GO:0042597] | galactose binding [GO:0005534]; glycosyltransferase activity [GO:0016757]; lipid binding [GO:0008289]; nucleotidyltransferase activity [GO:0016779]; toxin activity [GO:0090729] | PF01375; | 1.20.5.240;3.90.210.10; | Enterotoxin A family | null | null | null | null | null | null | null | FUNCTION: The A1 chain catalyzes the ADP-ribosylation of Gs alpha, a GTP-binding regulatory protein, to activate the adenylate cyclase. This leads to an overproduction of cAMP and eventually to a hypersecretion of chloride and bicarbonate followed by water, resulting in the characteristic cholera stool. The A2 chain te... | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
P01556 | CHTB_VIBCH | MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN | null | null | positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531] | catalytic complex [GO:1902494]; extracellular region [GO:0005576]; host cell plasma membrane [GO:0020002]; membrane [GO:0016020]; periplasmic space [GO:0042597] | galactose binding [GO:0005534]; host cell surface binding [GO:0046812]; toxin activity [GO:0090729] | PF01376; | 2.40.50.110; | null | null | SUBCELLULAR LOCATION: Secreted. Host cell membrane {ECO:0000305}. | null | null | null | null | null | FUNCTION: The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself. | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
P01562 | IFNA1_HUMAN | MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involved ... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. {ECO:0000269|PubMed:1634550}. | Homo sapiens (Human) |
P01563 | IFNA2_HUMAN | MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE | null | null | adaptive immune response [GO:0002250]; apoptotic process [GO:0006915]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cell surface receptor signaling pathway [GO:0007166]; cell-cell signaling [GO:0007267]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]... | collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:6159538}. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. {ECO:0000269|PubMed:6159538}. | Homo sapiens (Human) |
P01566 | IFN10_HUMAN | MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involved ... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. | Homo sapiens (Human) |
P01567 | IFNA7_HUMAN | MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKKGLRRKD | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cell-cell signaling [GO:0007267]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natura... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. | Homo sapiens (Human) |
P01568 | IFN21_HUMAN | MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involved ... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. {ECO:0000269|PubMed:1634550}. | Homo sapiens (Human) |
P01569 | IFNA5_HUMAN | MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involved ... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. | Homo sapiens (Human) |
P01570 | IFN14_HUMAN | MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involved ... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. {ECO:0000269|PubMed:1634550}. | Homo sapiens (Human) |
P01571 | IFN17_HUMAN | MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGLPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLEACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKILRRKD | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involved ... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. {ECO:0000269|PubMed:1634550}. | Homo sapiens (Human) |
P01572 | IFNA1_MOUSE | MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cytokine-mediated signaling pathway [GO:0019221]; defense response to bacterium [GO:0042742]; defense response to virus [GO:0051607]; humoral immune response [GO:0006959]; natural killer cell activation involv... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | PTM: Glycosylated. {ECO:0000269|PubMed:15254193}. | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. {ECO:0000269|PubMed:15254193}. | Mus musculus (Mouse) |
P01574 | IFNB_HUMAN | MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN | null | null | adaptive immune response [GO:0002250]; B cell activation involved in immune response [GO:0002312]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cell surface receptor signaling pathway [GO:0007166]; cellular response to exogenous dsRNA [GO:0071360]; cellular response to interferon-beta [GO:003... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | chloramphenicol O-acetyltransferase activity [GO:0008811]; cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:6157094}. | null | null | null | null | null | FUNCTION: Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed:10049744, PubMed:10556041, PubMed:6157094, PubMed:6171735, PubMed:7665574, PubMed:8027027, PubMed:8969169). Signals via binding to high-affinity (IFNAR2) and lo... | Homo sapiens (Human) |
P01575 | IFNB_MOUSE | MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN | null | null | adaptive immune response [GO:0002250]; B cell differentiation [GO:0030183]; B cell proliferation [GO:0042100]; cellular response to dexamethasone stimulus [GO:0071549]; cellular response to dsRNA [GO:0071359]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type I interferon receptor binding [GO:0005132] | PF00143; | 1.20.1250.10; | Alpha/beta interferon family | PTM: This beta interferon does not have a disulfide bond. {ECO:0000269|PubMed:1505514}. | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01574}. | null | null | null | null | null | FUNCTION: Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed:10708458, PubMed:23872679). Signals via binding to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, activating the canonical Jak-STAT si... | Mus musculus (Mouse) |
P01579 | IFNG_HUMAN | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ | null | null | adaptive immune response [GO:0002250]; apoptotic process [GO:0006915]; astrocyte activation [GO:0048143]; cell surface receptor signaling pathway [GO:0007166]; cellular response to virus [GO:0098586]; defense response to virus [GO:0051607]; extrinsic apoptotic signaling pathway [GO:0097191]; humoral immune response [GO... | extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; type II interferon receptor binding [GO:0005133] | PF00714; | 1.20.1250.10; | Type II (or gamma) interferon family | PTM: Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. {ECO:0000269|PubMed:3109913}. | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed:16914093, PubMed:8666937). Primarily signals through the JAK-STAT pathway after ... | Homo sapiens (Human) |
P01580 | IFNG_MOUSE | MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC | null | null | adaptive immune response [GO:0002250]; antigen processing and presentation [GO:0019882]; apoptotic process [GO:0006915]; astrocyte activation [GO:0048143]; CD8-positive, alpha-beta T cell differentiation involved in immune response [GO:0002302]; cellular response to interleukin-18 [GO:0071351]; cellular response to lip... | external side of plasma membrane [GO:0009897]; extracellular space [GO:0005615]; perikaryon [GO:0043204] | cytokine activity [GO:0005125]; type II interferon receptor binding [GO:0005133] | PF00714; | 1.20.1250.10; | Type II (or gamma) interferon family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01579}. | null | null | null | null | null | FUNCTION: Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed:11585387, PubMed:8456301). Primarily signals through the JAK-STAT pathway after ... | Mus musculus (Mouse) |
P01581 | IFNG_RAT | MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC | null | null | adaptive immune response [GO:0002250]; antigen processing and presentation [GO:0019882]; apoptotic process [GO:0006915]; astrocyte activation [GO:0048143]; CD8-positive, alpha-beta T cell differentiation involved in immune response [GO:0002302]; cellular response to interleukin-18 [GO:0071351]; cellular response to lip... | external side of plasma membrane [GO:0009897]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; perikaryon [GO:0043204] | cytokine activity [GO:0005125]; type II interferon receptor binding [GO:0005133] | PF00714; | 1.20.1250.10; | Type II (or gamma) interferon family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01579}. | null | null | null | null | null | FUNCTION: Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNG... | Rattus norvegicus (Rat) |
P01582 | IL1A_MOUSE | MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETSKMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEETIQPRSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS | null | null | cellular response to heat [GO:0034605]; cellular response to lipopolysaccharide [GO:0071222]; connective tissue replacement involved in inflammatory response wound healing [GO:0002248]; cytokine-mediated signaling pathway [GO:0019221]; ectopic germ cell programmed cell death [GO:0035234]; extrinsic apoptotic signaling ... | cell surface [GO:0009986]; cytosol [GO:0005829]; extracellular space [GO:0005615]; nucleus [GO:0005634] | copper ion binding [GO:0005507]; cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149] | PF00340;PF02394; | 2.80.10.50; | IL-1 family | PTM: Acetylated within its nuclear localization sequence, which impacts subcellular localization. {ECO:0000250|UniProtKB:P01583}.; PTM: Proteolytic processed by CAPN1 in a calcium-dependent manner. Cleavage from 31 kDa precursor to 18 kDa biologically active molecules. {ECO:0000250|UniProtKB:P01583}.; PTM: Phosphorylat... | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P01583}. Cytoplasm {ECO:0000250|UniProtKB:P01583}. Secreted {ECO:0000250|UniProtKB:P01583}. Note=The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that use... | null | null | null | null | null | FUNCTION: Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed:16256210). After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affini... | Mus musculus (Mouse) |
P01583 | IL1A_HUMAN | MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA | null | null | apoptotic process [GO:0006915]; cellular response to heat [GO:0034605]; cellular response to lipopolysaccharide [GO:0071222]; connective tissue replacement involved in inflammatory response wound healing [GO:0002248]; cytokine-mediated signaling pathway [GO:0019221]; ectopic germ cell programmed cell death [GO:0035234]... | cell surface [GO:0009986]; cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634] | copper ion binding [GO:0005507]; cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149] | PF00340;PF02394; | 2.80.10.50; | IL-1 family | PTM: Acetylated within its nuclear localization sequence, which impacts subcellular localization. {ECO:0000269|PubMed:26439902}.; PTM: Proteolytic processed by CAPN1 in a calcium-dependent manner. Cleavage from 31 kDa precursor to 18 kDa biologically active molecules. {ECO:0000269|PubMed:2115174}.; PTM: Phosphorylated.... | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:26439902}. Cytoplasm {ECO:0000269|PubMed:32272059}. Secreted {ECO:0000269|PubMed:26439902}. Note=The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used f... | null | null | null | null | null | FUNCTION: Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed:26439902). After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affini... | Homo sapiens (Human) |
P01584 | IL1B_HUMAN | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS | null | null | apoptotic process [GO:0006915]; astrocyte activation [GO:0048143]; cell-cell signaling [GO:0007267]; cellular response to interleukin-17 [GO:0097398]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to mechanical stimulus [GO:0071260]; cellular response to organic substance [GO:0071310]; cellula... | cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; lysosome [GO:0005764]; secretory granule [GO:0030141] | cytokine activity [GO:0005125]; integrin binding [GO:0005178]; interleukin-1 receptor binding [GO:0005149]; protein domain specific binding [GO:0019904] | PF00340;PF02394; | 2.80.10.50; | IL-1 family | PTM: Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated. {ECO:0000269|PubMed:15192144}.; PTM: (Microbial infection) Cleavage by S.pyogenes cysteine protease SpeB promotes its activation independently of CASP1. {ECO:0000269|PubMed:2833190... | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:15192144}. Secreted {ECO:0000269|PubMed:11728343, ECO:0000269|PubMed:15192144, ECO:0000269|PubMed:33883744}. Lysosome {ECO:0000269|PubMed:15192144}. Secreted, extracellular exosome {ECO:0000250|UniProtKB:P10749}. Note=The precursor is cytosolic (PubMed:151921... | null | null | null | null | null | FUNCTION: Potent pro-inflammatory cytokine (PubMed:10653850, PubMed:12794819, PubMed:28331908, PubMed:3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, a... | Homo sapiens (Human) |
P01586 | IL3_MOUSE | MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC | null | null | B cell apoptotic process [GO:0001783]; B cell proliferation [GO:0042100]; cell population proliferation [GO:0008283]; cytokine-mediated signaling pathway [GO:0019221]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; hematopoietic progenitor cell differentiation [GO:0002244]; hemopoiesis [GO:003... | extracellular space [GO:0005615] | cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; interleukin-3 receptor binding [GO:0005135] | PF02059; | 1.20.1250.10; | IL-3 family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Stimulates also mature basophils, eosinophils, and monocytes to become functionally activate... | Mus musculus (Mouse) |
P01587 | CSF2_MOUSE | MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK | null | null | cell population proliferation [GO:0008283]; cellular response to granulocyte macrophage colony-stimulating factor stimulus [GO:0097011]; dendritic cell differentiation [GO:0097028]; embryonic placenta development [GO:0001892]; epithelial fluid transport [GO:0042045]; granulocyte-macrophage colony-stimulating factor sig... | extracellular region [GO:0005576]; extracellular space [GO:0005615]; granulocyte macrophage colony-stimulating factor receptor complex [GO:0030526]; intracellular membrane-bounded organelle [GO:0043231] | cytokine activity [GO:0005125]; granulocyte macrophage colony-stimulating factor receptor binding [GO:0005129]; growth factor activity [GO:0008083] | PF01109; | 1.20.1250.10; | GM-CSF family | null | SUBCELLULAR LOCATION: Secreted. | null | null | null | null | null | FUNCTION: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. | Mus musculus (Mouse) |
P01588 | EPO_HUMAN | MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR | null | null | acute-phase response [GO:0006953]; blood circulation [GO:0008015]; cellular hyperosmotic response [GO:0071474]; embryo implantation [GO:0007566]; erythrocyte differentiation [GO:0030218]; erythrocyte maturation [GO:0043249]; erythropoietin-mediated signaling pathway [GO:0038162]; hemoglobin biosynthetic process [GO:004... | cell body [GO:0044297]; cell surface [GO:0009986]; extracellular region [GO:0005576]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; erythropoietin receptor binding [GO:0005128]; hormone activity [GO:0005179]; protein kinase activator activity [GO:0030295] | PF00758; | 1.20.1250.10; | EPO/TPO family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:32989016}. | null | null | null | null | null | FUNCTION: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. {ECO:000... | Homo sapiens (Human) |
P01589 | IL2RA_HUMAN | MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI | null | null | activated T cell proliferation [GO:0050798]; activation-induced cell death of T cells [GO:0006924]; apoptotic process [GO:0006915]; cell surface receptor signaling pathway [GO:0007166]; immune response [GO:0006955]; inflammatory response [GO:0006954]; inflammatory response to antigenic stimulus [GO:0002437]; interleuki... | external side of plasma membrane [GO:0009897]; interleukin-2 receptor complex [GO:0005893]; plasma membrane [GO:0005886] | interleukin-2 binding [GO:0019976]; interleukin-2 receptor activity [GO:0004911] | PF00084; | 2.20.28.230; | null | null | SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein. | null | null | null | null | null | FUNCTION: Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells. {ECO:0000269|PubMed:23416241, ECO:0000269|PubMed:24116927}. | Homo sapiens (Human) |
P01590 | IL2RA_MOUSE | MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVASCLFLLISILLLSGLTWQHRWRKSRRTI | null | null | activated T cell proliferation [GO:0050798]; activation-induced cell death of T cells [GO:0006924]; inflammatory response [GO:0006954]; inflammatory response to antigenic stimulus [GO:0002437]; lymphocyte proliferation [GO:0046651]; negative regulation of inflammatory response [GO:0050728]; negative regulation of lymph... | cell surface [GO:0009986]; external side of plasma membrane [GO:0009897] | interleukin-2 binding [GO:0019976]; interleukin-2 receptor activity [GO:0004911] | PF00084; | 2.20.28.230; | null | null | SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein. | null | null | null | null | null | FUNCTION: Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells. {ECO:0000250|UniProtKB:P01589}. | Mus musculus (Mouse) |
P01591 | IGJ_HUMAN | MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD | null | null | adaptive immune response [GO:0002250]; antibacterial humoral response [GO:0019731]; glomerular filtration [GO:0003094]; humoral immune response [GO:0006959]; immune response [GO:0006955]; innate immune response [GO:0045087]; positive regulation of respiratory burst [GO:0060267]; protein-containing complex assembly [GO:... | blood microparticle [GO:0072562]; dimeric IgA immunoglobulin complex [GO:0071750]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; monomeric IgA immunoglobulin complex [GO:0071748]; pentameric IgM immunoglobulin complex [GO:0071756]; secretory dimeric IgA immunog... | antigen binding [GO:0003823]; IgA binding [GO:0019862]; immunoglobulin receptor binding [GO:0034987]; protein homodimerization activity [GO:0042803]; protein-macromolecule adaptor activity [GO:0030674] | PF15097; | null | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01592}. | null | null | null | null | null | FUNCTION: Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces dimers and/or larger polymers. It also helps to bind these immunoglobulins to secretory component. {ECO:0000250|UniProtKB:P01592}. | Homo sapiens (Human) |
P01592 | IGJ_MOUSE | MKTHLLLWGVLAIFVKAVLVTGDDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCDPVEVELEDQVVTATQSNICNEDDGVPETCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD | null | null | adaptive immune response [GO:0002250]; antibacterial humoral response [GO:0019731]; glomerular filtration [GO:0003094]; humoral immune response [GO:0006959]; innate immune response [GO:0045087]; positive regulation of respiratory burst [GO:0060267]; protein-containing complex assembly [GO:0065003] | dimeric IgA immunoglobulin complex [GO:0071750]; monomeric IgA immunoglobulin complex [GO:0071748]; pentameric IgM immunoglobulin complex [GO:0071756]; secretory dimeric IgA immunoglobulin complex [GO:0071752]; secretory IgA immunoglobulin complex [GO:0071751] | antigen binding [GO:0003823]; IgA binding [GO:0019862]; immunoglobulin receptor binding [GO:0034987]; peptidoglycan binding [GO:0042834]; phosphatidylcholine binding [GO:0031210]; protein homodimerization activity [GO:0042803]; protein-macromolecule adaptor activity [GO:0030674]; single-stranded DNA binding [GO:0003697... | PF15097; | null | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1517233}. | null | null | null | null | null | FUNCTION: Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces dimers and/or larger polymers. It also helps to bind these immunoglobulins to secretory component. {ECO:0000269|PubMed:1517233}. | Mus musculus (Mouse) |
P01593 | KVD33_HUMAN | MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP | null | null | adaptive immune response [GO:0002250]; immune response [GO:0006955] | blood microparticle [GO:0072562]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886] | antigen binding [GO:0003823] | PF07686; | 2.60.40.10; | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. Cell membrane {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. | null | null | null | null | null | FUNCTION: V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound imm... | Homo sapiens (Human) |
P01594 | KV133_HUMAN | MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP | null | null | adaptive immune response [GO:0002250]; immune response [GO:0006955] | blood microparticle [GO:0072562]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886] | antigen binding [GO:0003823]; identical protein binding [GO:0042802] | PF07686; | 2.60.40.10; | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. Cell membrane {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. | null | null | null | null | null | FUNCTION: V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound imm... | Homo sapiens (Human) |
P01597 | KV139_HUMAN | MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTP | null | null | adaptive immune response [GO:0002250]; immune response [GO:0006955] | blood microparticle [GO:0072562]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886] | antigen binding [GO:0003823] | PF07686; | 2.60.40.10; | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. Cell membrane {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. | null | null | null | null | null | FUNCTION: V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound imm... | Homo sapiens (Human) |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.