ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
A5DIB1
MTEDWGGDILARLKLRDDLESRDSKYFEAFDLLRRKKVIKGTSGDPDVAAENERLIEKLNNLAIEVEKKDSQISKLKRQLSVAEKTIKSHQNKLENLALEVQEKNKNIEIVNDEVLMNQIQTAVLQKKLGELTKENETLVKRWMDRVSSEAQQMNDANQFLESMRKTSG
Function: Stabilizes the ATG5-ATG12 conjugate which is necessary for autophagy. The ATG5-ATG12/ATG16 complex is required for efficient promotion of ATG8-conjugation to phosphatidylethanolamine and ATG8 localization to the pre-autophagosomal structure (PAS). Recruits also ATG3 to the PAS. Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 19487 Sequence Length: 169 Subcellular Location: Preautophagosomal structure membrane
O94656
MELIKKIQDRDAAEKAYYDVIEPYSELLEFSFHKEFVSEEKVTQRTASSDSLNTIASENNDENVINLEEFRQLKRNCDLYQRNLQKLQLLFKQQSQKNTLLEKQLSLQTELNQEKDKRVKILQDELWALQLEVAALERKSPNA
Function: Stabilizes the atg5-atg12 conjugate and mediates the formation of the 350 kDa complex, which is necessary for autophagy. The atg5-atg12/atg16 complex is required for efficient promotion of atg8-conjugation to phosphatidylethanolamine and atg8 localization to the preautophagosomal structure (PAS). Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Required for meiotic chromosome segregation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 16892 Sequence Length: 143 Subcellular Location: Cytoplasm
A7TIN2
MDSLFVERLAQRDEVEGRFCELFKEVQIMVGPQLEDESMERKLIVALKSDLVEKDLRIGELEEILQLRNKDYERLNDELISLNIENNILRDKLQNMTEENSKLVKRWLNKVQQEADAMNENLH
Function: Stabilizes the ATG5-ATG12 conjugate which is necessary for autophagy. The ATG5-ATG12/ATG16 complex is required for efficient promotion of ATG8-conjugation to phosphatidylethanolamine and ATG8 localization to the pre-autophagosomal structure (PAS). Recruits also ATG3 to the PAS. Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 14616 Sequence Length: 123 Subcellular Location: Preautophagosomal structure membrane
Q6C4Y4
MQLNVTHRTNAERLEKHNRELETALAKKTEEHKEQAKALLLLQDDMLANQIQLNVLEQKTEALQQENETLVQRLVAKAAADADKMNDANAFLER
Function: Stabilizes the ATG5-ATG12 conjugate which is necessary for autophagy. The ATG5-ATG12/ATG16 complex is required for efficient promotion of ATG8-conjugation to phosphatidylethanolamine and ATG8 localization to the pre-autophagosomal structure (PAS). Recruits also ATG3 to the PAS. Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 10776 Sequence Length: 94 Subcellular Location: Preautophagosomal structure membrane
A6ZML8
MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSHDDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDLKKEHSQLVARWLKKTEKETEAMNSEIDGTK
Function: Stabilizes the ATG5-ATG12 conjugate and mediates the formation of the 350 kDa complex, which is necessary for autophagy. The ATG5-ATG12/ATG16 complex is required for efficient promotion of ATG8-conjugation to phosphatidylethanolamine and ATG8 localization to the pre-autophagosomal structure (PAS). Recruits also ATG3 to the PAS. Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 17222 Sequence Length: 150 Subcellular Location: Preautophagosomal structure membrane
Q757A7
MSSSNQVKGFYFNAQRRLSRAQALCQNSQDTLHNMQLLLVRWQRTVSKLQFTIHCICNQTVFLAECILKKTVGQQLIETEWKRMLLDELQGEMQRSQEEITGKIDALRRTKNELDGSGATLADFISMENIFLLGDKLKDVPVVQEQVEHIKVQYESLVDKVVEQLQNNRVRKLEADFAAAFRSGKNDFNAFSMKYLQKIRQLETDLADILKSLTDHYDKCSLLKAGDLPAAEQAELFEVVKNDDQELDSIMGVLEVIVRDIKSLAKNVSIRLRQKERDKQQLKNAMGKAHSELLKYEEHLTVFQGIDDLIRNFKASCLHNVSKVRELCEFYDNFLNSYQVLLREVERRRRVAKQMEDILQACEGQLMALSDTDLKQRQQFLMRHGDYLPENIWPGNIDDLSPLYDLEYRIKKV
Function: Autophagy-specific protein that functions in response to autophagy-inducing signals as a scaffold to recruit other ATG proteins to organize pre-autophagosomal structure (PAS) formation. Modulates the timing and magnitude of the autophagy response, such as the size of the sequestering vesicles. Plays particularly a role in pexophagy and nucleophagy (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 47998 Sequence Length: 413 Subcellular Location: Cytoplasm
Q6BYP8
MSNRDSSEHGDSSNKIASNECNEATKLGFNFTQLWSQITTTYSLIDRNDSNMFNRDERVESEQEKKSVVILGKKYDDISVDDGVIEQDIYSKIWLTYRTGFEPIAKCLDGPQPLSFVQSMVFNRNPISSTFNNFHGLLDNDNFTTDVGWGCMIRTSQALLANTYQLLFLGRGFSYGRDRSPRHDEIIDMFMDEPRAPFSLHNFIKVASESPLKVKPGQWFGPNAASLSIKRLCDNVYESNGTGRVKVVISESSNLYDDIITQMFTTLNPVPDAILVLLPVRLGIDKVNPLYHASVLELLALRQSVGIAGGKPSSSFYFFGYKGNDLLYLDPHYPQFVRNKTSVYDTYHTNSYQKLSVDDMDPSMMIGILIKDINDYEDFKSSCTKSSNKILHFHPTSEKADRRGSLSEFKRKNSEFVCIESKDVQRREDFITIDNVSRDDLNNMEGFIDMADEFDSEIDQNNKDDNFDDDEPVNVSQTSIGEEYTSTAGSRP
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 55840 Sequence Length: 492 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q557H7
MFTKYSHHNGYQDGSHLQPFQYQQQTYNQQSYLRQQQQAPQQISYGFNQPNSPTSSSSTPSSSTAMGNSFQNQRQINLQQQQQQEQFLQEQVFYQQQLLQQQSQIKEQQRQKEQKQKTNILNIYKEGKQKIMMSFYNLYRNYPTEPPHFSPSPIWLMGRCYTSKDNNSNNNSNNNQVPQTQPTQLQQSIGIFQNNNSNSNNNNNHNNNHNNNNNNLTTDLIYRPAIESGFLSDVASMIWFSYRKDFPPIENTNITTDIGWGCMLRTGQMILARALIKHLYKENDMVPEIERKKPHSNYSQVLAWFSDYPSKEHVYGIHQIVNKKQAMEKNNRKQQILREQVISLNRGGGGSSKGKKKKEKEEEINDNVEEWLAPTRISNILRQLIKFQHLEDLEMYVPTDGVIYKDYINNLCNNSNTHNHYQIIQQQLQHLREQQNIQQNNNKNNNNNNPTTTTTTTTTATSSNNNNNQSPPSRVPNGYNNQVFDDESLFDYNTAISSIPPKWKSLIIMIPLKLGADKLNSTYIEKLKLLLKLPQSLGFIGGKPKQSFYFIGFQDDQVIYLDPHFVQESVNPNSFDYSNTYSGCIPQKMPFTQLDPSLSIGFYCRDQASFEDLCDRLSVINNCEFPIISVCQKLPDYQIECELVDDYAESETTEMLAITIANGGNNHSCIPENIVVDDEEFIVHHHIPYNPNNNQNNNQNNNNNNNKNNNNNTNQQQTPNYPPKLNTYQPDFSSDGEIDDFTMVG
Function: Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins . The protease activity is required for proteolytic activation of ATG8 family proteins: cleaves the C-terminal amino acid of ATG8 proteins to reveal a C-terminal glycine (By similarity). Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy (By similarity). In addition to the protease activity, also mediates delipidation of PE-conjugated ATG8 proteins (By similarity). Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 86136 Sequence Length: 745 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q5B7L0
MNATDIERCRKRIIQYIWDPEPKNDEEPGSPIWCLGTRYPPQCVEETADESRNPDHGQQQNTNTSAPGWPEAFLLDFESKIWMTYRSNFPPIPKDAGQEGSLSLTLGVRLRSQLIDAQGFTSDTGWGCMIRSGQSLLANSMAILLLGRDWRRGERLEEEGKLLSLFADSPHAPFSIHSFVKHGADFCGKHPGEWFGPTATARCIQGLAARYDQSNLQVYIADDNSDVHQDKFMSVSRDEKGTVRPTLILLGLRLGIDRITAVYWNGLKAVLQLPQSVGIAGGRPSASHYFVAVQGSHFFYLDPHNTRPALRYSESGTYTEDEVNTYHTRRLRRLNIQDMDPSMLIGFLIRDEDDWEDWKARIMSLEGKPIITILSESDAASWKGRREALDEVEAFDDLDVAL
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 45379 Sequence Length: 402 Subcellular Location: Cytoplasm EC: 3.4.22.-
W0TGM7
MEFLTKITQQLGLVGEIDKVGSVFVLGEEYRPYIFKTQGKADDAETAFGSFLGNAQTNPQLLSDIETRIFFTYRTQFTPIPRDEEGPSPINLTLFFRDNPINTLENVLTDPDSFYSDIGWGCMIRTGQSLLANAIQRVKQTREFRVNLENIDIKEMSIIQWFQDDWKYPLSLHNFVKVEGKKSGMKPGQWFGPSSTARSIQSLINDFPDCGIDRCLISPQSADIYEDEMIRVFEENKRANVLLLFATRLGVNEINSIYWSDIFQILKSSYSVGIAGGKPSSSLYFFGYQNDYLFYLDPHQTQSSSLDMDDNSYYRSCHGHRFSKIHISETDPSMLLGMLISGKAEWDLFKDEFKNSRIIQFVASKPSDDIYEGVDLSPGSVSVHSIQSDLQDTGDYIDVGNFMSEKANSSQPSKNEEFENVKCKNQRILICENPSETEIEQVLVEDSTTDN
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8 . Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine . ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy . The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity). Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 51288 Sequence Length: 451 Subcellular Location: Cytoplasm EC: 3.4.22.-
A5DSB4
MSLMSDDSEVFVQAPTVANAELNIEAKPEANAQVNAEADSDANLGNNLGEQQTTDESAFGRNIGKFTAFVKEITGSGTEVEEQEKRNNHTISVDPSSNHENTSFEPTTYKILGRTYTSTTDASARVQELLWLSYRCGFEPIPKSDDGPQPITFFPSIVFNRLTLVNLSNLRSLLDKDHFTSDAGWGCMIRTSQNLLANALLRLFHTTGGQPQNFAVTKTEADVIELFQDTLSAPFSLHNFIKAANSLSLNIKPGQWFGPSAASLSIKKLVNDYNLIQQERRSERDSGRDSGHKVPTPNLKLHSKSADSDSDSDSDAISKRNSIPYVYVSENCDLYDDEINAIFELEQRPILFLFPIRLGIEQVNKYYYSSILQILASKFSVGIAGGKPSSSFYFIGYEGEDDLIYFDPHLPQIVQTPVNLESYHTSEYSKLKIDQLDPSMMIGILIETIDEYQEFKMSCFESDNKILHFHPLVTTAPRESSINQSWEEVQGEEEFVNLNIVKNEEDFVDLGSASTQGQNHEPS
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 58443 Sequence Length: 523 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q523C3
MDSAVAGAADIGRYGRRIVRMIWDPEPTNDPIANRPAWCLGYEYTLETNITSKTKGEDSKLSTATSSDQQRPPAQANKVPQMPSAQLPTEAAATALSGNTTPPTPEAALEPTKITSQPAAIDTPPDSVDSSFDSSMAYDDVPDDGGWPPAFLNDFESRIWMTYRSGFEPIPRSTDPTASSRMSFAMRLKTMADQQAGFTTDSGWGCMIRTGQSLLANSLLTCRLGRSWRRGQAPDEERKLLSLFADDPRAPYSIHNFVAHGAAKCGKYPGEWFGPSATARCIHALANATENSFRVYSTGDLPDVYEDSFMEVAKPDGKTFHPTLILISTRLGIDKINQVYWESLTATLQLPQSVGIAGGRPSSSHYFVGAQRSDEDQGSYLFYLDPHHTRPALPFHEDPQLYTPSDVDSCHTRRLRRLHIREMDPSMLIGFLILDEENWHAWKSSVKHVQGKSIITVSEHDPSKGSASGRPSAIDEVETLSDDDGDTVLDG
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8 . Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity). Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 53934 Sequence Length: 491 Subcellular Location: Cytoplasm EC: 3.4.22.-
A2Q1V6
MVLKDLCDRIVAAKCSSKSSTEIVDNTQVPASSKAGSSDSKFPKASLWSTFFTSGFSVDETYSESSSSEKKTVHSRNSGWAAAVRKVVSGGSMRRFQERVLGSCRTDVSSSDGDIWLLGVCHKISQHESTGDVDIRNVFAAFEQDFFSRILITYRKGFDAIEDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTVDKPVDKEYIDILQLFGDSEAAAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQREKNEQGEQLLPMAIYVVSGDEDGERGGAPVVCIEDACKRCLEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTFKFPQSLGILGGKPGASTYIIGVQNDKAFYLDPHEVKPVVNITGDTQEPNTSSYHCNISRHMPLDSIDPSLAIGFYCRDKDDFDDFCSRATKLAEESNGAPLFTVAQSRSLPMQVTSNSVSGDDTRFEEDDSLSMNLVNDAGNEDDWQFL
Function: Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins. The protease activity is required for proteolytic activation of ATG8 family proteins: cleaves the C-terminal amino acid of ATG8 proteins to reveal a C-terminal glycine (By similarity). Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. In addition to the protease activity, also mediates delipidation of PE-conjugated ATG8 proteins (By similarity). Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 53809 Sequence Length: 487 Subcellular Location: Cytoplasm EC: 3.4.22.-
A7KAL5
MTMDMEKCKRIVQYFWDPEPRNDVPAASIWCLGREYAPSQPPSDPASNNPRSPSRQPNASTLNDTTWPKAFLSDFGSRIWITYRSNFTPIPRTKTPEATSSMTLGVRLRSQLMDPQGFTSDTGWGCMIRSGQSLLANTFSVLLLGRDWRRGEKVEEESKLISMFADHPEAPFSIHRFVNRGAESCGKYPGEWFGPSATAKCIQLLSTQSEVPQLRVYLTNDTSDVYEDKFAHVAHDESGRIQPTLILIGTRLGIDNVTPAYWDGLRAALTYPQSVGIAGGRPSASHYFVGAQDCHLFFLDPHTTRPATLYRPDGLYTQEELDSYYTSRLRRIHIKDMDPSMLIGFLVKDEDDWADWKKRIRSTPGQPIVHIFPSQHQPDHGHGRAEALDEVEALDDSDEME
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8 . Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity). Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 45302 Sequence Length: 401 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q0U199
MNDFERFGRNVVRTFYDPPPCNESNEPIWLLGQRYDSRPPLPKPAPSDSSTTATATAQAERNEDESWIRTSIDDKERKEAPNGEDPTQYGNWPSAFLDDFESRVWMTYRSGFSPIQKSQDPKATSAMSFRVRMQNLASPGFTSDAGFGCMIRSGQCILANALQILRLGRDWRWQENHADKDHAEILSLFADDPQAPFSIHRFVEHGAAVCGKYPGEWFGPSAAARCIQDLANKHREAGLKVYVSGDGADVYEDKLKQVAVDEDGLWQPTLILVGTRLGIDKITPVYWEALKASLQIPQSIGIAGGRPSASHYFVGVQGNNFYYLDPHSTRPLLPFHPPSLAAATSDTPNLTASTTSVSSTTSSTTIVPPADSIPAPSDPRQSLYPPSDLSTCHTRRIRRLQIREMDPSMLLAFLVTSEADYQDWKEGVQGVQGKSVVHVQDKEPPPRGQEREGAIDEVESWDEDGLQ
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 51812 Sequence Length: 467 Subcellular Location: Cytoplasm EC: 3.4.22.-
A7KAI3
MASHSLNTLHTVFEYIWDRELPNDDFTNTLTVLGRTYAPGPPPHQEKAPDLRTLFHKFKPDQAADTEASWPREFLRDVHSRIWLTYRSGFPLIKRAEDGPSPLSFGSLIRGTVDLATVTKGFTTDAGWGCMIRTSQSLLANSLLQLRLGRGWRYDQTRECAKHAEIVSWFVDIPTAPFSIHNFVEQGANCAGKKPGEWFGPSAAARSIQVLCEANYDKTGLKVYFTASGDIYEDELFELAQQGAELRPVLILAGIRLGVKNVNPLYWDFLKKTLGWPQSVGIAGGRPSSSHYFFGFQGDYLFYLDPHVPQKALLIASEAPHESPDPNHYVEVESGLDLDSVHTNKIRKLHLDQMDPSMLVGLLVENRASYDALKHSINSHDQGSRFLNVYDSRPVLAAKSSGGLEESEFVDLGVLSMNEYDAIDDCDVGTCSALLRKERAFSHPVLVAMDPEEPEEIDASIHFDKDASILEKDPDRANETFEEIHVSETESRFEPDEPVVVSHDSAAVM
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8 . Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity). Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 56839 Sequence Length: 509 Subcellular Location: Cytoplasm EC: 3.4.22.-
A5DEF7
MTWDTKNQFETTKTSQELPATSQDHISDNKMNSEPSHRLSQFWSSLTRSSSESITAEPVVILGHTYREGDRDREGDSEVQKQVKKRYWMSYRSGFEPIKKHEDGPSPLSFVQSMIFNKNVGNTFANIHSLVDNDNFTTDVGWGCMIRTSQSVLANAIDRAGYEVDVELFADTSSAAFSLHNFVKVASDSPLRVRPGQWFGPSAASLSIKRLCEARNSSTNVPLSVLVCESGDIYDDQIQTFPVLLLLPLRLGIDHVNNVYHSSLLQLLEVPQSAGIAGGKPSSSLYFFGYQGTSLLYLDPHYPQNVSAGVGSYHSSSYQKLDISDMDPSMMAGIVLKNNEDYTDLKRRTTGNKIIHFHEARNYNDYVEVEREDFIDLGQNNRSATAGAEADFDSESSMVIVD
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 44844 Sequence Length: 402 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q8NJJ3
MYRFLGLGTHPNDDQNKIHVLGRQYDPIKTQETEGKDLDLNSRFQQVLDSIKDGNKKSTTYSQSFIDDVYSKIWLTYRAGFPPIARDKDSPTFTLGALLRGQFDFNEIGFTSDAGWGCMIRTSQSLLANALLFLHLGRDWVFKAKDPANVEHDRIISWFVDIPDEPFSIHNFVQQGIKCCDKKPGEWFGPSAASRAIKNLCKEYPPCGLRVYFSSDCGDVYDTEVRELAYGDSDTFTPILVLLGIRLGVEKVNLYIGDLLRECLSLKQSVGISGRKTSFLALLSIGFQGDYLFYLIPTFPKKALTFGKHGEPVHRLQTKKTDENAAGQYPVFKYWIQIMKQTMMTAMKASKTTASTLKFFRVLMSNQSTHQKVTKLHLSHMDPSMLIGFLITSEDDFNDWKENIGKKDPSHKIVHITETKVSESTSNFQFNSLRSNSIADYDNCSGEDCDSAAIASDSDDFVDLAADFAVTGLEPRTHTGVDDETSSDYVQHFPIRRFSQPVIVSREDVVPTLSEDNGVIALDDKMSGISVGR
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 59883 Sequence Length: 533 Subcellular Location: Cytoplasm EC: 3.4.22.-
A3LQU0
MAREDASVPRSHDSADASPNSTAKEIPVPQPPLLNLNLNLNMNSGFNLSNWWHQITSIEADSSDDRNNNNSNNGINAAESDSAQSQPIVVLGHSYQTTEEAHEDIIKKLCLTYRYGFERIPRAVNGPSPLSFMQSVIFSKSLLYNLQNFNNFIEKENFTTDVGWGCMIRTSQSLLANTFVRLLDKQSDIIALFNDTYLAPFSLHNFIRVASSSPLKVKPGEWFGPNAASLSIKRLCDGYYDNSTSETILPRINVLISESTDLYDSQIAQLLEPSTETKGLLVLLPVRLGIDSINSYYFSSLLHLLSLEQSVGIAGGKPSSSFYFFGYQDNSLIYMDPHSAQIFSSDIDMSTYYATRYQRVDIGKLDPSMLIGVFIRDLTSYENFKKSCLDAANKIVHFHATERSTVPESRRKNSEFVNINRSDLKDEDYINIDRVNRLDSTDDFIDLGDDYVETNTNLEEATPSAEDTVPVSTLSASESEITTSSYETPTSKDDNSSRASLDVVVLDTTGEQQE
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of ATG8. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. The protease activity is required for proteolytic activation of ATG8: cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of ATG8 during macroautophagy: ATG8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS. Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 57380 Sequence Length: 514 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q9P373
MELMARFLERYLHFAPTNTEPPGTLIWFLGHSYKIEDSQWPEKFLYDSFSLITITYRSGIEGLENMTSDTGWGCMIRSTQTLLANCLRICYPEKQLKEILALFADEPSAPFSIHQFVTMGKTLCDINPGQWFGPTTSCSCVARLSDQNPDVPLHVYVARNGNAIYRDQLSKVSFPVLLLIPTRLGIDSINESYYDQLLQVFEIRSFVGITGGRPRSAHYFYARQNQYFFYLDPHCTHFAHTTTQPASEETFHSATLRRVAIQDLDPCMIFGFLIRDEEEWHSFEANQKYFADIVQIFDSEPQPVETHDDFVLDENVEDHL
Function: Cysteine protease that plays a key role in cytoplasm to vacuole transport (Cvt) and autophagy by mediating both proteolytic activation and delipidation of atg8 . Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). The protease activity is required for proteolytic activation of atg8: cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine . Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. In addition to the protease activity, also catalyzes deconjugation of PE-conjugated forms of atg8 during macroautophagy: atg8 delipidation is required to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity). Plays a role in meiosis and sporulation . Catalytic Activity: [protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine Sequence Mass (Da): 36929 Sequence Length: 320 Subcellular Location: Cytoplasm EC: 3.4.22.-
Q6TGJ4
MRKLCGNGSTSMISTDSYKNTTFFVIAFSTFLISCIDYTKLFSSLSTPEAVGRLEDVLIGQCITKGSFAHTLFLIILSAFFIFQVANFAMSVPRLLDMYRFYTHLLGVPDADIQTLPWPEIVRLIGDIRKHNPVTSLSNGQATALADMVGNDAKAPVKKLDAHDIANRILRQENYLIALFNKDLLDLRVRIPVPHIFTAFIPSSMLILSADPPLPSLQSEPERKFLSFGANHLTKALEWNLRFCLLGYLFDRRGQVRKEFVREKRRKDLVQGLRRRFVFMGILNAIFAPFIILYLLIYSFFRYFEEYHKNPSSIGSRQYTPYAQWKFREFNELPHLFERRLDRSYETAKEYVDQFPKERTALVMRFVAFVAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGVFGSVLAISRGMVPQENMVFDPEASLNEVVRWTHYLPVEWRGQLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLPPCAAAIIDFFREFTVHVDGVGYVCSFAVFDFARHGNIDSNRPETGVQGATGPDAGDSGGGGGGGGGGFAAGKSGRQTTRRAASASPSRFKQKDWRSNENKMEQSFLHFKATHPDWQPSDPSSSLFLDRLMGAGARNRPAGGISGSIYGGGGGGGGGGGRGLGIDGSVMAEMEEERLRAKSQSYERAWAKSSHLHRPDISNPLRHPHSAASEIIEEEEGGEGDKGDDSIDGWSKRMKTDGESDDEQEEHGRLWKDDGVQIDIKQ
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking. PTM: Phosphorylated by ATG1. ATG1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 84191 Sequence Length: 751 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
P0CM41
MGKGEGYLDPTILSVASGSRNSGKGKERTRRKGGHKYHSLHVQDEEEEEPPESDALRTRGKVGLNAYEKALWKWVNVDDLDGFLQEVYDYYKGKGIYCIVLARVLNLLTTFFVIAFSTFLISCIDYSKLFSSISTAEAVGRLEDVLVAQCITKFVHFKLYILNKTNSSAYDYRGSFAHTLFLIILSAFFIFQVASFAMSVPRLLDMYRFYTHLLGVPDADIQTLPWPEIVRLIGDIRKHNPVTSLSNGQATALADMVGNDAKAPAKKLDAHDIANRILRQENYLIALFNKDLLDLRVRIPVPHVLTAFIPSSILISSADAPLPSLQSEPERKFLSFGANHLTKALEWNLRFCLLGYLFDRRGQVRKEFVREKRRKDLVQGLRRRFIFMGILNAIFAPFIILYLLIYSFFRYFEWKFREFNELPHLFERRLDRSYEIAKEYVDQFPKERTALVMRFVAFIAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGVFGSILAISRGMVPQENMVFDPEASLNEVVRWTHYLPVEWRGQLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLPPCAAAIIDFFREFTVHVDGVGYVCSFAVFDFARYGNVDANQPETGLEGATGPDGGPAADGFAAGKPSRPTTRRTTSSSPSRLKHRDWRGNENKMEQSFLHFKATHPDWQPSDPSSSLFLDRLMGAGTRNRHGGGPVSAATGGISGSIYGGGGGGVGGRGLGVDGSVMAEMEEERLRAKRQSYERAWAKSSHLHRPDSSHSHPLRHPHSAASEIIEEEEGGEGDKGDDSIDGWSKRVKTDGETDDEEERERLWKDEGVIIIFFLTNNHITVVVMNVCRCIFRVAADEHKTAGRINKSQTRRLT
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking. PTM: Phosphorylated by ATG1. ATG1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 99290 Sequence Length: 879 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q54NA3
MSHEDRGGDYYPMMDDPEDRNFIQAKYPNSTGHMSSGGGSNHMSFDDNHGIEMLRDDEHSLLHESPVSIPAIHNLDSFLTDVYNYFRGKGFMCIFFNDLFELVSSLFVVLFFTFLVCFVDYSKLFSEQMPPPALRESVNFSAPIPIWLMVFLVIFSLYWLSKLFSFFSSIKTNWEISSFYKNTLKINEDDIQTIEWREVVSKIVLVPRLCIVKENMNALDIANRIMRKENYIIGLINQRILNLSIPFPFLRNLTFITKTLEWSLMYSLFNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAEELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSYSHANQYVESFPSQMLSTIAKFISFLFGSVLAVFIVLGIVSDHFIMNYQIFDRTPIWYIGILGTIVAITRSLIVDENQVFQPAKHMARTVQNTHYLPMSWVGKTHTHKVRDEFLVLFEYRIVDFVRDIFSVLFTPFILIFSLPKSSQAIIDFFGNNTVVLEGVGPICQLGDFSNIRKLGDNSFGSLNHSQNKISLTNNAKLEKSIINFKCLNPEWNTDNNELLQNLNEFSKIKNNNNNNNNNGSNNHIGNHSQLPTTSVDDFQFIHDSHYIPHEIIDAVLGTHHHSQQSNNNAPRFKTGRVDQNILNAVNDLHQSFYESQYKHKNDNFVNSI
Function: Phospholipid scramblase involved in autophagy by mediating autophagosomal membrane expansion. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion (By similarity). Required for lipopolysaccharide (LPS)-enhanced bacterial clearance through the autophagic pathway . Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 81314 Sequence Length: 699 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q5B6U6
MMASNVLSRLLPQTGQSVYETIRQHDNDSDASDVEERAGLVYDDDVNLGNRFSDRELEEAMADATREGSSSPSDTFLTPQIAQRGERSASSGPRMRKPNNPRFMRSVTPRPEFVEDDLDDDHDDDVPASLLMEGQHDDEYLRTRLPPPPSHHFSDPQPSRSARSPRREHIRTFAFVVGFTTFLTNCIDYRLVRTSKSLDQILISKCTSRMSASSTFLLWLLCLFWIGKIFQLILDIRRLKNMHDFYHYLLGVSDAEIQTISWQEVVSRLMTLRDANPATAGAVSAFNRRLLGSQSKQRMDAHDIANRLMRKENYLIALINKDILDLTLPIPFLRNRQLFSRILEWNINLCIMDYVFNEQGQLSSRQYTPLAEWKFREFNELWHLFEKRINLSYPYATRYVDQFPKDKTVQVAGFVAFISGALASVLALASILDPELFLGFELTHDRTTLFYLGVFGSVWAFARGMVPEETLVFDPEYALLEVIQFTHYFPSHWKGKLHSDDVRREFAVLYQMKIIIFMEEILSMIFTPFILWFSLPKCSERVIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVIPQGHINQRDARQDPRVDYFSTKDGKMLASYYGFLDNYGGNPRATNANKRAFHPPPTFPSLGSPPFVGASNIGNRQDPIQARVNTASAALGQQSMLGATRLGALGVGDTQSPAPSLLLDPQHQPSASGFRATNHIAPHHRQRLGRPPPAPVSESIIDDNEPSIAAARRPAPRRKSGQLHTNSGSSEALGAGDSNVEDSWGMKSGGEVNDEDAEENVDDVVGGAGVLGLIQQFQKVNKDNRPRAAVGL
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through atg2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking. PTM: Phosphorylated by atg1. Atg1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 92456 Sequence Length: 820 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of atg9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
I1S9X9
MASNIFSRIKSPSGGSQSFYQQLRSGEDPEYDPGLDEENLGHRFDDFQAEGMDIGDSSMTVESVAPGSKGKGKATFRPTAHARSSGITSPRWQQDDDGDNEVPASLLMEPKDLDPPASPPNKRATNPGSSRTPASVGPSSARTRAQWEAATAQQQLHQDHPYTTPMGPQPIPVARGTMSNNPREKALWRWVNTSNLDSFMRDVYDYFEGGGLWCILCANALWLFQCIDYSRVPDSRSLHEVIVPQCTRKMSGLWNFAIWLYTFFFIWKCVQYFVEIRRLTYIRDFYIYLLDIPEQDMQTISWQDVVARIMALREENPKTATNISPRLRQFMGSQSKERLDALDIANRLMRKENYLIAMINKDILDLSLPVPFLRGRQMFSKTMEWYLQYCILDMAFNELGQVQQDFLRPDRRRLLSQKLRQRFLFAGFLNLLFAPVVLAYVVIVYFFTYYYEYQKDPKQAAARKYTSLAEWKFRQFNELPHIFYERLHMSYPFATRYIDQFPKRITEAVARTIAFMSGAITAILAIGSVLDSELFLNFEITKDRPVIFYLGVFAAIWATTRGMVSEETLVFNPEYALRNVIEYTRYVPDHWKNKLHSSEVKQEFSELYKMKVVIFLEEMMGIVTTPMLLLFSLPRCSDQIVDFFREFTIHVDGLGYVCSFAVFDFQKGPGNTGPQGPRPDVREDYYSTKHGKMAASYYGFLDNYAANPKTGIPGHLPPGPKPSFHPPPSFPGIGSPTLAADMQGSHIGRTGTETGRARSRAPGGRGPRIGVMPQPSPMASMLLDQHHQPPGGNMVARSLHASRYPRGYRGESQIIEETEASSIRRNGEDDELYEPGGALGESVWETSPARGVTRENSAANTEDPEAGVLGLIYQLQQTQRPRRGGGMV
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking (By similarity). Autophagy is required for proper vegetative growth, asexual/sexual reproduction, and full virulence . Autophagy is particularly involved in the biosynthesis of deoxynivalenol (DON), an important virulence determinant . Required for aerial hyphae development and lipid droplet degradation in response to starvation . PTM: Phosphorylated by ATG1 (By similarity). ATG1 phosphorylation is required for ATG18 interaction and preautophagosome elongation (By similarity). Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 100819 Sequence Length: 888 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q51WZ9
MASNIFSRLVPQDRGRSFYEDLRQTDPDADLESRAGIDIDEENLNRSYHDYDLDEAERLAGDESHISHSRGDVAGANTVHRRGQKANTARWLGAGVEDDVDNDVPESLLVETPRAPQHLLLSPSRAGPSHPRPTAVPGPSTRQNQAQWEATRHQQRLHNDDTMPHGPFSGRAGQGRPEPPPVGLMAGDPYEQAMWRWVNVSNLDNFIKDVYAYYRAAGFWCIIVQRILELVNAAFVAVFLTFLSQCVDYHKLPHSKKMEDIIIPKCTQNMSLVWNVGLWLFAIYFICRCFGLIIQLRQLKHLRDFYTHLLKIPEADMQSVSWQDVVGRIMALRDSHPRTAGNLTRVQRAWIGSQSKERLDAHDIANRIMRRENFMIAMLNKDVLDLTIPLPFFRNKQHMSECVVLAISFSILDFVFDNQGQVNPEFLKASRRRQLSQKLKSRFFFAGLMIFVMSPFIALYLILVYFLTYFHEFRNDPGALGARTYNSLAKWKFREFNELDHLFNDRMNMSHPFAKRYIDMFPKRKTEQVARTVSFITGSIVAVLGLATIFDSEAFLTFEITPDRSVLFYVSILATLWAVARGNISDDNEVYDPEFAMKSIIEFTHYEPDHWRGRLHSTEVKNEFSELYKPRPQIFLEEILSILLTPLVLLVSLPNSTDQIVDFFREFTIHVDGLGYVCLFSVFNFQQGHANQKQAAAADAPDNREEYYSTKHGKMAASFYGFLDHYVINPKTGLPGNQLPGSRQQFQHPPSFPGLQSPTLAADMRHSRMMRERGRSSGVQIQGSQGRTPQFRTPMPQPSPMASILLDPHHQPAPGAFGSRSMHRSRQMAVPHRGGYMSDRDIIEEAVTEDGQDDARFGKLGDEDIDESGGALDESTWQTSPTKTLSRENSGANPQETEVGVLGLIHQFQQAHMHLRR
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress (By similarity). Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking . Plays a role in appressorium formation and pathogenicity . PTM: Acetylated by HAT1 at Lys-621, which increases the ability to bind vesicles during nutrient starvation induction. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 104559 Sequence Length: 917 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q7S4D7
MADGVIARLMSGGRGARSFYEELRGRDNVSDVDDRAGLLDEENLNQHFNDYDLENAEGLRLEDSRATVDGRIPRGRAQLSGRPPRPAATTHWGTSHDDDGDNDVPASLLVERYDRGAAPLGSPGKPRSQHAGSRAHPAPGLSKGRTHQQRPHIDQELQPPLHSDAAPSSLLAGAITGNAKKMAEWRWANITNLDSFMQDVYSYYRGSGMWCIVVERVLHLIKVAFVAFLLTFLSQCVDFKKIPSNQKLSQVLVPQCTRNMSGLWNIGLWLFAFYFMWKSIQYILDLRRLTHVRDFYIHLLNIPDEDMQTITWQEVVARIMVLRDQNVRTTRTITPQNQRWVLGSQSKERLDASDIANRLMRRENYMIAMINKDILDLTIPLPILRNRQLLSQTLEWTLMFSILDFVFDPKGQVHQEFLRSDRRGILSAKLRSRFIFAGVMILILSPFVAGYLIIVYFLEYYNEIQKNPSILSARSYTPLAEWKFREFNELPHLFKRRLDMSHPFASHYIDQFPKAKTSMVAKTVSFIAGSIATVLALISVFDPEMFLGFEITHDRTVLFYTAVFGAIWSVARGSVSEDNAVFDPEYALGNVVEYTHYQPEHWKDRWHSADVKAEFEELYKLKLVIFIEEILSILTTPFVLFFSLPKSADQIIDFFREFTIHVDGLGYVCYFAEFDFKKGSKSQAPAATAGEGDVRDDYYSTKHGKMEASMYGFINNYARNPKHLPPAMRQQFHLPPVFPGITSPTLAGDLAASRMGRSQRGRSKGPLPSRTPRPGAVMAEPSPMASILLDPRHQPIFPNNMSFVNTGHQFRGGNQGDGHMMGGGSMEEDVKGAARHGQQTHDDESEDSRAGLDESAWQVSPTKDLSRENSGRGLDSVVGEEAGNGAGVVHMLYQFNQAHLNRRLGGVR
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through atg-2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking. PTM: Phosphorylated by apg-1. Apg-1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 102641 Sequence Length: 908 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of apg-7/atg9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
A7KAM0
MMSSNILSRFLPPTGSPSVYETIRQHDAGSEYSDLEERAGLVIEDQQEQYSDRELEDALADAQDSEIVSPSTALLNQARSVKAPEERASPSGTRRRKSSRPRWMAQESPLGYELDDHDEDVPQSLLVEGHHEDLKPRLPPPPQSHNRSDRRRTPSPGPSSRPTEARWNERGVHQQPPPSESGHPIGRWFTGQHPGLANVDPKKKAMWRWANVEDLDNFLKDVYVYFLGNGIWSILLTRVLNLLTFAFVVGFSTFLTNCIDYPKVRRSKTLNDILVPQCTANMSGSSTFLLWLFSFFWIGKLFQYLLDIRRLKHLHDFYLYLLGVSDAEVQTISWQEVVSRLMALRDSNPSTAAAVSAKHRRFLGSQSKQRMDAHDIANRLMRKENYMIALVNKDILDLTLPIPFLKNRQLFSRTMEWNLNLCVMDYVFNEQGQLRTLFLKDTHRRALSDGLRRRFIFAGVMNIFVAPFIVVYFMMHYFFRYFNEFKKNPGQIGSRQYTPMAEWKFREFNELWHLFERRINMSYPFASRYIDQFPKDKTVQVARFVAFISGALASVLALASVIDPELFLGFEITHDRTVLFYLGIFGTVWAFARGLAPEETDVFDPEYALLELIDFTHYFPSGWKGRLHSDDVRKEFAILYQMKIVIFLEEILSMIFTPFVLWFSLPKCSDRLIDFFREFTVHVDGVGYLCSFAVFDFKKGTNVLSQAGPGRRDPGKQDLRTDYFSTKDGKMLASYYGFLDNYGTTHQATSRRPFHPPPTLPTLGSPTAGGFGALPDRPDHLQTRLGPTPGAPFGPQSMIGTSKPRQMGGFDHRSPAPSILLDPHHQPSTTGFRAAARIAPQQHQRSRLGRSHHPSTDPIDDEEEPLSQDGHDSTTRQSGARTGTSSAGAGTSDSNLGDSWRMNPLSNDEDEGDEGENIDAIAGGGGVLGLIQQFQKANTEGRRTNVGI
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation . Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through atg2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking (By similarity). PTM: Phosphorylated by atg1. Atg1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 107622 Sequence Length: 948 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of atg9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q0UYL2
MASNLLSRLLPSASDDLLEQEASNNQNRRTSSSTDERPDMDIDEENFGARFEAQDLNDLLAEASSSHMTTESRAASPEARRNAPPGINTAARAPAWRQPAPARAVPLDDDDDVPQSLLLEGGLDPPPNPHPRPDGLPPPVPGPSTRHTRAQWETTRQQQRLHGDDRGGAPVRDWGAIGRGGQFTADPKEKASWLWVNQTDLDTYMREVYEYYVGSGIYSMILRRTLSLLQSAFVVGFMTFLGWCIDYSKLSGSNKLSQVLVPKCTKEIHGFWIFALWVFTIYWLYSFYGLLTDIPRLRAMHDFYHYLLDVPDRDIQTIQWQQIVSRIMALRDLNLTTASNLSPETRKLLDSKSRQRLDAVDIASRLMRRDNYLIALFNKEILDVTVPIPFLGNRFIFSETTGWHVNLAVMEFVFSGPNGQFNQDFLKERNRRELVRRLRGRFFWTGIISIICAPFAVVFVLASYLFKYFTEYHKDPGQLSNRDFTTFAQWKFREFNELPHLFNRRRNMAYPYANLYLAQFPKDKTEQISSFVAFIAGAFASVLVAFTLLDSELFLTFEISPGKTAIFWIGVLTTIYRVARGSSPQEDQVTDPSYYLDHVIYHTRYKPDSWQDRLHTDEVRAEFAKLYQPKILIFAEEILSMVVTPFLLMFRLPQCSERIVDFFREFSIVVDGLGVTCSYSMFPFKKGTQNVNNAPANRSGAHKDDGDLREDYFMAKDNKMLASYYGFLDTYATTGKGNSARLPGRAGFHPPPQFPNAFGAMSQTAQPVDVGARGTSRGPAGRQPLQRRTPRSGPAGRDEPIASVLLDPHHQPSSASILRGSPRTGPSGRYRTPLQPVADTPGTRIEEESTIGDSWRTSRLAQDDDEEEEAPGANRGGVLQLLQQFSKAQAEGRGAGVGV
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking. PTM: Phosphorylated by ATG1. ATG1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 101537 Sequence Length: 899 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
A7KAI7
MGDLNKHTFLSRVFGSASNPLLNDDNNDIEFSINNLQDTFEEHQVESPPRAPHPINVNSEDESSSETESASNEDLLYDQKRELYQQVESELRQDDYDTVPESLMMERRRPHEGSTRTIGTKIPPSPAEPPIGPNITQWGEKARGIASRTLDNIPKTIAKGISFQLPANASSKLPPPPLSYRRETSVGGETEMAQNINEQRQLRGRLGLLSPMERALWLWSNVSNLDTFLEDVYGYYTGNGYRCIILSRVSDLLIIVFVVWLTSFMGNCVDYNQLMNGNATKYSDVVVDKCYSKISLSQKLFFLVLFAILVLRIKSFYSHFKDLKEIKNFYNLLLGVSDEELQTISWSTIVKKIKVLRDQNTNALISGNQNLRGDDLKSKKRLSAHDIANRLMRKENYMIAIFNKNVLAPALTIPFINHHFLTKTLEWNLKLCIFDFVFNTDGQLKQAVLSEHKRLALATEMRKRFRLAGILSIFLTPFLVIYFLLYFFLKFFYDIKTNPSLVGSREYSPYARWKLREFNELPHMFDKRLKMSRARATEYINQFPKEATNIILNFVAFVTGSLVTILVVLTVLGHENFLNFELTEGRTVLFYISTLGAVFTICKGSVSENDTVFDPEASLRYVAQFTHYLPNSWNGRFHTEEVKNEFCKLFNLRLILVLKEITSLIMLPYILYCRLPDVSEKVIDFFREFSVHVDGLGYVCTFAMFEFDSKDKPVRSQAANDDDDLKQEYYTADDDKMVKSYLYFLESYGNESVRKTGKEPAVDRISRRPGKKNLLRSAMMNNSMMDKSRGAQSTVRYPPQFRSPNLAESVYTKRQNIDLMEDTTAGLSTDTRNYLQTLNNSTLLGESFQHGFPVEDTTHHEEDADSEDDDEAGVLGLINQIYKHKEGVN
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation . Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking (By similarity). PTM: Phosphorylated by ATG1. ATG1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 102069 Sequence Length: 889 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q876N4
MHKNNTTFLSRVFGINSRNIDVHNPLFADDSVIPLYDQNQSAYYDNAYSDYSSDEEDSKPRTSRQTDSNLHMTDHSGDGNDPFNQMDNSSRFSNSSSFHYNNTDQEDDNPELLLLQDEDSSLNRKNLDNSDFQSFAKKTFNQIPKIKFQLPKKEDYPTSHRQPPDIENQNGTLKSSVKKQIHFLDPMDKALWMWSNVSNLDTFLHQVYDYYTGNGFNCIMMNKFTELFTVVFIVWLFSFMGNCIDYDKLMNDRNVYQFSQVKIDKCYSKIGFFPQKLIYWLFFIGLCLKLYQIFLDYLVLKDMKLFFNLLLGLSDDELQTISWGLVVKRIMILRDKNINAIVSQNTDLTSRKRMNAHDIANRILRKENYMIAMYNKSILDLDIELPLIGKVQLLTNTLQWNLNIAILDYFFDSETGQINLPALKERNRHTISTELKKRLIFCGIINIVLAPILSIYFIMYYFLKFFYDFKTNPADISSREYSPYARWKLREFNELPHIFNRRLNISTESSNKYINQFPKETTTALLKFIMFISGSIVGVLVIVTILDPEFFLNFELTPGRTVLFYVSTLGAIFTICKNSIPDDTLVFDPEVSLRYLSQFTHYLPQEWEGKYHTEEVKNDFCKLYTLKLYLVGKEILSWLFLPYILCYKLPECADTISDFFREFSVHVDGLGYVCTFAMFQFNNQHNENGNANVHQNGNGNGGVPSAKSKSKKVPNPNRFTTKPSMRDMENDDKMIKSYMYFLESYGNDEIVQHQQALNRSLIYSTEISPTSGDDLNDSNILGLRQRNVATTGKRQNSIGNGLIYNGQNKRLSIGEAKTNVYSNPIASTVLDKDLQYKLANSYILNGMPGLNEANQPADRKNERKYSNDSPGVMKLVDKISQQHKA
Function: Phospholipid scramblase involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Required for mitophagy. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking (By similarity). Essential for the formation of the sequestering membranes and assembly of the micropexophagy-specific membrane apparatus (MIPA) which mediates the fusion of the sequestering membranes and incorporation of the peroxisomes into the vacuole during micropexophagy . PTM: Phosphorylated by ATG1. ATG1 phosphorylation is required for preautophagosome elongation. Location Topology: Multi-pass membrane protein Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out) Sequence Mass (Da): 102597 Sequence Length: 885 Domain: Forms a homotrimer with a solvated central pore, which is connected laterally to the cytosol through the cavity within each protomer. Acts as a lipid scramblase that uses its central pore to function: the central pore opens laterally to accommodate lipid headgroups, thereby enabling lipid flipping and redistribution of lipids added to the outer leaflet of ATG9-containing vesicles, thereby enabling growth into autophagosomes. Subcellular Location: Preautophagosomal structure membrane
Q2HIE9
MKEMSRYLWPKDSWGDKLRVLLAVGLLVGGKVLNVQVPFFFREIVDSLNVDIAATGGTVATVAGTMIFAYGASRIGAVVSQELRNAVFSSVAQKAIRRVATRTFGHLLNLDLNFHLSKQTGGLTRAIDRGTKGISFLLTSMVFHIVPTALEISMVCGILTYQFGWEFAAVTALTMSAYTAFTIWTTAWRTKFRRQANAADNKASTVAVDSLINYEAVKYFNNEKYEIGRYDKALHQYEKSSIKVATSLAFLNSGQNIIFSSALTIMMWLGAKGIVAGSLSVGDLVLINQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNLSIKEKPNAASLVLPKGGEIRFDNVSFGYYPDRPILNNLSVTIPAGKKVAVVGPSGCGKSTLLRLLFRSYDPQSGRIFIDDQDIRDVSLDSLRRSIGVVPQDTPLFNDTVELNIRYGNLDASREKVLEAARRAHIHDKIESWPHGYQTKVGERGLMISGGEKQRLAVSRLILKDPPLLFFDEATSALDTHTEQALMSNINEVLKEKRRTSVFVAHRLRTIYDADVIIVLKEGRVVEMGSHRELMEGNGLYTELWMAQEMSMHDQSLGRSEREAPVPVK
Function: Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins (By similarity). Hydrolyzes ATP (By similarity). Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 67070 Sequence Length: 603 Subcellular Location: Mitochondrion inner membrane EC: 7.-.-.-
J9VWU3
MGFGSCSRHALFTPAAFSGSFTTMTTSCFKRVYTAQIHGGDALGKRLPSVSSFSGQLPRHGLHRQSLAFFSTSHRRQTSPPPSPRTTSQSPTVPSKASTTPPTSLNTSKPIATESQDKTDWSIIVKLAGNIWPKNNPNVKFRVIGALTLLVAGKVLNVQVPFFFKTIVDSLNVPITESTTVWVLAGASIAGYGAARILTTLFGELRNAVFASVAQNAIRKVARETFEHLLNMDMKFHLERQTGGLTRAIDRGTKGISFILSSIVFHVIPTALEISMVCGILSWKFGWDFAAVTAITMLLYTWFTIKTTAWRTTFRKQANAADNKGATVAVDSLINYEAVKSFNNEKYEVAQYDTTLKAYEKASVKIATSLAALNSGQNFIFSSALTMMMLLGAQGIVKGTMTVGDLVLVNQLVFQLSLPLNFLGTVYRELRQSLIDMDVMFNLQSLNSAIKDTPTAKPLHLKGGEIEFRNVAFAYHPERPIFRDLSFKIPAGQKVAIVGPSGCGKSTVFRLLFRFYDSNSGQILIDGQDIKTVTLDSLRRSIGVVPQDTPLFHADILHNIRYGNLEATDEQVYEAARKAHVEGTIQRLPEKYATKVGERGLMISGGEKQRLAVARVLLKDPPVLFFDEATSALDVYTETELMRNINSILTGQGKTSVFIAHRLRTISDADLIIVLQDGYVAEQGTHEQLLAMPGGVYHRLWQAQLTESTQPTDEEIERQREELEVVDEKKKQ
Function: Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of mitochondrial Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins . Hydrolyzes ATP (By similarity). Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity). Plays a role during copper stress, in a manner dependent on the copper metalloregulatory transcription factor CUF1 . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 80771 Sequence Length: 732 Subcellular Location: Mitochondrion inner membrane EC: 7.-.-.-
Q5B1Q2
MLRQAAQTRCWRTPARFVSHRPAFPRSNPVSAALGGTQFRKLSVKTQTDKNTLSDKKTAEADTSSSSSSAKSAAPSQQKTQNATTAQKNLLSESTVANKEQRKADWAIMREMAKYLWPKGDWGTKLRVGTALSLLVGAKVLNVEVPFYFKSIVDSMNVDFAAVGGTAYTVAGSMIIAYGATRIGATFFQELRNAVFASVAQKAIRKVARNVFEHLLRLDLNFHLSRQTGGLTRAIDRGTKGISFLLTSMVFHVVPTALEISLVCGILTHQYGIKFAAITATTMLAYSAFTIATTAWRTKFRKQANAADNRGATVAVDSLINYEAVKYFNNEKFEVARYDKALKAYEDASIKVTTSLAFLNSGQNMIFSSALAAMMYLAADGVATGSLTVGDLVMVNQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVNIKEKPDAKPLELKQGGQIRFENVTFGYHPERPILKNASFTIPAGQKFAIVGPSGCGKSTILRLLFRYYDVQEGRILVDGQDIRHVTIESLRKAIGVVPQDTPLFNDTIEHNIRYGRLDASDEEVRKAARRAHIHELVERLPEGYRTAVGERGMMISGGEKQRLAISRLLLKDPQLLFFDEATSALDTYTEQALMQNINSILKEKGRTSVFVAHRLRTIYDCDQILVLKDGQVAELGSHRELLDLDGIYAELWSAQETSLAQDPEYERNAGLEGETAGEVEDKAPRQ
Function: Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by nfs1 and other mitochondrial proteins (By similarity). Hydrolyzes ATP (By similarity). Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 79800 Sequence Length: 721 Subcellular Location: Mitochondrion inner membrane EC: 7.-.-.-
Q7RX59
MAPSIKLSTMATSLHRAHGTSALLRRPRLWAPRLSSIHATPTIANLRASFTTSSPRLFAPNGSAKDESKPAVSTVPKTTGRGPSDPLAAIDKTAQEQRKADWAIMKEMSKYLWPKGSWGDKARVLLAIGLLVGGKVLNVQVPFYFREIVDSLNIDFSTTGGSVTAVAGAMILGYGAARVGAVVSQELRNAVFASVAQKAIRKVARNTFEHLLNLDLSFHLSKQTGGLTRAIDRGTKGISFLLTSMVFHIVPTALEISMVCGILTYNFGWQYAALTALTMVSYTAFTILTTAWRTKFRRQANAADNKASTIAVDSLINYEAVKYFNNEAYEVGRYDKALAQYEKNSIKVATSLAFLNSGQNIIFSSALTVMMYMGAHGVATGQLTVGDLVLINQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVTIKEQPNAKPLTLTRGGEIEFKDVTFGYHPESPILRDLSLTIPAGKKVAIVGPSGCGKSTLLRLLFRFYDPQKGAIYIDGQDIRSVTLESLRRAIGVVPQDTPLFNDTVEHNIRYGNLSATPEQVIEAAKAAHIHEKIISWRDGYNTKVGERGLMISGGEKQRLAVSRLILKDPPLLFFDEATSALDTHTEQALMENINAILKGLGQKGEKKTSLFVAHRLRTIYDSDLIIVLKEGRVAEQGTHRELMERNGVYAQLWRAQEMLMTEEGEVSKKGEKEEVGEKKEA
Function: Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by egt-3 and other mitochondrial proteins (By similarity). Hydrolyzes ATP (By similarity). Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 78758 Sequence Length: 716 Subcellular Location: Mitochondrion inner membrane EC: 7.-.-.-
Q2G506
MPPETATNPKDARHDGWQTLKRFLPYLWPADNAVLRRRVVGAILMVLLGKATTLALPFAYKKAVDAMTLGGGAQPALTVALAFVLAYALGRFSGVLFDNLRNIVFERVGQDATRHLAENVFARLHKLSLRFHLARRTGEVTKVIERGTKSIDTMLYFLLFNIAPTVIELTAVIVIFWLNFGLGLVTATILAVIAYVWTTRTITEWRTHLREKMNRLDGQALARAVDSLLNYETVKYFGAESREEARYASAARAYADAAVKSENSLGLLNIAQALIVNLLMAGAMAWTVYGWSQGKLTVGDLVFVNTYLTQLFRPLDMLGMVYRTIRQGLIDMAEMFRLIDTHIEVADVPNAPALVVNRPSVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRILIDGQDIAHVTQTSLRAALGIVPQDSVLFNDTIGYNIAYGRDGASRAEVDAAAKGAAIADFIARLPQGYDTEVGERGLKLSGGEKQRVAIARTLVKNPPILLFDEATSALDTRTEQDILSTMRAVASHRTTISIAHRLSTIADSDTILVLDQGRLAEQGSHLDLLRRDGLYAEMWARQAAESAEVSEAAE
Function: Mediates the ATP-dependent export of glutathione-conjugated substrates, such as heavy metal-glutathione conjugates. ATP hydrolysis is stimulated by glutathione binding. Protects cells against toxic heavy metal ions, such as silver and mercury ions. May also mediate the transport of glutathione-conjugated aromatic hydrocarbons, such as dinitrobenzene. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 66867 Sequence Length: 608 Subcellular Location: Cell inner membrane EC: 7.-.-.-
O14286
MLERCPWKLISSPRNIPARSFLNSRGTYLVLRKSNILPLQHILRFSNFASKQCFPLRNGNNSASKALWNNKSKEKEPLNTSVKLASDVPDDKNVTGQMIVKDMLQYIWPKGKTNLKVRVVSALALLVAAKILNVQVPFYFKSIIDTMNTTLVQEVGALWSTVGAVVLGYGFARIFSTVFQELRNSVFAIVSQSAIRSVSSNVYQHLLNLDMNFHLSKQTGSITRAMDRGTKGISFILSSMVLHIIPITLEIAMVSGILTYKYGPSFSAIAATTVALYALFTVRTTSWRTVFRRQANAADSKASAAAIESLINYEAVKTFNNESYEMSRYEKHLSAYEKANVKVASSLAFLNSGQAIIFSTALTLMMYMGCRGIVTSNLTVGDLVMINQLVFQLSIPLNFLGSVYREMRQAFTDMEQLFSLKRINIQVKEAPDARDLVLKGGSIQFDNVHFSYNPNRPILNGCSFNIPAGAKVAFVGASGCGKSTILRLLFRFYDTDSGKILIDNQRLDQITLNSLRKAIGVVPQDTPLFNDTILYNIGYGNPKASNDEIVEAAKKAKIHDIIESFPEGYQTKVGERGLMISGGEKQRLAVSRLLLKNPEILFFDEATSALDTNTERALLRNINDLIKGSHKTSVFIAHRLRTIKDCDIIFVLEKGRVVEQGSHEQLMAKNSVYTSMWHSQESPFGESNKSGDA
Function: Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by nfs1 and other mitochondrial proteins . Hydrolyzes ATP (By similarity). Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 77056 Sequence Length: 693 Subcellular Location: Mitochondrion inner membrane EC: 7.-.-.-
A6ZYV0
MLKCICRVYSQPLAQMVTSPLFKHMGSAGTYTILPITNLRHLSTKNCPLKIKSNRSEPLQFGDFERQVPCSRKSGSSKNVQKRLYELRQLKTVLSETFGVTEYASFFESLRNALHINNCSENEKKKLLYDIILHQHELYPEVARKIGFYLPGEVHRWFWYHIPKSESFNHYLFLLKSDVLLFTSNYCTRFTNRLIKGTEMERQLATFQIFLHDETNIKFIMEKVLKLHTFDSLIALVNGLVKAKNFRFIKVFIQALLQKLEQHCYSGKDGAKQKNLRYVKFNNTLLYYLLKSGNVELFIKTFQEELKFIVSSGLLNHIDGNEHILNFPIHHYLNLLRISNRQEELFNVISCLQSSPLMKYKLFKEFLMGELIASFQAFRDPKLVCKYLLSSYSSKASANILNALGIWGWLYHSKSTTLTAPTLARELKNKNNILPNTMRIGSPVTVPILTELYRSLLSSSSVSLESGQFKNCLLDLYYKYKSFLSEEAHKYRYWRNDTGILNVFLNYIRFQAREPRLAYNVLLDFYSQPFAKKVVLTTTLCPFSIVAYKNHTLTQAELSELLQVMHKNGVPLTFKFCSAMVMHYVKMRDEKGARSWYNKILFGGFEIRHMALIQIIKDQGWPFPKNFDETLLTELVENNNIKEPTDSTLFTDEDMFEEDGKPRFNDDDVNKCTNIIRETLKSLN
Function: Translation factor specific for subunit 6 of the mitochondrial ATPase. Required for assembly of the CF(0) component of the ATPase (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 79756 Sequence Length: 684 Subcellular Location: Mitochondrion inner membrane
Q9SRP6
MEDAAAPNSGSEFNPGARRGKSIDECQDMIRRSFRNPIVKFLMEQMEKSGCRVGDNFVKAVVCTGPVAGGYTKGRGITVCSNYLTIQDEVNQVVIHELIHAYDECRAKNLDWTNCAHHACSEIRAGHLSGDCHFKRELLRGFIKLRGHEQECIKRRVLKSLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP
Function: Has a dual role in the assembly of mitochondrial ATPase (By similarity). Acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side (By similarity). Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 21798 Sequence Length: 194 Subcellular Location: Mitochondrion inner membrane EC: 3.4.24.-
A6SSS5
MSSSEGNKPPLVPDSTKESEPQFDPTARTRNWFSILLGTMPPSHQILYREDQYARHEKRDCDRCEEWRDYNLKYSPIVIFMQKNIRDLNGKLDADNIRCRRCPTRITEDGKTVRQGGGFSPEHGIQLCANEMRDSKHVEDTLAHEMVHAWDHLRWKVDWGDLRHAACSEIRAASLSGECRWAREFWTRNNYRVTQQHQDCVRRRAVKSVLARPWCKDDVQAVRVVNEVWDSCYSDTRPFDEIYK
Function: Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 28756 Sequence Length: 244 Subcellular Location: Mitochondrion inner membrane EC: 3.4.24.-
Q2H8S7
MATPPPPQLSSTSTQPPSPSSASSNPQQPSPPKTQPPLPRFLDNDPARTGYDPTVKWWLNYFRIMTGQVTREGVEHYREDRYKANEARDCARCEADRAYLFAYSPTIRFLRDKVAALNGTLDETNVVCRRCPARVAEDGRVVRQGGGFSPEHGILICANEMRDRSHLEDTLAHEMVHAWDHLRWKVDWSGGGNLRHAACTEIRASMLSGECRWTRETMTRGNWTLTQQFQNCVRMRAIQSVMARPTCRDDVHATKVVNEVWDSCFSDKRPFEEVYR
Function: Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 31556 Sequence Length: 276 Subcellular Location: Mitochondrion inner membrane EC: 3.4.24.-
Q1E910
MAEAASSGSNSTSPPKDNGYIPGDDAWTICRNLWRGLTGKMTQEGMEQFRVARDVRNEKEDCKRCEDQRDYLLQYSPLIRFLQDNIQQLGGNISKHNIFCRRCKNRQAGGFDPDYGIQICANEMRNQGHLEDTLAHEMIHAYDHMRFKVDWDDNLRHAACAEIRASNLSGECRWMREFFSRGQWKFAQHHQECVRRRAILSVQARPACKDEQHATQVVNEVWDSCFRDTRPFDEIYR
Function: Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 27737 Sequence Length: 237 Subcellular Location: Mitochondrion inner membrane EC: 3.4.24.-
P0CQ26
MPENPSSSPTEPPEQSAAFEKWRSGLAQFTGLGLSESEKAERERLKAQGKLAKDWDKCEGWKRDLMNYSPMITFLLNHLKLAGCPFPSSAMQCHPCPENRAGGFSPDHGILLCQDRFFNKKHMEDTLAHELVHAFDHCRFKVDWGNLRHHACSEIRAANLSGDCRFTREVKRGFYAFNKQHQACVKRRAILSVLANPACTSPEMAEKAVNEVWESCFTDTRPFDEIY
Function: Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 25850 Sequence Length: 227 Subcellular Location: Mitochondrion inner membrane EC: 3.4.24.-
P93298
MRRIFLFDENSLNSSSTIDTSSASTIDTSFASQCTNFSSGQASGTQDTHAGIFEDCPGLNPNDERVVELQCEIREKCEALTQDPEMGLILGEALHAESDNVPFLQSIADDLTQNGVSGEAFQEALNIVGQAAASPLDQFEIVPLIPMHIGNFYFSFTNSSLFMLLTLSFFLLLIHFVTKKGGGNLVPNAWQSLVELLYDFVLNLVKEQIGGLSGNVKQMFFPCILVTFLFLLFCNLQGMIPYSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLCMNDIFYFIGALGPLFIVLALTGLELGVAILQAYVFTILICIYLNDAINLH
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 42342 Sequence Length: 385 Subcellular Location: Mitochondrion inner membrane
B2KEW6
MIEEILTHHIIDHKLTYKLFGVIPLSSNLITLFCITIGVFILFTLIAKFRRPVLLMTAIEGLVVFIRDEIVVANFGEHGKKLTPYFCTLFIFLLFSNSLGMIPQMRTITGSISVTIGMALTSLSLIIFLGVKQNGLLGYLKHFVPEGTPWFLAPLLFFLEILGLFTKTAALALRLFANMIAGHMVIICFICLIFIMTAINKYAGIFTAIPSTGLSLFVNLLEVLVILIQTYVFTLLTAIFAGEAYAHH
Function: Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 27595 Sequence Length: 248 Subcellular Location: Cell membrane
Q830Z9
MEEKKLLFNIGPIWFDGTIVLMVLLTCIIVFAFVYACTRNMKLRPKGKQTVIEWLVDFIRGIITDNLPRKEVSNFHLMAFTLFMFVLVSNILGLVTKIVVGDDLSVWKSPTADPIVTLTLAMMMIVLTHFFGMKRFGFKGYLVNSYLRPVGFLLPVKLMEEFTNLLTLGLRLYGNIFAGEVLLGLIAGTVASVGLWVIPLAIPLEMIWVAFSIFIGCIQAFIFVTLSMVYMSHKIETEE
Function: Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 27002 Sequence Length: 239 Subcellular Location: Cell membrane
Q0RDA8
MEVFVVPVLADEGFEGPTKEVFQTPHWFDVGIGSVNLYLNKATALTIFAALFVGVIFWLGFRRAKIIPRGIQNLCESAYDFVDLQIARGVIGEKGARYTPYLLVLFSFVLVSNVLAIIPAAQFPATSRIAVPMVLAVVTWVMFIYAGIKSNGAGAYFKEMIDPAPTAPLAIRLLLGPIEILSTLIVRPFTLAIRLFANMFAGHLLLLVFSLGADYLLPKPPFVFGVASLLVAIVLTAFELVIDALQAYIITILTAAYIGGAMAHGEHEVAPSEELAEHAPVGVPAAAHA
Function: Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 31110 Sequence Length: 289 Subcellular Location: Cell membrane
P21535
MFITSPLEQFELNNYFGFYLFNYHFDFSNFGFYLGLSALIAISLAIINLTPYGSGAKIVPQKFGIAMEAIYFTMLNLVENQIHSSKTVSGQSYFPFIWSLFVLILFSNLLRLIPYGYATTAQLIFTLGLSISILIGATILGLQQHKAKVFGLFLPSGTPTPLIPLLVLIEFVSYIARGLSLGIRLGANIIAGHLTMSILGGLIFTFMGLNLITFIIGFLPITVLVAISLLEFGIAFIQAYVFAILTCGFINDSLNLH
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 28294 Sequence Length: 257 Subcellular Location: Mitochondrion inner membrane
O79406
MIMSFFDQFLSPSFLGIPLIALAISIPWLMFPTPTNRWLNNRLLTLQAWFINRFIYQLMQPMNLGGHKWAILFTALMLFLITINLLGLLPYTFTPTTQLSLNMAFALPLWLTTVLIGMFNQPTIALGHLLPEGTPTPLVPVLIIIETISLFIRPLALGVRLTANLTAGHLLMQLIATAAFVLLTMMPTVALLTSLVLFLLTILEVAVAMIQAYVFVLLLSLYLQENV
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25382 Sequence Length: 227 Subcellular Location: Mitochondrion inner membrane
Q7SI16
MAARNAALKVDWAKITTSLGLRGQTAASLQAFKKRNDDARRKLQQLSELPTTVDFAAYRSTLKNQAIVNEIEKRFTSFKPATYDVNRQLKAIEAFEVEAIKNAEATKTKVDLELKDLEKTLTNIETARPFDELTVDEVAAAEPSIDEKTSKLVSKGRWSVPGYKERFGDLSVL
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/atp6 static relative to the rotary elements (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 19365 Sequence Length: 173 Subcellular Location: Mitochondrion inner membrane
O94390
MSKVASAAGKAIDWASVASKLKLDAATASAIANFRSRHAQAVAKLGTLREQATTVDFATYRSVLANKEIVNRIESSMKSFKPVKIDLNSQLKAINAFEAKASEGAKKNVELVKAELQNLSATLKNIEQARPTEEITIEDMKQAVPEIEKIVETMVTKGKWVIPGYREKFGDLSIM
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 19138 Sequence Length: 175 Subcellular Location: Mitochondrion inner membrane
Q6CFH9
MSVAAARSSAVKVDWGKIVSSLGLTGATVSSLQAFRKRHEEAKKNAYELQNQPTTVDFAHYRKVLKNQKVVDEIEQHFKSFKPVTYDVSKQLKTIDAFEAKAIEDAKATEGKVNQEIGDLQKTLENIESARPFDQLSVDDVFKARPDLEKKIEEMVKKGRWSVPGYNEKFGSVVLM
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain . F-type ATP synthases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk . During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation . Part of the complex F(0) domain and the peripheral stalk, which acts as a stator to hold the catalytic alpha/ATP1(3)beta/ATP2(3) subcomplex and subunit a/ATP6 static relative to the rotary elements . Location Topology: Peripheral membrane protein Sequence Mass (Da): 19821 Sequence Length: 176 Subcellular Location: Mitochondrion inner membrane
Q0C0Z8
MDISPAEISGILKSQIENFGVEAEVSDVGQVLSVGDGIARVYGLDSVQAGELVEFNGGIKGMALNLEKDNVGVVIFGEDRSIKEGDTVKRTSEIVAAPVGKALLGRVVNALGEPIDGKGPLKDVAARSQVDVKAPGIIPRKSVHEPMMTGIKAIDGMIPVGRGQRELIIGDRQTGKTAICIDTILNQKPTNDAAKSDKDKLFCVYVAIGQKRSTVAQVVKVLEERGALDYTIVVSATASESAPLQYLAPFTGCTMGEWFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDNGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFNSGIRPAVNVGLSVSRVGSAAQTKAMKKVAGSMKGELAQYREMAAFAKFGSDLDAATQRLLNRGARLTELLKQPQYSPLLMEEQVVIIYAGTRGYLDKVALKDVTRYEKELLVHMRGAKKELLAKLREKKELTSEIEDEIKKALDDFTSKFA
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 55417 Sequence Length: 511 Subcellular Location: Cell inner membrane EC: 7.1.2.2
Q5FKY2
MSIKAEEISSLIKQQLEHYDDKLDINEVGVVTYVGDGIARAHGLDDVLSGELLKFDNGSFGIAQNLESNDVGIIILGQFDNIREGDRVQRTGRIMEVPVGDALIGRVVNPLGQPVDGLGEIKSDKTRPIEAKAPGVMDRQSVNQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKGQDVICIYVAIGQKESTVRTQVETLKRFGAMDYTIVVEAGPSEPAPMLYIAPYAGTAMGEEFMYNGKDVLIVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDKLGGGSLTALPIIQTEAGDISAYIPTNVISITDGQIFLQSDLFFAGTRPAIDAGNSVSRVGGNAQIKAMKKVAGTLRTDLTAYRELESFAQFGSDLDQATQAKLNRGQRTVEVLKQPLHDPIPVEKQVLILYALTHGYLDAIPVEDISRFQNELFDNFDSSHADLLKTIRETGKLPDDKELSAAIEEFSESFTPSEK
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 54932 Sequence Length: 503 Subcellular Location: Cell membrane EC: 7.1.2.2
Q6YXK3
MVKIRPDEISSIIRKQIEDYSQEIKVVNVGTVLQVGDGIARIYGLDKVMAGELVEFEDNSIGIALNLESDNVGVVLMGDGLTIQEGSSVKATGKIAQIPVSDGYLGRVVNALAQPIDGKGQIPASEFRLIESSAPGIISRRSVYEPMQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQKGQNVICVYVAIGQKASSVAQVVNTFEERGALEYTIVVAEAANSPATLQYLAPYTGAALAEYFMYRKQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSSQLGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQSQSSPLAVEEQVATIYTGVNGYLDVLEVDQVKKFLVQLREYLTTNKPQFAEIIRSTKVFTEQAEGILKEAIKEHTELFLLQEDK
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 55273 Sequence Length: 507 Subcellular Location: Plastid EC: 7.1.2.2
C0HK51
ATAKAAPTEVSSILESKIRGVSDEANLDETGRVLSVGDGIARVFGLNNCQAEELVEFASGVKGMALNLEPGQVGIVLFGSDREVKEGEIVKRTGKIVDVPIGPGMLGRVVDALGNPIDGKGPIEATGYAIAQLKAPGILPRRSVFEPMQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNDGNDESKKLYCVYVAVGQKRSTVAQLVQTLEQNDAMKYSIVVAATASEAAPLQYLAPFTACAIAEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDANGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLSRGERLTQLLKQKQYSPQASEEQVPVIYAGVNGFLDNIPIERIPEFEEQFIAYLKANEGDILEAIRTKGELSSELLDKLKSATETFVATF
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain . F-type ATP synthases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk . During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). Subunits alpha/ATP1 and beta/ATP2 form the catalytic core in F(1) (By similarity). Rotation of the central stalk against the surrounding alpha/ATP1(3)beta/ATP2(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta/ATP2 subunits (By similarity). Subunit alpha/ATP1 does not bear the catalytic high-affinity ATP-binding sites (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 54950 Sequence Length: 510 Subcellular Location: Mitochondrion inner membrane
P84582
IVNTGTVLQVGDGIARIAQIPVSEAYLGRVINALAKPIDGRLIESPAPGIISRASSVAQVVNALQERKFLVELRTQFQEIISSTKLRNQADQTITLIR
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 10621 Sequence Length: 98 Subcellular Location: Plastid EC: 7.1.2.2
P17674
MSIKAEEISALIKQQIENYQSEIKVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGMAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMEVPVGEQLIGRVVNSLGQPVDGLGPVETTKTRPIEGAAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMVCIYVAIGQKESTVRNVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVTMGEEFMYNGKHVLVIYDDLTKQASAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDQATQAKLNRGARTVEILKQGLHKPLRVEKQVAVLYALTKGFLDDVPVSDITRFEDEYLTWLESNRKEVLESIRTTGGLPEAGLFESALEEFKKTFIASE
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 54603 Sequence Length: 502 Subcellular Location: Cell membrane EC: 7.1.2.2
A3DIM9
MATENVGTVVQIIGPVIDIRFERGKLPSIYNAIKINSEGIDIVAEVMQYTGNDTVRCVSMNSTDGLKRGMKAVDTGEPIKVPVGKEVLGRVFNVLGEPIDGKGDVKATTYLPIHREAPGLDEQKPVTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSVFTGVGERSREGNDLWNEMNESGVIEKTALVFGQMNEPPGSRMRVGLTGLTMAEYFRDELGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRHIVEQGIYPAVDPLDSTSRVLDRRIVGDEHYTVARKVQEILQRYKELQDIIAILGLDELSEEDKLIVFRARKIQRFLSQPFFVAEAYTGYKGKFVRIKDTIRGFKEIIEGKMDDIPEAAFYMAGTIDEVYERAKKM
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 51013 Sequence Length: 464 Subcellular Location: Cell membrane EC: 7.1.2.2
P50002
MAQNIGKVVQVIGPVVDVKFQKDKLPKLNNAVNIELNGHTLVIEVAQQLGDDIVRCIAMDSTDGLMRNQEAVDTGSAIQVPVGKATLGRMFNVLGEPIDGKPFDTKDVVMHPIHRHPPSFEEQQTQPEMFETGIKVVDLICPYVRGGKIGLFGGAGVGKTVLIQELINNIATQHGGLSVFAGVGERTREGNDLYYEMMESGVINKTALCFGQMNEPPGARMRIALAGLTMAEYFRDDEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTSKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAITEKGIYPAVDPLDSTSRILDPKIVGQEHYETAREVQEILQRYKELQDIIAILGMDELSDADKITVSRARKVERFLSQPFNVAEQFTGTAGVYVTIGDTIKGFKEILEGQHDDLPESAFLLVGTIEDAVVKAKKIKG
Function: Produces ATP from ADP in the presence of a sodium ion gradient across the membrane. The beta chain is the catalytic subunit. Catalytic Activity: ATP + H2O + 4 Na(+)(in) = ADP + H(+) + 4 Na(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 50663 Sequence Length: 466 Subcellular Location: Cell membrane EC: 7.2.2.1
Q4FQ37
MSSGRIVQIIGAVLDVEFNRNEVPRIYDALQVDGTETTLEVQQQLGDGIVRTIAMGSTEGLKRNLSVTNTGGPISVPVGVGTLGRIMDVLGRPIDEEGPVEADERWSIHREAPSYAEQSNSTELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELINNIALKHEGLSVFAGVGERTREGNDFYHEMQEAGVVNTEDFSKSKVAMVYGQMNEPPGNRLRVALSGLTMAEYFRDTKDPATGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGMLQERITSTQSGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASQGIYPAVDPLDSTSRQLDPLVIGEEHYNVARGVQEVLQRYKELKDIIAILGMDELSEEDKLVVYRARKIQRFLSQPFHVAEVFTGAPGKYVPLRDTIASFKAIIAGEYDSLPEQAFYMAGGIDEVVAKAEKMKSSAA
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 51731 Sequence Length: 477 Subcellular Location: Cell inner membrane EC: 7.1.2.2
A0T0R6
MVETTNKGYVCQIIGPVLDIEFPGGKLPPIYSAIKIETADGIGNIVEVQQLLGDNKVRAVSMRSTDGLKRGVEAVDLGAPITVPVGVPTLGRIFNVIGEPVDEQGDVVVDQTLPIHRDAPAFTELETKPSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYEEMKESGVINSSNFAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLDSTSTMLQPGIVSEVHYETAETVKETLQRYKELQDIIAILGIDELSEEDRLVVARARKVERFLSQPFFVAEIFTGSPGKYVSLEETIKGFTMILNGELDDLPEQSFYLVGNIDEAIAKAETLK
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. Catalytic Activity: ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 51142 Sequence Length: 474 Subcellular Location: Plastid EC: 7.1.2.2
Q89B42
MSSTKDELQLYAKAIYNCAISNHQSLDHWKTMLQLMANILNNEIIKNLISKAYFSQHVISLFIDLCCNKVNQYGINLIKILAENKRLMLLEKLYKEFINLCELYQGVVNITVISAHKLNEEYISKINIMLKKRFFKKINVTYVIDESIIGGLIIKFCDTVINASIHSRLEKLLNILQY
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 20691 Sequence Length: 178 Subcellular Location: Cell membrane
Q6B8Q9
MSSQGFMSKIALPYAEALVESASSASALDQINQDLSLISEILNQSQELKTFFYNPLITTEIKKNVVSSLFTNQVHSLVIRFLLVLIDRRRIALLDVIISKYLELVYQLQSTVIAEVLTPVLLTDVQQSALINKIKDMTNSKTVKLVITIKPMLIAGFIIKIGSKTIDTSLYGRLKHISAYLNAVS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 20573 Sequence Length: 185 Subcellular Location: Plastid
O78476
MIAMNNKLAQPYAMAFLEFSLDAKQTLDTTIADLTQIKTILHDSVDLSKTLSNPLLSIKAKKEVIKAIFEPNISKNTLKFLLVLCDRGRSANLSSIIDNTIELAYKKASIEIAYVTTATAFSSNQQEALVEKLKSMTSTEQIKLNITVDKTLIGGFKVQIGSKVIDTSIQGQLRQLASHLGSSAI
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 20219 Sequence Length: 185 Subcellular Location: Plastid
Q9K6H2
MSNHAVANRYAVALFELAQEKGLHESFVSELELIKAVFQDTPELMQFLTHPKTELTQKRELLEKTFKGKVNDTIFNTLVVLVERKRIDLIIPVVQKFKSLSYDAQKIAEAFVYSAKPLSEAEKDQLSVLFAKKVGKAKLLIENIVDPSIIGGLKIRIGDRIYDGSIKGQLDVLHRELVSGPRS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 20605 Sequence Length: 183 Subcellular Location: Cell membrane
B8CZ13
MINNEVSRKYSSALLEVALESDNLSRFKEELEGISKALKQYDDLKKILYHPRVLPDDKKEVIHQVFSDKVSEPVFNFLNLIVDKRREVYLDFIIRDFIKQANRKEGLVKIEVVSAIELSEKQREQLKNKLKKALNKKIELKTKIDPGIIGGIIIKIGDRLIDGSIKHQLDSIKESIEKIPVTELGVIQNES
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 21978 Sequence Length: 191 Subcellular Location: Cell inner membrane
Q7VJ24
MFNIISKKYTQALVDSGSNLDETLSILKGLSLALKDKRNADIIASPFLSKTQKEQFLLESVGKVDMKLQNFFRLLAQSDRILLIPYISDELERRLLARKKEYAATLTAKESLDTKTLEKIQDSLAKKLGVKLSIKQRLSEVDGIKLSVEDLGIEVSFSKERFSNDLKHHILKAL
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 19695 Sequence Length: 174 Subcellular Location: Cell inner membrane
B0TI53
MLTGAVARRYAQALLEIGIQTKTLDALEGELGRFVEMIGHPELQRFLFHPSIVVAEKKDLVGRLLATGAFSETARAFILLVIDRRRESYFADIFREFVRLANKVRNIEEARVTSAVELAPEQVERLRSQLAAATGKAIVLRMAVDPDLIGGLVVAFGDRIIDGSVAGKIRDLRESLLRSPLPSLS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 20424 Sequence Length: 185 Subcellular Location: Cell membrane
B2XT89
MSTNSRAGDAYAYALLKVLFNETKDFDSFSDLVGDVLDFVTIFNTCPSIEEFFANPTYSPIQKKQFLYDFFGRSLNPILMSFLYLLCDTKRIIYISSIISIFLETLLKNTNSHIVEVQTPTGKDYKLDISKLETTLSGWFNKIQKNNDEAVNFLNFDESLVIFTVKEVPGLLGGFRLNFVTDSKVIDFSIAGKIKRLAAVLNY
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 23059 Sequence Length: 203 Subcellular Location: Plastid
Q0I5X0
MSELTTIARPYAKAVFDFAVEQSEKDKSTVEKWANMLEFLSELIRHDKVQTYLTSTSSTFKLADTVISICSEQLDQYGQNLVRLMAENKRLSVLPAVFNEFKSYVEEYKSLSQVEVISAQQLNDVQQQKIITAMEKRLARKVILNCRIDSSLIAGAIIRTNDFVIDGSCRGQINRLANELRL
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 20717 Sequence Length: 182 Subcellular Location: Cell inner membrane
A5V3X2
MENSGGIQASLSGRYATALFGLARDEKAIDAVSASLQSLKAALTESDDFRRLTTSPLVSRDEAMKAVAATAASLGIDPLTTKFLGVLAQNRRLGQLGAVIRSFGTLSARHRGETTAEVTSAHPLTATQVKALKAKLKTQLDRDVAVDLTVDPSILGGLIVKIGSRQIDGSIRSKLNSLAIAMKG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 19272 Sequence Length: 184 Subcellular Location: Cell inner membrane
Q7UFB8
MVKLPSLKFLRRSTDETPNVSETASHSTVLDVGAEKLGKTYARALLAATQADGSTDAVVSDLNAICDEALLHNPKLQLAFQSPQIDADEKCRVVDRLFGGNSHPTLIKLMKVMAKRGRLGYLVAVRDAAVDLFDEAAGRVVAEVRTAVPMTEQLRGEVTQQLSSRFGKTVRLRESVDTELIGGMVIRVGDTVFDSSVASRLDKLGKSAAAGFARQLIEQSDRFSSSS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 24508 Sequence Length: 227 Subcellular Location: Cell inner membrane
P72244
MSEPASISAAIAGRYATAIFDLAQEAKGIDALSADVDALTAALAGSAELRDLISSPVYTREEQGDAIAAVAAKMGLSAPLANGLKLMATKRRLFALPQLLKGLAAAIAEAKGEMTADVTSATALSAAQAEKLAATLAKQTGKTVKLNVAVDESLIGGMIVKLGSRMIDTTVKAKLASLQNAMKEVG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 18913 Sequence Length: 186 Subcellular Location: Cellular chromatophore membrane
Q2RV21
MSSHKAGVTGVAERYATALYELAEDRGALDQVSADLRSLKAMLDESGDLRRVIASPVIGRDDQRKALTALAEKAGFHEIVRNFLGVVAAKHRSFAVPGMIGAFLERLAARRGEVTARIVSATALTSAQKSALTTALNKATGNTVTIDASVDPALLGGMVVRVGSRMVDSSLSTKLKRLQLAMKGVG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 19576 Sequence Length: 186 Subcellular Location: Cell inner membrane
A7IH28
MAAQGARHGLQVRERCGVADTIVSGMAGRYATALFELATEAGAVDSVKADLDRLSALIAESADLARLVKSPVFSAEEQLKAISAVLDQAGISGLAGNFVRRVAQNRRLFALPRMVADYASLVAAMRGETTAQVTVPAPLSDAHFFALKDALAQQTGKDVILDVTVDPSILGGLIVKLGSRMVDASLKTKLNSIRHAMKEVR
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Peripheral membrane protein Sequence Mass (Da): 21243 Sequence Length: 201 Subcellular Location: Cell inner membrane
Q6C877
MFSVARTAIRGAARPAVRIARRGYAETASVDKLRLTLALPHQSIYNQKEVTQVNIPSTAGELGILANHVPTIQQLKPGVVEVIETNGETKSYFISGGFATVQPDSELSVNSIEAFQAEDFSPEAIKSLTAEAQKNAQSADEAVAAEAEIELEVLEALAHFAK
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain . F-type ATP synthases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk . During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation . Part of the complex F(1) domain and the central stalk which is part of the complex rotary element . Rotation of the central stalk against the surrounding alpha/ATP1(3)beta/ATP2(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta/ATP2 subunits . Location Topology: Peripheral membrane protein Sequence Mass (Da): 17349 Sequence Length: 162 Subcellular Location: Mitochondrion inner membrane
B2KEX4
MKKLTFSFISPERPIVQNQEADFVALPAFEGEMGVLPGHVNSVVILMPGFVRFKNNGEEKEFAIIDGFAEVFKDHIDVFASEASLSEEKQSEEQKQRLERAKKALSSQDADIDIELAEIQLKTQILKMKMKKRKM
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15359 Sequence Length: 135 Subcellular Location: Cell membrane
B1H0B4
MNKFEVEILSPEGIVFKGATPSVSFPTTRGIITVLSGHINLITKLNSGEIIIEATDGTKKIIVSGGFIEIVNNNVNVVAEFAAHSDEISRQKIKQAIDHAKDMKNKRKEFVNMYAIESQLKKSAVDLKSGLEIKRKKI
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15223 Sequence Length: 138 Subcellular Location: Cell inner membrane
P29709
MATFKLEVVTPLKKVLDRDAEMVIMRTIEGDMGVMADHAPFVAELAVGEMKIKSANGEEAYFVSGGFLEISKEKTMILADEAIDVKEIDVERAKREAEIAKETLVKLKEDKDIAVTQKSLQEALTKVRIAEQYMHHL
Function: Produces ATP from ADP in the presence of a sodium gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15351 Sequence Length: 137 Subcellular Location: Cell inner membrane
Q88BX5
MAMTVHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGAHEVFYISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNLKGADFDYGAAAARLAEAAAQLRTVQQMRKGK
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14538 Sequence Length: 139 Subcellular Location: Cell inner membrane
Q0AUD4
MAESTFMLEVVTPERILYRDEIQFMVAPGIEGELGIMKNHAPLVAALNIGVLRYQTSTGVDKRMAISGGFMEVIDNGTRVLAETAEHGSEIDVLRAKAAKERAEKRLEVRSEEINHARAKMALQRAIARIRASEKPL
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15202 Sequence Length: 137 Subcellular Location: Cell membrane
A0T0R7
MVMDIRVLTPDRVICSTTADEVILPGLTGQVGVLDGHATLITALDTGLLRIKLADKWTPIILCGGLAEIDRNRVTVLVNDVEELVAVELSEATKELEKATSAIENAETSKARLDASVELKKATARLEGINYLS
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14284 Sequence Length: 133 Subcellular Location: Plastid
Q47M83
MAVSKKLFVELVTPERELWAGEGDMVIAKTVEGEIGIQPGHVPVLALLAPGSVVRVLGARESGEVRAAVHGGFMSVTLSDRVSILAEIAELAEEIDVERARAALKSAEREALGDAEMRARVARARGRLRAAKAEEAA
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14537 Sequence Length: 137 Subcellular Location: Cell membrane
Q9X1U5
MKVKIVTPYGIVYDRESDFISFRTVEGSMGILPRRAPIVTQLSVCDVKIKSGDDEYHLKVAGGFLLCDGKDVIIITEEAGREEDISPDRFMEARERVERVRRFFQSSL
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 12329 Sequence Length: 108 Subcellular Location: Cell inner membrane
Q8DLG7
MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14750 Sequence Length: 138 Subcellular Location: Cellular thylakoid membrane
B5YI25
MENKLKLEVITPYGEVINEEVDEVYTTGAEGDFGVFPGHCAFMTAIRIGSLSYKKDGQMHYLFVNRGYCEVLNDRVLVLVGSAERVEEIDVERAKAALARAEERLRKAQAGETDIDLARAQAALERATIRIQLATKLIPR
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15627 Sequence Length: 140 Subcellular Location: Cell inner membrane
Q7UFB9
MKRLLAISSLTLLASLVLLVVSPARSLAAQDEVTVVDALADAADSEDGDHDHDHEGDDHGHDEAAGDEHGHGDGDHAATPLLSFDGGSAIWNLIIFLCVLAILSKFVWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLDEAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSKLAMQVARSVVGRELSADDHADLIRQSMERLPSQN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 25894 Sequence Length: 242 Subcellular Location: Cell inner membrane
O05332
MANETNAVEAAAAVAGHAAEAAEKGGMPQLDFSTFPNQIFWLLLALGAIYWLLKNIAIPRIAAILADRAGTISGDLAAAEQYKLKAKDAEAAYAKALADARAQAQKIIAETRAVIQKDLDAATAKADADIAARVAQSEVKIAEIRAGALEAVQIVATDTATAIVTALGGKADMGALNAAVGQRVKG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 19065 Sequence Length: 186 Subcellular Location: Cellular chromatophore membrane
B6IX46
MTQEVAPPAAAQDDAHGTAEHIAEGVAAETAEHAKGGLPQLNPDTYPTQIFWLAVTFGLLLFLMSKVALPRVAEVLEARQEKIADDLDRAGALKAEADAVIENYERELAEARAKAQKVLSDATLAAESETTQRLGELAADLAERARAAEARIEQARRAALGNIRGVAAETAVAAAAKLAGLDLDPATAEAAVEEALNRVRQEVV
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 21509 Sequence Length: 204 Subcellular Location: Cell inner membrane
A5CQ56
MLTPHNVMAAGEEAPSILLPAVYDIVWSAVVFVVLLVVIWKYALPRVYAMLDGRTEAIAGGIEKAERAQAEADAAKAELTAQLAEARAEAGRIREQARVDATAIAAEIKEQATADAARITASAQQQIEAERQQAVVSLRSEVGSLAIDLASGVIGQSLTDDQRSTALVDRFLADLEASETAGRTGSAS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 19801 Sequence Length: 188 Subcellular Location: Cell membrane
O05098
MEFNLVTIGFTIVNFIILMLILKHFFFDKVNKVIDDRNNEVALTIKKADAQNEEARLLKVESEKNLEDSKLQGKTIVENYKVKAEKVSEEITAEAKTEAQNILERAKRETQREKEKAEDEIKNQVVELAVLISSKALENSINEAEHRKLIEDFVSKVGI
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 18245 Sequence Length: 159 Subcellular Location: Cell membrane
B1KSS4
MNISIPQIIAAILNFIILLLIVKHFWFDKITAVVDSRQSEIINKIEDTDKNQKLALELKEKNELELGNAKKQGKTIVEEYKSKAENVYEDIVKEAHEEADRIIKKSRLEAERQKKNAEEEIRAEAVELAVLVSSKTLEKTIDDLEHRRLIKDFISKVGI
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 18336 Sequence Length: 159 Subcellular Location: Cell membrane
Q180X1
MEKALVGITWEFVFQIVNTFIIFLLLRKLLFKPVLNIIESRENDIKSDLAEGEKAKNEGLALKKEYESKINFAKDEGQEIIKQATIRAEQKSDDIVNTAKKDALDIKEKANKDIEQERQKVINEIKNDISNIALLAASKVIEKDLDKSKHEELIENFIKEVGEAK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 18884 Sequence Length: 165 Subcellular Location: Cell membrane
A0Q2Z8
MNFSIPTFVWTIINFLLLLVVLSYFLFKPVNEIIDKRSKDIEGDIEQARIDKDKAEELRIANEEEYKAAKKEGKIIVENYKAKAENVSEEIISDAHKEAEIIIERAKKEIQREREKAEYEIKNKTIELSLELSKKALERSIDEKMHRELIEEFISKVGN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 18654 Sequence Length: 159 Subcellular Location: Cell membrane
Q0ZS23
MQFASFISLDWGVVFQIVNTIVMYLILKKLLFKPVTKFMNDRQESIANSIKEAEETKKEAYALKAEYEAKINASKEEGQEIIKEASRKAEMRADEIIKNAQNEANRLMEKAHIEIEREKQKVVNELKDEISNIAILAASKVIEADIDKNKHEKLISDFIKEVGEATWQN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 19444 Sequence Length: 169 Subcellular Location: Cell membrane
Q6KI77
MLELGIFSSNTQNIGQSISERFAGIFPSWPIMLATLVSFTILLVVLTKLIYKPVKKMMKNRRDFIQNNIDESTKQVEKSNELLEKSNIEILDAKIKANTIIKDAQILAEEIKNNSIKDAKDKSKQLLEETKIYIRQQKVLFAKESKKEIVEIAGEMTKKILSESDVKLEDSKFLENLLKNDITK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 21091 Sequence Length: 184 Subcellular Location: Cell membrane
Q9MUT1
MTDILTNIFTILSRMSLAEGFGFNTDIFETNILNLAVVLGILLTSGREFFVSLLQNRQQNILQSINDADERYKEAAEKLQQAQNEFEQAKLEADQILAQSKKTASEIEVGLMNLIKEDTKKLLDMKQATISFEEEKAISEIRRQVIRLALQRALEQSKSRLNRRLQKRVTRLNIGLLGRLVTPNDV
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 21235 Sequence Length: 186 Subcellular Location: Plastid
B3PLV4
MNFNINQSSISDAITKTFGNLTINWPFFVFSFLTLILVVTIVTLLVYKPLKKMLKNRQNFIQNNIDESIKAKEAALKVQEEIDEKIIESSKHANQIIEQAKLERERIINNGIEVSNKKAEIIIEQANILVTKSQAEFENKQRKIIVENAVEIAKKIIGREIRDKDNLKMIEEMLES
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 20315 Sequence Length: 176 Subcellular Location: Cell membrane
Q1GXM6
MNINLTLIAQAISFAILIWFTTKFVWPYLLNAIETRQKTIADGLAAAERGKQELDMATQRSAEVVNDAKQKATSIIAQAEKRASEIVEEAKANAKAEGDRIIAGAKAEIDQEVNRAKEGLRQQVSALAVAGAEKILRKEIDAKAHADLLNAIANEL
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Location Topology: Single-pass membrane protein Sequence Mass (Da): 16951 Sequence Length: 156 Subcellular Location: Cell inner membrane