ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
A4G5P1
MPDIDKHKLSLSFSRAAAQYDAIAGFQQQVAARLAQLLPAIPATCVLDGGCGTGTSSALLTRHWPDALLLACDLSPEMVRQAHARQLTAVCGDLEQLPFSKACFDVVWSSLVLQWCQPQLAYPELQRVLKHGGRLLFSTLTSGSLHELESTFGEIDRHRRVLPFASEQQVVDALYAAGFEHVQCQAERWVTQHADLKTLLTSIRGIGANQTGAARRPGMMGKTQWQAAQVRYENLRDADGMLPLTYSLLFVSAEKSRAQD
Function: Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway. Catalytic Activity: malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Sequence Mass (Da): 28618 Sequence Length: 260 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.1.1.197
C1D5S5
MTEAFYTDKSRVRASFDRAAATYDRAAVLQREVCDRMATRLDLIRHAPARVLDAGSGTGYGAGLLRARYPEAQVTELDLAPSMLRASRDKQLPQGRLRRLFARAPALVCADLEQLPLASGSLDMVWSSLALQWLNTPDAVLAEFHRVLRVDGLLMFATLGPDTLKELRQAFAGIDGATHVNQFIDMHDMGDALVRAGFATPVMDVERIVLTYDEVKAVMRDLKAIGAHNATAGRGRGLMGRQAWQRIEAAYDRLRQDGRLPATYEVVYGHAWRPAARPRRKLDDGRDIIEFHPHAPA
Function: Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway. Catalytic Activity: malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Sequence Mass (Da): 33014 Sequence Length: 297 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.1.1.197
Q5ZT34
MTVNNEISKAFSKHADDYERVAKVQKEIGSRLFERLQYLKIAPRRILDLGCGPGFFSKELALLYPKAQIVGMDLSFAMLEQARKKQGWRRKWPLVSADMQKMPFATGAFDLVFANQVIHWSSSLGMVFRELNRVMNVNGCLMFTTLGPDTFKELQTAWSAANQYAHVNEFVDMHDIGDCLIAEHFMDPVIDMELLSIHYETLPQLLLALKTQGVRNINPKRNHGLTGKSAWKQFEAQYATMRTTTGKYPLTYEVVYGQAWKGAQRKMEQGIETWIPVSRVVKKS
Function: Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway. Catalytic Activity: malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Sequence Mass (Da): 32488 Sequence Length: 284 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.1.1.197
A0L3L9
MNLPNRGEGNRNGRVGKNFGRALNYHRKALVQQHVADELAERLVDFPLPERPRVLEIGCGTGFLSRHLMRQWPGGSFLFTDISAPMLVRCQSHLSDLPGQRQFMVMDGEHCAVRGPFDLVVSSMAMQWFGDLPGALQGLSSLLKTNGMLAFATLGDETFREWRGVCAQYGSPFGRPDYPDVAQLQEMWPSGGEGDVEEDHIPVAHSSGHGFLRALREVGAHQPSGQHRPVSAALMRRMLQATRGGQHGFTVTYHVLYGFYTRSFDDRPIH
Function: Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway. Catalytic Activity: malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Sequence Mass (Da): 30083 Sequence Length: 270 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.1.1.197
A6W0X8
MLITPDISALSYKRQLAKRFDRASQSYDSYADFQKVVLERLLAMLPLNQADVVLDLGTGTGQALGILSERLNPKCNIALDLSLQMLAVASERFSSLHNTHYVCADAERLPLQDRSCDLVFSSLAIQWCLSPLDLFKELYRVIKPGGYVVFSTLSQGSMPEISKAWFGLDNKEHVHQYMASDALLDSIRASELNLLSSQLSNISMWFDSPESAIYSLKKVGASLIASDGDPSVSPSKWKAFLLEYEKQRNELGIPLSYQVSFVVAQRPNSI
Function: Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway. Catalytic Activity: malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Sequence Mass (Da): 30062 Sequence Length: 270 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.1.1.197
Q609U9
MNSLPRPDIGPFADTPEKRWVGVSFGAAAVGYDGVAALQREVGESLLAGIRHLGPPPARMLDLGAGTGHFSGLLVAAFPTAECLALDIAEGMLRFLRSHRPGADGMGLVVGDAEALPLADESVDLIFSNMAFQWCERLDRAISECCRVLRPGGRLAFSTFGEATLAELRMAWRAVDGYTHVNAFATRRSVEQELRAQGFTKIRLDARTLRRGYPSVLALMKELKALGARNLTRNRPRHLLSRHTLERVSEAYGRLPGMASAVTASFEVLTALVEK
Function: Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway. Catalytic Activity: malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Sequence Mass (Da): 29869 Sequence Length: 275 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.1.1.197
A1U4A9
MAKHTFFVTGTDTGVGKTIVSAAILEAAKAAGKRTLAMKPIASGCDQTPEGLRNEDALMLQAAITEKLPYDTINPIALEPAIAPHVAAQQAGKQVTAQRIVGFCRGMQIRPADLLLIEGAGGWRVPLNDRETYAAVPGELKLPVILVVPLQLGCINHAMLSAEAIRADGLVVAGWVGNHPEEQVMSCEQDTLNYLSTHLGAPCLGVLPWLENTDTAEMPAILSRYLNITPLIEN
Function: Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. Catalytic Activity: (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Sequence Mass (Da): 24936 Sequence Length: 234 Pathway: Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Subcellular Location: Cytoplasm EC: 6.3.3.3
Q58695
MIFITGTDTGIGKTYVSSILAENLKKMGINVGYLKPVETGGREDTLTLKNILNTDDDLDLMNPINLKLPLSPNIAFDVENSPLTLDEIKEKIKNAYETLKEKYDFLIVEGAGGVCVPIKEDFLMSDLIKFLGLDAVVVSRPNLGTINHTLLTVEHLRNKGINVRGVIINCITDLSEVLYYEKTFETIEKVGNIEIIGIVKSREDFEIDFEKILR
Function: Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. Catalytic Activity: (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Sequence Mass (Da): 23935 Sequence Length: 214 Pathway: Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Subcellular Location: Cytoplasm EC: 6.3.3.3
B8IBW1
MSTLFVAGAGTEIGKTYVTAALTRALRASGRPVRALKPVASGVPDLSDPDFSASDTALLLAAQDLPVTPETVAAMTPWRFAAPLAPDLAAAREGRSLALADLVAWCETAIAAPAPGTAVLIEGVGGLMSPLTAEATGLAWLKALRLPVLLVSGSYLGAISHALTAIETLHHHAVDLRAVVVSETPGAPTPPETVAEAIARHAGVRVLCVARGGGFPAEGLDVVPA
Function: Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. Catalytic Activity: (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Sequence Mass (Da): 22754 Sequence Length: 225 Pathway: Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Subcellular Location: Cytoplasm EC: 6.3.3.3
B0JX07
MNSLLIAATDTDAGKTVVTTGLVAYWQKYYPSKALGLMKLMQTGQGDREWYEGLFQGQLEMITPLQYQAPLAPPVAADLEGRDIPLGTVWQALLNLQKSQDLVLIEGLGGLGCPVTHELTLADLAAQWRLKTLLVVPVKLGAISQTVANIALAEQKKVNLGGIILNCLEPRTETEIEQLTPIDLIQSLTNCPVLGVFPFIEDRRDLDKLASVVASWPEIKLSSI
Function: Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring (By similarity). This cyanobacterium does not encode bioA (which catalyzes the formation of the precursor for this reaction in the cannonical pathway), instead it encodes bioU, which replaces bioA and also performs the first half of the cannonical BioD reaction. Thus in this organism BioD has a different substrate (By similarity). Catalytic Activity: (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Sequence Mass (Da): 24417 Sequence Length: 224 Pathway: Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Subcellular Location: Cytoplasm EC: 6.3.3.3
B1MBZ5
MTILLVTGTSTGVGKTVATAALAAAAVRQGIDVTVCKPVQTGDDHDAGEVARLSGVTRVQTLVRYPEPLAPVASASRAGLELLDHTQMATAIVALDRPGALTLVEGAGGLLVELAADGKTLRDLAMVLDAPVLVVTTADLGTLNHTALTLEALAVQSVPCAGLVVGSFPAEPDLAQRLNRENLANQFGTPVRAVIPEGAARLMPPVFAELSIELFEPQWVAGLVA
Function: Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. Catalytic Activity: (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Sequence Mass (Da): 23095 Sequence Length: 225 Pathway: Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Subcellular Location: Cytoplasm EC: 6.3.3.3
A0QX66
MTVLAVTGTDTGVGKTVTTAALACAARLARRDVAVCKPVQTGTIDGDDDLGEVRRLSGVTALHGGWRYPEPLAPVAAAGRAGAPLPTRTELVGSVRAVDAAGRLTIVEGAGGLLVALGADGVTLRDLAHDLGAQVLIVVSPGLGTLNHTALTLEALAAHGLSCAGLVIGAWPAEPGVAELDNRTALEALAPVRAVLPAGAGAASPERFEALSAAAFDADWITSLS
Function: Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. Catalytic Activity: (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Sequence Mass (Da): 22430 Sequence Length: 225 Pathway: Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Subcellular Location: Cytoplasm EC: 6.3.3.3
C8V1D1
MGDSPKCLRDSLREALRRREDKLCRRKLTILPSSSVDFSSNDFLSLSTSPAYRARFLDILQQAPPLHPFASGGSRLLDGNSAYAEELENFIAAFHNAPSGLLFNSGYDANVGVFSSIPQPGDLIVYDELIHASAHEGMRLSRAGKRIKFPHSSPDGLRAVLQAEITADPRLLQGRRNVFIAFESVYSMDGDVAPIREFVEIVDQLLPYGNGYFLVDEAHATGVFGPRGSGVVQELGLEDRMFVRVHTFGKALASHGAIVLCCADTRDYLINYARSLIYTTALGFPFLASIRAAYELLVEGKTEQLQHKLGQLIAHFRTGLDNLNHKDSSTFEVEHFTNSPIFSLRSSVPRVLASVCQEQGYTVRAIMPPTVPAGKERVRVCLHAGNTVEEVDGLLETIATWLQRMEKQKARL
Function: 8-amino-7-oxononanoate synthase; part of the cluster involved in the biosynthesis of biotin (also known as vitamin B8 or vitamin H), a water-soluble vitamin that functions as a prosthetic group of many carboxylases, such as acetyl-CoA carboxylase and pyruvate carboxylase . Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON) (By similarity). Catalytic Activity: 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Sequence Mass (Da): 45580 Sequence Length: 412 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.3.1.47
A7HMM1
MFNYKILEDEMENLKNEGLYINIRTLESPQGAWIVVNGKRVLNLCSNNYLGFASDERLKQAAKKAIDEWGVGPGAVRTIAGTMKIHEELEKALAEFKGADATIFLQSGFIANQAAIPTVFGDENDAIISDELNHASIIDGVRLSKAKRYVYKHNDMNELEARLKEARDVQKARRILIITDGVFSMDGDIAPLPEIVELAEKYEAAVMVDDAHGEGVLGRGGRGIVDHFGLHGRVDMEIGTLSKAFGVLGGYIAGKETLIRYLKQKARPFLFSTGLTPADVAACLEAVKILQESDERVKRLWDNANYFKSEMKKLGFDLGVSQTPITPVMLYDAKVASQFSRELFEEGIFAQSIGYPTVPKGKARIRVMISAVHTKEDLDFALDKFEKVGKKFAII
Function: Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. Catalytic Activity: 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Sequence Mass (Da): 43765 Sequence Length: 395 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.3.1.47
B9M8U3
MQTFGEELESLRAAGLFRSMRLVEGEQSSRIILDGREVLLLCSNNYLGLADHPLLKEAAIRAVERFGVGSGAARLVSGNMELHFRLEERIAAFKGTEAALVFNSGYAANTGIISAIAGRGDLIFSDRLNHASIVDGALLSRAKVIRYSHNDMVALRRLLEENRSTSGRRIIVTDGVFSMDGDLAELAELAALKEEFGALLMVDDAHGTGVLGEHGRGSAELCGVMDRVDIHMGTLGKALGSFGAYAAASKEIIDYLVNRARSFIFSTSLPPAVLAASIAAFDLVDSQAGADLRKGLAANSTRFKDGLENAGFNTMGSETQIVPAFVGGAAETMKFSRKLLDQGIFVQGIRPPTVPVGSCRLRCTLMATHSQADVDRAVSAIAHVGRKLGVTGC
Function: Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. Catalytic Activity: 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Sequence Mass (Da): 41786 Sequence Length: 393 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.3.1.47
Q5KY23
MKTELTVKLHEWEQKAQKRQLRRAEASGATVILNGKPMLNLASNNYLGLADDRRLIEAGCEAMRAYGAGAGASRLVVGNHPLYERAEAALKQWKKAEAALIFNSGYTANIGVLTALIGRDDLVFSDKLNHASLIDGIRLSKAACFRYRHHDIDQLESLLKQSPPAKRKWIVTDAVFSMDGDMAPLEELVELKRRYRAVLLVDEAHSGGVFGPNGEGLLHHFGLEKEEDVIAIGTFSKALGSFGAYVTGEPWLVDYLINSARSLIFTTALPPSVLAANEAAIHIVQAEPKRRERLHALSERFRTKLKRLGFDTGGSETPIVPVIVGPNDRAVAMSEQLQEAGIAAVAIRPPTVPEGTARIRFSITAAMTEEDIDMAVDCIALAGKRIGLIS
Function: Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. Catalytic Activity: 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Sequence Mass (Da): 42524 Sequence Length: 390 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.3.1.47
Q749W3
MTRSIAGELQQLREQGLYRSLRTVAGSQGSRVVAEGREVVLLCSNNYLGLADHPSLKRAAVEAVERYGTGSGASRLVSGTMELHAALEERLARFKGTEAALVFNSGYAANSGIIPALVGRGDVVFSDRLNHASIVDGCLLSRARFVRYPHNDMNALERLLAEHRGAGRMLIVTDGVFSMDGDLAPLPALVALKRQYGALLMVDDAHGTGVLGESGRGSAEQFEVAADIDLQMGTLGKALGGFGAYVAASAEVVELLINRARSFIFSTSLPPAVLAAARAALDLVDSPEGKALRRRLARSAALFRDALQEAGFDTMGSETQIVPALVGEAEPAMTFTRRLLEEGFYVQGIRPPTVPAGTCRLRCTLMATHDESDLERAVAAMARIGKELGIV
Function: Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. Catalytic Activity: 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Sequence Mass (Da): 41593 Sequence Length: 391 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.3.1.47
A5G6I9
MQTFAEELAALRMEGLFRSMRLVEGNQSKRAVLDGREVLLLCSNNYLGLADHPLLKEAAIRAVERYGVGSGASRLVSGTMELHEALEARIAAFKGTNSALVFNSGYAANTGIISAIAGRGDVIFSDRLNHASIVDGALLSRARFVRYPHNNISVLRRLLEDTEVASGRRLIVTDGVFSMDGDLAKLSELVALKKEFDALLMVDDAHGTGVLGDGGRGSAEQCGVMAEVDIHMGTLGKALGSFGAYAAASREIIDYLVNRARSFIFSTSLPPAVLAASQAAFELVDSPSGAALRLALAANTIRFKAGLQAVGFDTMGSETQIVPVYVGGAQQTMEFSRLLLEEGVFVQGIRPPTVPAGSCRLRCTLMATHSENDLDQAITAITAIGEKLGVI
Function: Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. Catalytic Activity: 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Sequence Mass (Da): 41490 Sequence Length: 391 Pathway: Cofactor biosynthesis; biotin biosynthesis. EC: 2.3.1.47
Q5NZF6
MNRPDLVLLHGWGLGPQVWSALTPYLPAGLRVRTPALPGHGGTPARGPTLEAWSDALLPELPDDAVVCGWSLGGLVALDLARRHPHKVARLVLIGTSPCFVTRPENAAAPWPYGLAASTVTGFIDDFAHDPAATLRRFVALQALGDARRRTVSNALNAALANLEQCRPAALGAGLELLADTDWRAALDDVRQPVQLIHGAGDALMPLAAAEWLATRLPDARLARFDDCGHAPFLSHPEDCAVLIEDVVRG
Function: The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters. Catalytic Activity: 6-carboxyhexanoyl-[ACP] methyl ester + H2O = 6-carboxyhexanoyl-[ACP] + H(+) + methanol Sequence Mass (Da): 26598 Sequence Length: 250 Pathway: Cofactor biosynthesis; biotin biosynthesis. Subcellular Location: Cytoplasm EC: 3.1.1.85
Q89A54
MNKKLHWKSLGTGTTNLILIHGWGVNSKIWSILVQSQLYQHFKLHFVDLPGFGHSNQLLPMTLNDTAELLSVYIPKNSILLGWSMGGLIASKIALNYPQKIKGIISVCSSPCFIVRPNWPGIPKKIFLKFYNKLNINFDRTISEFITLQSHNTNYLEIKNLKQQILSQPYPTIYTLKKNLETIFKTDLRTKIKKLKIPMLRIYGSLDTFVPKKIREILDILWPKTKSITIAHASHIPFVSHQKEFYESIINFKNYLNTLKITCQK
Function: The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters. Catalytic Activity: 6-carboxyhexanoyl-[ACP] methyl ester + H2O = 6-carboxyhexanoyl-[ACP] + H(+) + methanol Sequence Mass (Da): 30655 Sequence Length: 265 Pathway: Cofactor biosynthesis; biotin biosynthesis. Subcellular Location: Cytoplasm EC: 3.1.1.85
Q7NPW5
MNLFVETLGQGPDVVMLHGWGLHGGVFARVAEQLATRFCVHLVDLPGHGASPALPRFDADAVADLLAAHFPLPAQVVGWSLGGLIAQHWAARHPDKVKSLALVATSPRFVRDETWPHAQARASIEAVAQSLDGAFEQTLERFLALQMMGAPSARDTLKALRGELFSHGRPQGLLPALGLLLEADARALAGRIQCPAALFYGARDAITPIGAGRWLAESLPDAVLYEFPQASHAPFLSHEQDFVRALAEHLETQA
Function: The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters. Catalytic Activity: 6-carboxyhexanoyl-[ACP] methyl ester + H2O = 6-carboxyhexanoyl-[ACP] + H(+) + methanol Sequence Mass (Da): 27301 Sequence Length: 254 Pathway: Cofactor biosynthesis; biotin biosynthesis. Subcellular Location: Cytoplasm EC: 3.1.1.85
O07631
MKLRNDLRNIAIIAHVDHGKTTLVDQLLHQAGTFRANEQVAERAMDSNDLERERGITILAKNTAINYKDTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGCMPQTRFVLKKALEQNLNPVVVVNKIDRDFARPEEVIDEVLDLFIELDANEEQLEFPVVYASAINGTASLDPKQQDENMEALYETIIKHVPAPVDNAEEPLQFQVALLDYNDYVGRIGIGRVFRGTMKVGQQVSLMKLDGTAKSFRVTKIFGFQGLKRVEIEEAKAGDLVAVSGMEDINVGETVCPVDHQDPLPVLRIDEPTLQMTFVVNNSPFAGREGKYVTARKIEERLQSQLQTDVSLRVEPTASPDAWVVSGRGELHLSILIENMRREGYELQVSKPEVIIKEIDGVRCEPVERVQIDVPEEHTGSVMESMGARKGEMVDMINNGNGQVRLIFTVPSRGLIGYSTEFLSLTRGFGILNHTFDSYQPMQAGQVGGRRQGVLVSMENGKATSYGIQGIEDRGVIFVEPGTEVYEGMIVGEHNRDNDLVVNVSKMKQQTNVRSATKDQTTTIKKARIMSLEESLEYLNEDEYCEVTPESIRLRKKILNKNEREKAAKKKKTAGLS
Function: A 50S ribosomal subunit assembly protein with GTPase activity, required for 50S subunit assembly at low temperatures, may also play a role in translation. Binds GTP and analogs. Binds the 70S ribosome between the 30S and 50S subunits, in a similar position as ribosome-bound EF-G; it contacts a number of ribosomal proteins, both rRNAs and the A-site tRNA. Catalytic Activity: GTP + H2O = GDP + H(+) + phosphate Sequence Mass (Da): 68389 Sequence Length: 612 Subcellular Location: Cytoplasm EC: 3.6.5.-
O25225
MKNIRNIAVIAHVDHGKTTLVDGLLSQSGTFSEREKVDERVMDSNDLERERGITILSKNTAIYYKDTKINIIDTPGHADFGGEVERVLKMVDGVLLLVDAQEGVMPQTKFVVKKALSFGICPIVVVNKIDKPAAEPDRVVDEVFDLFVAMGASDKQLDFPVVYAAARDGYAMKSLDDEKKNLEPLFETILEHVPSPSGSVDEPLQMQIFTLDYDNYVGKIGIARVFNGSVKKNESVLLMKSDGSKENGRITKLIGFLGLARTEIENAYAGDIVAIAGFNAMDVGDSVVDPANPMPLDPMHLEEPTMSVYFAVNDSPLAGLEGKHVTANKLKDRLLKEMQTNIAMKCEEMGEGKFKVSGRGELQITILAENLRREGFEFSISRPEVIIKEENGVKCEPFEHLVIDTPQDFSGAIIERLGKRKAEMKAMNPMSDGYTRLEFEIPARGLIGYRSEFLTDTKGEGVMNHSFLEFRPFSGSVESRKNGALISMENGEATAFSLFNIQERGTLFINPQTKVYVGMVIGEHSRDNDLDVNPIKSKHLTNMRASGSDDAIKLTPPRTMVLERALEWIEEDEILEVTPLNLRIRKKILDPNMRKRAKK
Function: A 50S ribosomal subunit assembly protein with GTPase activity, required for 50S subunit assembly at low temperatures, may also play a role in translation. Binds GTP and analogs. Binds the 70S ribosome between the 30S and 50S subunits, in a similar position as ribosome-bound EF-G; it contacts a number of ribosomal proteins, both rRNAs and the A-site tRNA. Catalytic Activity: GTP + H2O = GDP + H(+) + phosphate Sequence Mass (Da): 66676 Sequence Length: 599 Subcellular Location: Cytoplasm EC: 3.6.5.-
H9L427
MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFDARAETQERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPIIYASALNGIAGLDHEDMAEDMTPLYQAIVDHVPAPDVDLDGPLQMQISQLDYNNYVGVIGIGRIKRGKVKPNQQVTIIDSEGKTRNAKVGKVLTHLGLERIDSNIAEAGDIIAITGLGELNISDTICDPQNVEALPALSVDEPTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDIRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEAVILVPPIKMSLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRGQKEE
Function: A 50S ribosomal subunit assembly protein with GTPase activity, required for 50S subunit assembly at low temperatures, may also play a role in translation. Binds GTP and analogs. Binds the 70S ribosome between the 30S and 50S subunits, in a similar position as ribosome-bound EF-G; it contacts a number of ribosomal proteins, both rRNAs and the A-site tRNA (By similarity). A ribosome-stimulated GTPase, GTPase activity increases 4 fold in the presence of 70S ribosomes. Binds 70S ribosomes in the presence of GTP or its non-hydrolyzable analog GMPPNP; in the presence of ppGpp or under stress conditions it binds to 30S ribosomal subunits . Catalytic Activity: GTP + H2O = GDP + H(+) + phosphate Sequence Mass (Da): 67377 Sequence Length: 607 Domain: Has 5 domains; domain I (residues 1-202, also called the G domain), II (203-305, also called the beta barrel domain), III (306-386) V (387-479) and the C-terminal domain (CTD 480-607) which is BipA-specific. Domains I-V are homologous to domains in EF-G and LepA; although the domains are similar, their relative arrangement among these proteins is different. Domains I and II are not required for ribosome binding, although in their absence no 30S binding under stress is seen, whereas domains III, V and the CTD are required to bind both 70S and 30S ribosomes. The data suggests interdomain communication modulates GTPase and ribosome binding. Subcellular Location: Cytoplasm EC: 3.6.5.-
Q44056
MYVLSVEKPTLRNKFAAGIGVVLVCVVASFIPTPVFALDTTKLIQAVQSEESALHARVGMTVFDSNTGTTWNYRGDERFPLNSTHKTFSCAALLAKVDGKSLSLGQSVSISKEMLVTYSPITEKSLSPETVTFGKICQAAVSYSDNTAANVVFDAIGGATGFNAYMRSIGDEETQLDRKEPELNEGTPGDVRDTTTPNAMVNSLRKILLGDALSASSRSQLTQWMLDDQVAGALLRASLPSDWKIADKTGAGGYGSRSIVAVIWPPSKQPLVVGIYITQTKASMQASNQAIARIGVVLKDTVAP
Function: Hydrolyzes carbenicillin. Methicillin and oxacillin are weakly hydrolyzed. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 32428 Sequence Length: 304 EC: 3.5.2.6
P10424
MKNKKMLKIGMCVGILGLSITSLVTFTGGALQVEAKEKTGQVKHKNQATHKEFSQLEKKFDARLGVYAIDTGTNQTIAYRPNERFAFASTYKALAAGVLLQQNSTKKLDEVITYTKEDLVDYSPVTEKHVDTGMTLGEIAEAAVRYSDNTAGNILFHKIGGPKGYEKALRKMGDRVTMSDRFETELNEAIPGDIRDTSTAKAIARNLKDFTVGNALPHQKRNILTEWMKGNATGDKLIRAGVPTDWVDADKSGAGSYGTRNDIAIVWPPNRSPIIIAILSSKDEKEATYDNQLIKEAAEVVIDAIK
Function: Acts preferentially on penicillins. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 33596 Sequence Length: 306 Subcellular Location: Secreted EC: 3.5.2.6
Q59514
MQRRHFLQKTLLALPIIFSGNLLTGCKTNLSDDYLPDDKITNNPNLLQNKLKEILPIWENKFNAKIGMTIIADNGELSSHRGNEYFPVNSTIKAFIASHILLLVDKEKLDLNEKIIIKESDLIEYSPVCKKYFDENKPISISELCEATITLSDNGSANILLDKIGGLTAFNQFLKEIGADMVLANNEPLLNRSHYGETSDTAKPIPYTKSLKALIVGNILSNQSKEQLITWLINDKVADNLLRKYLPKNWRIGDKTGTGSESKNIIAVIWNENNKPYFISLFITQPHDGKSLDFKNQKDEIMAQIGKEIYPFL
Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Location Topology: Lipid-anchor Sequence Mass (Da): 35383 Sequence Length: 313 Subcellular Location: Cell membrane EC: 3.5.2.6
P52700
MRSTLLAFALAVALPAAHTSAAEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR
Cofactor: Binds 2 Zn(2+) ions per subunit. Function: Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 30801 Sequence Length: 290 Subcellular Location: Periplasm EC: 3.5.2.6
Q9S169
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARGTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Function: Hydrolyzes ampicillin. Can also hydrolyze cephaloridine, aztreonam and ceftazidime with a low catalytic rate. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 31166 Sequence Length: 286 EC: 3.5.2.6
P04190
MKKNTLLKVGLCVGLLGTIQFVSTISSVQASQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK
Cofactor: Binds 2 Zn(2+) ions per subunit. The enzyme can also function with only 1 Zn(2+) ion . Function: Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Active on cephalosporin and penicillin. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 28092 Sequence Length: 257 Subcellular Location: Periplasm EC: 3.5.2.6
O07293
MQRSLSMSGKRHFIFAVSFVISTVCLTFSPANAAQKLSCTLVIDEASGDLLHREGSCDKAFAPMSTFKLPLAIMGYDADILLDATTPRWDYKPEFNGYKSQQKPTDPTIWLKDSIVWYSQELTRRLGESRFSDYVQRFDYGNKDVSGDPGKHNGLTHAWLASSLKISPEEQVRFLRRFLRGELPVSEDALEMTKAVVPHFEAGDWDVQGKTGTGSLSDAKGGKAPIGWFIGWATRDDRRVVFARLTVGARKGEQPAGPAARDEFLNTLPALSENF
Function: Has a broad substrate profile, hydrolyzes amoxicillin, ticarcillin, cephalothin, ceftazidime, cefotaxime, and aztreonam, but not imipenem or cephamycins. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 30602 Sequence Length: 275 EC: 3.5.2.6
P13661
MKNTIHINFAIFLIIANIIYSSASASTDISTVASPLFEGTEGCFLLYDASTNAEIAQFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKTPKGMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLDNSTKLYGKTGAGFTANRTLQNGWFEGFIISKSGHKYVFVSALTGNLGSNLTSSIKAKKNAITILNTLNL
Function: This is an oxacillin-hydrolyzing beta-lactamase. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 30880 Sequence Length: 276 EC: 3.5.2.6
O84955
MIIRFLALLFSAVVLVSLGHAQEKTHESSNWGKYFSDFNAKGTIVVVDERTNGNSTSVYNESRAQQRYSPASTFKIPHTLFALDAGAVRDEFHVFRWDGAKRSFAGHNQDQNLRSAMRNSTVWVYQLFAKEIGENKARSYLEKLNYGNADPSTKSGDYWIDGNLAISANEQISILKKLYRNELPFRVEHQRLVKDLMIVEAKRDWILRAKTGWDGQMGWWVGWVEWPTGPVFFALNIDTPNRMEDLHKREAIARAILQSVNALPPN
Function: This is an oxacillin-hydrolyzing beta-lactamase. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 30449 Sequence Length: 266 EC: 3.5.2.6
Q00982
MKTIAAYLVLVFYASTALSESISENLAWNKEFSSESVHGVFVLCKSSSNSCTTNNAARASTAYIPASTFKIPNALIGLETGAIKDERQVFKWDGKPRAMKQWEKDLKLRGAIQVSAVPVFQQIAREVGEIRMQKYLNLFSYGNANIGGGIDKFWLEGQLRISAFNQVKFLESLYLNNLPASKANQLIVKEAIVTEATPEYIVHSKTGYSGVGTESSPGVAWWVGWVEKGTEVYFFAFNMDIDNESKLPSRKSISTKIMASEGIIIGG
Function: Hydrolyzes both oxacillin and methicillin. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 29432 Sequence Length: 267 EC: 3.5.2.6
P0A3M4
MKKILLLHMLVFVSATLPISSVASDEVETLKCTIIADAITGNTLYETGECARRVSPCSSFKLPLAIMGFDSGILQSPKSPTWELKPEYNPSPRDRTYKQVYPALWQSDSVVWFSQQLTSRLGVDRFTEYVKKFEYGNQDVSGDSGKHNGLTQSWLMSSLTISPKEQIQFLLRFVAHKLPVSEAAYDMAYATIPQYQAAEGWAVHGKSGSGWLRDNNGKINESRPQGWFVGWAEKNGRQVVFARLEIGKEKSDIPGGSKAREDILVELPVLMGNK
Function: Oxacillin-hydrolyzing beta-lactamase. Confers resistance to beta-lactam antibiotics but at a significantly lower level than the TEM bla gene product. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 30568 Sequence Length: 274 EC: 3.5.2.6
A1KXI1
MKVLVLFCLVSLAAAGPLKDALNKAQVDAFYAEGYIVDGSNAADGDAPYQVSLQRTSHFCGGSIIADNYILTAAHCIQGLSASSLTIRYNTLRHNSGGLTVKASRIIGHEKYDSNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPKASSEVLITGWGTLSSGASSLPTKLQKVTVPIVDRKTCNANYGAVGADITDNMFCAGILNVGGKDACQGDSGGPVAANGVLVGAVSWGYGCAQAKYPGVYTRVGNYISWIKGKGVPV
Catalytic Activity: Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa. Sequence Mass (Da): 27555 Sequence Length: 266 Subcellular Location: Secreted EC: 3.4.21.4
Q03170
MKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMAERNDAIVKIGHSIFDVYTSQSR
Function: Hydrolyzes penicillin, ampicillin and carbenicillin but not other antibiotics including oxacillin, methicillin and cloxacillin. Catalytic Activity: a beta-lactam + H2O = a substituted beta-amino acid Sequence Mass (Da): 31348 Sequence Length: 288 EC: 3.5.2.6
A0A3B7TNM4
MHCTVFFLLIACAKSSYGQTRSVSTAKSESKSDEYSYNSDAIDQSRLLRGAVNPVSENMALRKFIFDMPEMLRPEHFEPIFINPAAVKEVIKDYLAYGEALCGSGYDPRLLALFGVRPTVLKQELMKAKGVTLSVMPSSRKRPRALDEVESEVENFRNVLKDFFIPPTTTNPSKLIPDDIETLVPEHVSAHFNSLVYLMYFAVLHFDSQELATMSSSVLLKYALQKNLLLREKIESGTLGEWERDFRLMRVLNVYKSEQT
Function: Secreted effector that triggers a robust hypersensitive response (HR) in Lactuca serriola LS102. The response to BLN06 was visible as strong necrosis . Although effector recognition is frequently associated with single dominant R gene loci, the recognition of BLR38 requires 2 unlinked loci that display incomplete dominance . Sequence Mass (Da): 29562 Sequence Length: 260 Domain: Has the canonical translocation motif RxLR, but lacks the canonical EER motif, which characterizes most oomycete effectors identified so far. Subcellular Location: Secreted
P25916
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG
Function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A. In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2 (By similarity). PTM: May be polyubiquitinated; which does not lead to proteasomal degradation (By similarity). Monoubiquitinated. Sequence Mass (Da): 36708 Sequence Length: 324 Subcellular Location: Nucleus
Q53HL2
MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
Function: Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment. PTM: Phosphorylated by TTK, essentially at Thr-88, Thr94, Thr-169 and Thr-230. Phosphorylation (probably by CDK1) promotes targeting of the CPC to centromeric DNA. Sequence Mass (Da): 31323 Sequence Length: 280 Domain: The C-terminal region (aa 207-280) represents the dimerization motif. Subcellular Location: Nucleus
Q8BHX3
MAPKKRSSRGTRTNTLRSRKLASFLKDFDREVQVRTKQIESDRQTLLKEVENLYNIEILRLPKALQGMKWLDYFALGGNKQALEEAAKADRDITEINNLTAEAIQTPLKSVKKRKVIEVEESIKEEEEEEEEGGGGGGRTKKSHKNLRSAKVKRCLPSKKRTQSIQGRGRSKRLSHDFVTPAMSRLEPSLVKPTPGMTPRFDSRVFKTPGLRTPAAKEQVYNISINGSPLADSKEISLSVPIGGGASLRLLASDLQRIDIAQLNPEALGNIRKLSSRLAQICSSIRTGR
Function: Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment (By similarity). PTM: Phosphorylated by TTK, essentially at Thr-94. Phosphorylation (probably by CDK1) promotes targeting of the CPC to centromeric DNA. Sequence Mass (Da): 32214 Sequence Length: 289 Domain: The C-terminal region (aa 216-289) represents the dimerization motif. Subcellular Location: Nucleus
O14613
MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
Function: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner. Location Topology: Peripheral membrane protein Sequence Mass (Da): 22484 Sequence Length: 210 Domain: The CRIB domain mediates interaction with CDC42. Subcellular Location: Endomembrane system
Q8JZX9
MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGDDMFGDISFLQGKFHLLPGTAVEEAEEDGSFDLPFQFTRTTTVCGRELPDGLSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLESPQPSPQPSPQGAGNVDVWRIPEAGSPHNGMSPEPEAEEPFLSHASSLLSLHVDLGPSILDDVLQIMDHDLGRVQIPT
Function: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 22997 Sequence Length: 214 Domain: The CRIB domain mediates interaction with CDC42. Subcellular Location: Endomembrane system
B1VN94
MILVTGATGAVGREVAGRLADAGPVRILARRPERLTVRGTGVEVVQGAYGDRAALDRALRGVDAVFLVTNDPTEPDDERVAAAAAAAGVRHLVKLSMMAVEEPDAEDFITRRQRENEQAVRDSGVPWTFVRPRTFMSNTLSWAPGIRSAGVVRALYGDAPVACVDPRDVAAVAVAALTGTGHEGRAYAVSGPEAITAREQTAQLSRVLGRPLRFEELGVDAARTALMAKYPPPVAEAFLQSAERQRTGAKASVVPTVQELTGRPARPFRDWSAEHAEAFAPE
Function: Involved in the biosynthesis of A factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone), a gamma-butyrolactone autoregulator that triggers secondary metabolism and morphogenesis in Streptomyces . Catalyzes the reduction of the butenolide phosphate produced by nonenzymatic intramolecular condensation of the 8-methyl-3-oxononanoyl-DHAP ester . Catalytic Activity: a [(3S,4R)-4-alkanoyl-5-oxooxolan-3-yl]methyl phosphate + NADP(+) = a (4-alkanoyl-5-oxo-2,5-dihydrofuran-3-yl)methyl phosphate + H(+) + NADPH Sequence Mass (Da): 30055 Sequence Length: 282 EC: 1.3.1.113
Q5JIZ3
MREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELVEKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGDDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMFRIQTLEGSKGFEDEITVGQELYDDEESSTT
Function: Involved in the biosynthesis of branched-chain polyamines, which support the growth of thermophiles under high-temperature conditions. Catalyzes the sequential condensation of spermidine with the aminopropyl groups of decarboxylated S-adenosylmethionines to produce N(4)-bis(aminopropyl)spermidine via N(4)-aminopropylspermidine. Can also use spermine to produce N(4)-aminopropylspermine. Catalytic Activity: 2 S-adenosyl 3-(methylsulfanyl)propylamine + spermidine = 2 H(+) + N(4)-bis(aminopropyl)spermidine + 2 S-methyl-5'-thioadenosine Sequence Mass (Da): 40229 Sequence Length: 351 Pathway: Amine and polyamine biosynthesis. Subcellular Location: Cytoplasm EC: 2.5.1.128
P25125
MNKEALVQVAEEVRRATGLPVGWRDVERTLGALRATRDLWEAVRLSRVPLRFLVPIWEGLARRGLLRVEEGLDLLAEVPAPRPGEAACPACEGRGLVGERLPGRAAERFLAWAKERPEAIQDFDQGYVTPESTLARVALAWNWGDLEGKEVLVLGDDDLTGLAAALTGLPKRVVVLDADPRIVRFLERAAKAEGLPLEAHVHDLREPLPEAWVHAFHTFFTDPVEGPLGLQAFVGRGLLALEGEGCAGYVGLTHVEASLAKWADFQRFLLENGAVITELRDGFHVYENWGYIEQMRAWPWLPVKRRPEKPWYTSALIRLELLRRADLENARVEGDLQDEEATY
Function: Involved in the biosynthesis of branched-chain polyamines, which support the growth of thermophiles under high-temperature conditions. Catalyzes the sequential condensation of spermidine with the aminopropyl groups of decarboxylated S-adenosylmethionines to produce N(4)-bis(aminopropyl)spermidine via N(4)-aminopropylspermidine. Catalytic Activity: 2 S-adenosyl 3-(methylsulfanyl)propylamine + spermidine = 2 H(+) + N(4)-bis(aminopropyl)spermidine + 2 S-methyl-5'-thioadenosine Sequence Mass (Da): 38395 Sequence Length: 343 Pathway: Amine and polyamine biosynthesis. Subcellular Location: Cytoplasm EC: 2.5.1.128
Q8DAR7
MSSDIHQIKIGLTDNHPCSYLPERKERVAVALEADMHTADNYEVLLANGFRRSGNTIYKPHCDSCHSCQPIRISVPDIELSRSQKRLLAKARSLSWSMKRNMDENWFDLYSRYIVARHRNGTMYPPKKDDFAHFSRNQWLTTQFLHIYEGQRLIAVAVTDIMDHCASAFYTFFEPEHELSLGTLAVLFQLEFCQEEKKQWLYLGYQIDECPAMNYKVRFHRHQKLVNQRWQG
Function: Functions in the N-end rule pathway of protein degradation where it conjugates Leu from its aminoacyl-tRNA to the N-termini of proteins containing an N-terminal aspartate or glutamate. Catalytic Activity: L-leucyl-tRNA(Leu) + N-terminal L-glutamyl-[protein] = H(+) + N-terminal L-leucyl-L-glutamyl-[protein] + tRNA(Leu) Sequence Mass (Da): 27378 Sequence Length: 232 Subcellular Location: Cytoplasm EC: 2.3.2.29
Q3BW59
MAIHADTHDDLRLFQTGEHACGYWSDRQARDLVLDPHDPRLGAIYPQALAWGFRRSGDLVYRPHCERCRACVPVRIAVAAFHPDRSQRRCLARNQDLVVRVVAAERTDEQLALYRHYLKHRHPGGGMDEHGATEFDQFLIGGWSHGRFLEIREPAIAHLPGRLLAVAVTDVTGHALSAVYTFYTPEAAARSLGTFAILQQIQWAQRERRAHLYLGYWIDGHAKMNYKRRFSALEAYDGRHWRGLPAHASVD
Function: Functions in the N-end rule pathway of protein degradation where it conjugates Leu from its aminoacyl-tRNA to the N-termini of proteins containing an N-terminal aspartate or glutamate. Catalytic Activity: L-leucyl-tRNA(Leu) + N-terminal L-glutamyl-[protein] = H(+) + N-terminal L-leucyl-L-glutamyl-[protein] + tRNA(Leu) Sequence Mass (Da): 28650 Sequence Length: 251 Subcellular Location: Cytoplasm EC: 2.3.2.29
A7INB9
MSEHPRDTPQFYLTAPSPCPYLPGREERKVFTHLVGDKAASLNDVLTQGGFRRSQSIAYRPACEGCKACVSVRICVDDFTPGRSFRRVQADNSDLIGQIKPATPTSEQYALFRSYVTGRHGTGGMADMSVLDYAMMVEDTHVHTRLVEYRKRGPDSRIIPRGTGDLMAVALTDVLTDGLSMVYSFYNPQVHDRSLGTFLILDHITRARQMGLPYVYLGYWVQGSRKMDYKRRYLPQERLTPHGWERVEK
Function: Functions in the N-end rule pathway of protein degradation where it conjugates Leu from its aminoacyl-tRNA to the N-termini of proteins containing an N-terminal aspartate or glutamate. Catalytic Activity: L-leucyl-tRNA(Leu) + N-terminal L-glutamyl-[protein] = H(+) + N-terminal L-leucyl-L-glutamyl-[protein] + tRNA(Leu) Sequence Mass (Da): 28301 Sequence Length: 249 Subcellular Location: Cytoplasm EC: 2.3.2.29
Q6ZLD3
MKEMVSSSTFRAPGGLGFLGPSKIGLIPLRNRSGVRSRVKYIAPKCAVSSARPASQPRFIQHKKEAFWFYRFLSIVYDHVINPGHWTEDMRDDALEPAELYHHGLKVVDVGGGTGFTTLGIVKHVDNENVTLLDQSPHQLEKARQKVALNGVNIIEGDAEDLPYPTDTFDRYVSAGSIEYWPDPQRGIREAYRVLKLGGVACLIGPVHPTFWLSRFFADMWMLFPKEEEYIEWFQKAGFQDVKIKRIGPKWYRGVRRHGLIMGCSVTGVKRSSGDSPLQLGPKAEDVEKPVNPFTFIFRFVMGTICASYYVLVPIYMWMKDQIVPKDQPI
Function: Involved in a key methylation step in both tocopherols (vitamin E) and plastoquinone synthesis. Catalyzes the conversion of 2-methyl-6-phytyl-1,4-hydroquinone (MPBQ) to 2,3-dimethyl-6-phytyl-1,4-hydroquinone (DMPQ, a substrate for tocopherol cyclase), and 2-methyl-6-solanyl-1,4-benzoquinone (MSBQ) to plastoquinone (By similarity). Catalytic Activity: 2-methyl-6-phytyl-1,4-benzene-1,4-diol + S-adenosyl-L-methionine = 2,3-dimethyl-6-phytylbenzene-1,4-diol + H(+) + S-adenosyl-L-homocysteine Location Topology: Single-pass membrane protein Sequence Mass (Da): 37439 Sequence Length: 330 Pathway: Cofactor biosynthesis; tocopherol biosynthesis. Subcellular Location: Plastid EC: 2.1.1.295
Q07457
MTAEPATKKIKLELSDPSEPLTQSDVIAFQKEALFRCINRRRVDFEALRKQYELSRRECIDVSRKLANIMALIVTLARFIETFCTDANEKQLCREIAQGDETLIVQRSDSFMKLLTKYGKPNTTDSNTNSNASDHIQELTTELKNLRKSKEELFYENSQLTEEISALKEYYTNIIRKYDRDESFTIKRVFKEDKTDAVKELREDEKESNENNIKSGNKDSSAINGDNTSKKSEKGDELVQAEDERKEDAENEKLELDLKFSDLRAEINSLSSTIKDLENIRRENEEELIKTRSEVSNLKKQQIAAADQDPDFKSYDHESLLAKIQHLTEQNAELSEINSSFLSKFQVLAKEKEIYTKKVREEFQKSLDSLVEMNSSLEKDVVRIRTARDDLLSKIAILEAEKSKTEVLSDLQHAIDILKEQWTKIDQRSNDTKSSSTQDALIKEIQDLEKGFRELSDLTHKKYSEIINHESVISKLTVEKTKADQKYFAAMRSKDSILIEIKTLSKSLSKSNELILQLKDSDRLLQQKIGNLHKQLDLSQNNERRLIDSSKTETLKIIDLNNTSTKLKRSLEKLQEESNKSIADMTHLETKLNDTEIELKHFKQKASHLESKCEKLHDTLFRGNNKNKGSSDEALVEELANFRTLVYCSLCSKNWKNMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFSSNDLLTVHL
Function: E3 ubiquitin-protein ligase that mediates monoubiquitination of histone H2B to form H2BK123ub1 in association with the E2 enzyme RAD6/UBC2. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. It thereby plays a central role in histone code and gene regulation. Also modulates the formation of double-strand breaks during meiosis. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 80692 Sequence Length: 700 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Nucleus EC: 2.3.2.27
A8Y3H3
MRQNRRASMIVNRILITLIVLVSLSFLFLRAGPKFSEADRACIQDEWQENKSLNVSSEINNETYQIVFADVQKEFKWIFLPKEISGNPDILMIVSSNRDNFARRNVIRKSWMNSDKNKIVAEKRMKILFLVGVNSENEKENTVVLKEAEVFGDIIVVDLEDNYQNLPYKSLTILLYGQSKTAESVKLIGKIDEDVIFYPDQLTPLINDGTINMSISAIYGEKWNAGVEVSNKDETNKWFIPKYSFKCQLLPSYLSGPFYLTTRKAAERILKSTKHRKFISVEDVFITGLLAGDVGVEKKQLPSMYMYDETTTDTAKAEILAWHNFKNNAEFLESWENLRLSRCKACRKSRNFRGSRSQLDEERNQ
Function: Transfers N-acetylgalactosamine onto carbohydrate substrates. Involved in susceptibility to pore-forming crystal toxins in conjunction with bre-1, bre-3, bre-4, and bre-5. Involved in resistance to the nematotoxic C.cinerea galectin Cgl2. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 42164 Sequence Length: 365 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.1.-
Q6QMT2
MRQSRRASSRVNRLVVIFIIVASGFLLLYKNTQQFTQIDRECIQDEWQENNNLGNTIDDGSNFRIAFTDIQQNYTWLHLPNFLENSEILMIVSSNCDNFARRNILRKTWMNPENSQIIGDGRMKALFLVGINGADEKLNAVVLEEAKVFGDMIVIDLEDNYLNLSYKTISLLLYSISKTKSPNLIGKIDEDVLFYPDQLTPLINDKTINTSTFSIYGEKYEAGVAVNHGEDNAKWQISKNSFKCSVYPSYLSGPTYFLTRKAAKRIVEATKHRKFISVDVEDVFITGLLAGDVGIKKNQLPFMYMIEEATNDRESYEILAWHTKKRDQQYIEAFESLKLNRCKSCRKSKNPDLEELKEK
Function: Transfers N-acetylgalactosamine onto carbohydrate substrates (By similarity). Involved in susceptibility to pore-forming crystal toxins in conjunction with bre-1, bre-3, bre-4, and bre-5 . Involved in resistance to the nematotoxic C.cinerea galectin Cgl2 . Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 41370 Sequence Length: 359 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.1.-
Q9GUM2
MAFRHLAVARLKSLLVLCAVLLLVHAMIYKIPSLYENLTIGSSTLIADVDAMEAVLGNTASTSDDLLDTWNSTFSPISEVNQTSFMEDIRPILFPDNQTLQFCNQTPPHLVGPIRVFLDEPDFKTLEKIYPDTHAGGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKRRWTRDGLSNLKYKLVNLELKPLYTRAVVDLLEKDCRRELRRDFPTCF
Function: Catalyzes the transfer of galactose onto proteins or lipids. Required for susceptibility to pore-forming crystal toxins in conjunction with bre-1, bre-2, bre-3 and bre-5. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 43914 Sequence Length: 383 Pathway: Protein modification; protein glycosylation. Subcellular Location: Membrane EC: 2.4.1.-
Q95US5
MFLCVRILKRKYHELSSFQKLLIFTITIFLLWVLGVVDKFRETSFGDFSWPLETRNLQLRSKFTKYPQCKFSGNGQKIIIIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHNENFIFWCRRVSQKEWDDGVIAVHGYARKDLEYEYSQLNGFE
Function: Transfers N-acetylgalactosamine onto mannose groups of carbohydrate substrates. Required for susceptibility to pore-forming crystal toxins in conjunction with bre-1, bre-2, bre-3, and bre-4. Involved in resistance to the nematotoxic C.cinerea galectin Cgl2 . Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 37587 Sequence Length: 322 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.1.-
A0A068ACU9
MPGRELAPRQNVEFQTLDGLTLRGWLFPAQSRGPAVIITPGFNCVKEMFVSEVAESFQHSDVTALVYDPRTLGDSGGLPRNNIDPLAQVSDYSDALTFLKTLPIVDQTNISFWGMSFSALVALNAAALDKRARCCIAVCPLTGMQPEPDMLPKVLARCMQDRESQVVGNPPVTISVLTEQGRNPAGMGIGADKMEYDYMVNAKFRGAPNYENRTTLQSYYKMMAWQPFEIMKYLSKTRVLMIIPENDTISPADKQQVLFDGLPEPKTAHIAKGKGHLDVLSGADYEILAEMQAYFIKGPRGKGNAPSA
Function: Thiohydrolase; part of the gene cluster that mediates the biosynthesis of brefeldin A (BFA), a protein transport inhibitor that shows antiviral, antifungal, and antitumor properties . The proposed biosynthesis of BFA involves formation of an acyclic polyketide chain that is differentially tailored throughout the backbone . The highly reducing polyketide synthase Bref-PKS is proposed to synthesize the precisely reduced octaketide precursor, which could then be directly offloaded by the thiohydrolase enzyme Bref-TH followed by a cytochrome P450 monooxygenase-mediated formation of the cyclopentane ring and macrocyclization to afford 7-deoxy BFA. Alternatively, the first ring annulation can also occur on the ACP-tethered intermediate before the thiohydrolase release and lactonization . The C7-hydroxylation by another cytochrome P450 monooxygenase is believed to be the final step in the process to obtain the final structure of BFA . In addition to the HRPKS Bref-PKS and the thiohydrolase Bref-TH, the brefeldin A biosynthesis cluster contains 4 cytochrome p450 monooxygenases (called orf3 to orf6), as well a the probable cluster-specific transcription regulator orf8 . Sequence Mass (Da): 33884 Sequence Length: 308 Pathway: Mycotoxin biosynthesis. EC: 3.1.-.-
A0A068A9T2
MFDIYDYSPRLVALGLIAATIIIYSFTLTVYRLFFHPLARIPGPKLCAITGWYEIFWDVLVGGQFTFKIEEWHKTYGPVMRIGPNEVHFNDPDFYNELYPTIGATYEKPAQWRWRFGCGTAIFDTIGHEHHAQRKAPVAAFFSRQKILQFSGFIQDQTDILVKRIRDDHRGQVICANEAFDALTMDIIGYYAFGLSYNSLQYPGFKAPYRNVTADIARMVHVGAHFPWVFTILNALPEKYITRLLPPMSKIFMFRKEISSQIRRIKDNKEYLDKNVNEHRTVFHEILNSNQPACELNEGRIYHEALSLVGAALETSKRTTALAVYYILATPGVEDNLRAELTAAMPDKTKNLSVPELEALPYLNAVIKEALRLAIGVSQRMRRYSPTETITYKDYTIPPNTVFGMCHWEQLRDARIWDRPTEFLPERWLAEQPLALNGQPLNKYFVPFHRGPRMCLGKEFGMAQLNIGLATLFRQDDIKLELYETDRKDVDVVADFFVPLTVKESQGVRVLVK
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of brefeldin A (BFA), a protein transport inhibitor that shows antiviral, antifungal, and antitumor properties . The proposed biosynthesis of BFA involves formation of an acyclic polyketide chain that is differentially tailored throughout the backbone . The highly reducing polyketide synthase Bref-PKS is proposed to synthesize the precisely reduced octaketide precursor, which could then be directly offloaded by the thiohydrolase enzyme Bref-TH followed by a cytochrome P450 monooxygenase-mediated formation of the cyclopentane ring and macrocyclization to afford 7-deoxy BFA. Alternatively, the first ring annulation can also occur on the ACP-tethered intermediate before the thiohydrolase release and lactonization . The C7-hydroxylation by another cytochrome P450 monooxygenase is believed to be the final step in the process to obtain the final structure of BFA . In addition to the HRPKS Bref-PKS and the thiohydrolase Bref-TH, the brefeldin A biosynthesis cluster contains 4 cytochrome p450 monooxygenases (called orf3 to orf6), as well a the probable cluster-specific transcription regulator orf8 . Location Topology: Single-pass membrane protein Sequence Mass (Da): 59157 Sequence Length: 513 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
A0A068AA98
MYHLIPFAAILGMTYALSLAIYRLFLSPLAKFPGPKLAAVTGWVETYYQLFYGEGGQFIFLYKEWHQKYGPIIRINPWEVHISDSCFFEILYSTNRPLKKLPHLAKVFDNELSGFSTVSPELHRIRRKAVSHLFSKGEVLKRGAQIQSAMDRLSERLKLDFLGHGNRVICMNDMWSVYTADLIAEYAFGRHYGFIDQPNFEADFTKALVHLLEPTHLAQQFPWLTDILKALPTSVLEFLHPHMAAFNKFKAANQVRIAKANFAKDLSKGGTMFSAIFNSDLPDEEKSIERAHQEALAFAAAGAETVAATLSVASFHLLHDPKIRRRLDEELATVVPDSRSSDASMPSLEILWQLPYLTGIINEALRLSYGSYARIPRTSDTPIQYDEWTIPPGVVFSMDIAPAHHDERIFPDSYSFKPERWLDNPQAFDGKPLTRYLFSFSRGTRSCLGMQLALAEMYIGIVSFFSRFDAHLFETDLTDITFVRDRFAPRPRIGSRGVRVNRLTTRKF
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of brefeldin A (BFA), a protein transport inhibitor that shows antiviral, antifungal, and antitumor properties . The proposed biosynthesis of BFA involves formation of an acyclic polyketide chain that is differentially tailored throughout the backbone . The highly reducing polyketide synthase Bref-PKS is proposed to synthesize the precisely reduced octaketide precursor, which could then be directly offloaded by the thiohydrolase enzyme Bref-TH followed by a cytochrome P450 monooxygenase-mediated formation of the cyclopentane ring and macrocyclization to afford 7-deoxy BFA. Alternatively, the first ring annulation can also occur on the ACP-tethered intermediate before the thiohydrolase release and lactonization . The C7-hydroxylation by another cytochrome P450 monooxygenase is believed to be the final step in the process to obtain the final structure of BFA . In addition to the HRPKS Bref-PKS and the thiohydrolase Bref-TH, the brefeldin A biosynthesis cluster contains 4 cytochrome p450 monooxygenases (called orf3 to orf6), as well a the probable cluster-specific transcription regulator orf8 . Sequence Mass (Da): 57951 Sequence Length: 508 Pathway: Mycotoxin biosynthesis. EC: 1.-.-.-
A0A068AA78
MANDVSGLGPTAFVRLLAFHLIGLFVSITVYRLFFHNLSGFRGPFIARLSSFYLAWLSAKRLHLHDEIDDLHSLYGDYVRTGPRELSIIDPQCVQVIYGSQTKCIKGPIYTLLDPRTNLSSTRDKTEHAKRRRAWDRGFSTTALHTYEPMVQELTEELMTIIDELSENPINITEWVDKYAFEVMGQLTFGKPFNMLKERKEAYFLELIRQDMNAIGYLLNLPWLSYLFLRTPGLNQNHLNFWRWIENEFAQRIARGQRRPDVFNWLHQAYLQGPQTKSDTLKLHGDGYLVIVAGSDTTASTITHLLFYLACNKALTQKLQAQLDALEGLTDESLRDVELLDACINETLRLRPAVPAGVQRETPKEGIYIGNRYIPGDTIVKVPMYTLFRDPRSFEQPNEFIPERFTTRPELVKDKSVFIPFLTGSYACVGRRLALMEVRRAVAAILCRYDIALAPGQNEEGFLDGKIDAFTLVAAPLSLKFTRRHQQKQ
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of brefeldin A (BFA), a protein transport inhibitor that shows antiviral, antifungal, and antitumor properties . The proposed biosynthesis of BFA involves formation of an acyclic polyketide chain that is differentially tailored throughout the backbone . The highly reducing polyketide synthase Bref-PKS is proposed to synthesize the precisely reduced octaketide precursor, which could then be directly offloaded by the thiohydrolase enzyme Bref-TH followed by a cytochrome P450 monooxygenase-mediated formation of the cyclopentane ring and macrocyclization to afford 7-deoxy BFA. Alternatively, the first ring annulation can also occur on the ACP-tethered intermediate before the thiohydrolase release and lactonization . The C7-hydroxylation by another cytochrome P450 monooxygenase is believed to be the final step in the process to obtain the final structure of BFA . In addition to the HRPKS Bref-PKS and the thiohydrolase Bref-TH, the brefeldin A biosynthesis cluster contains 4 cytochrome p450 monooxygenases (called orf3 to orf6), as well a the probable cluster-specific transcription regulator orf8 . Location Topology: Single-pass membrane protein Sequence Mass (Da): 56075 Sequence Length: 489 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
Q45340
MYLDRFRQCPSSLQIPRSAWRLHALAAALALAGMARLAPAAAQAPQPPVAGAPHAQDAGQEGEFDHRDNTLIAVFDDGVGINLDDDPDELGETAPPTLKDIHISVEHKNPMSKPAIGVRVSGAGRALTLAGSTIDATEGGIPAVVRRGGTLELDGVTVAGGEGMEPMTVSDAGSRLSVRGGVLGGEAPGVGLVRAAQGGQASIIDATLQSILGPALIADGGSISVAGGSIDMDMGPGFPPPPPPLPGAPLAAHPPLDRVAAVHAGQDGKVTLREVALRAHGPQATGVYAYMPGSEITLQGGTVSVQGDDGAGVVAGAGLLDALPPGGTVRLDGTTVSTDGANTDAVLVRGDAARAEVVNTVLRTAKSLAAGVSAQHGGRVTLRQTRIETAGAGAEGISVLGFEPQSGSGPASVDMQGGSITTTGNRAAGIALTHGSARLEGVAVRAEGSGSSAAQLANGTLVVSAGSLASAQSGAISVTDTPLKLMPGALASSTVSVRLTDGATAQGGNGVFLQQHSTIPVAVALESGALARGDIVADGNKPLDAGISLSVASGAAWHGATQVLQSATLGKGGTWVVNADSRVQDMSMRGGRVEFQAPAPEASYKTLTLQTLDGNGVFVLNTNVAAGQNDQLRVTGRADGQHRVLVRNAGGEADSRGARLGLVHTQGQGNATFRLANVGKAVDLGTWRYSLAEDPKTHVWSLQRAGQALSGAANAAVNAADLSSIALAESNALDKRLGELRLRADAGGPWARTFSERQQISNRHARAYDQTVSGLEIGLDRGWSASGGRWYAGGLLGYTYADRTYPGDGGGKVKGLHVGGYAAYVGDGGYYLDTVLRLGRYDQQYNIAGTDGGRVTADYRTSGAAWSLEGGRRFELPNDWFAEPQAEVMLWRTSGKRYRASNGLRVKVDANTATLGRLGLRFGRRIALAGGNIVQPYARLGWTQEFKSTGDVRTNGIGHAGAGRHGRVELGAGVDAALGKGHNLYASYEYAAGDRINIPWSFHAGYRYSF
Function: Inhibits the classical pathway of complement activation and prevents accumulation of deposited C4. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 103377 Sequence Length: 1010 Domain: The signal peptide, cleaved at the inner membrane, guides the autotransporter protein to the periplasmic space. Then, insertion of the C-terminal translocator domain in the outer membrane forms a hydrophilic pore for the translocation of the passenger domain to the bacterial cell surface, with subsequent cleavage. Finally, the mature protein remains tightly associated with the bacterium. Subcellular Location: Periplasm
P71345
MFSRKDIIVLGMMIFALFLGAGNIIFPPMEGFSSGQHWTSASLGFVLTGVLMPFITLVVVAILGRGEELTKDLPKWAGTGFLVILYLTIGSTFAMPRITNVAYEMAWLPLGLTENNANVRFVFSLIFNLIAMGFMISPNTIISSVGKFMTPALLVLLIAVAITVFISPLSEIQAPSNAYENSHSLLIGLTSGYQTMDVLAAIAFGGIVARALSAKNVTKTKDIVKYTISAGFVSVILLAGLYFSLFYLGATSAAVAEGATNGGQIFSRYVNVLFGSAGTWIMAGIIVLASLTTLVGVTSASADYFSKFSVRFSYPFWAALFTAMTITVSQYGLTDLLRITIPALLLIYPVAIVLVLLQFLRKKLPSIKFTYNSTLLVTVCFSLCDSLNNVKMLPESINSLLKHFPLSSEGMAWLVPTLVMLVASIFIGKALHKTHS
Function: Branched chain amino acid transport system, which transports leucine, valine and isoleucine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 47039 Sequence Length: 436 Subcellular Location: Cell inner membrane
P54104
MKEKLTHAESLTISSMLFGLFFGAGNLIFPAYLGEASGANLWISLLGFLITGVGLPLLAIASLGMTRSEGLLDLSGRVSHKYSYFFTCLLYLTIGPFFAIPRSFTVPFETGISALLPSGMAKSTGLFIFSLIFFAIMLFFSLRPGQIMDWIGKFLTPAFLLFFFFIMIMALLHPLGNYHAVKPVGEYASAPLISGVLAGYNTMDALAGLAFGIIVISSIRTFGVTKPEKVASATLKTGVLTCLLMAVIYAITALVGAQSRTALGLAANGGEALSQIARHYFPGLGAVIFALMIFVACLKTAIGLITACSETFAEMFPKTLSYNMWAIIFSLLAFGIANVGLTTIISFSLPVLMLLYPLAISLILLALTSKLFDFKQVDYQIMTAVTFLCALGDFFKALPAGMQVKAVTGLYGHVLPLYQDGLGWLVPVTVIFAILAIKGVISKKRA
Function: Branched chain amino acid transport system which is involved in the uptake of leucine, valine and isoleucine . The proton motive force is probably the driving force for transport . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 47869 Sequence Length: 446 Subcellular Location: Cell membrane
A2RJ04
MKEKLAGKDYLFIGSMLFGLFFGAGNLIFPIHMGQEAGDAISQANFGFLVTAVGFPFLGIIALGISQSNGVFELATRVNRIYAYIFTILLYLVIGPFFALPRLATTSFEIGISPFLSNKLQTPLLALFSILFFGTAWFLSRKPTKLLDYIGKFLNPLFLVLLGLILIIAFSHPLGSVHQAEVGKLYQSSAFMNGFTQGYNTLDALAALAFGIIIITTIRQRGVKNSKIIAKETIKAGLISVGLMAIIYTCLSYLGAMSVGKFAISENGGIALAQISNYYLGTFGMIILALIVIIACLKTAVGLMSAFSETFVELFPKREYRFYLMIVSILPCIFANIGLTKIIELSVPVLMFLYPLAITLILLALLGPVFQHSKLVYQITTAFTLLAAIADGLNALPNPLKSLKPIAAILNFSKDSLPFFSLGMGWILLAVLGFIIGCLVHFLKRITNK
Function: Branched chain amino acid transport system which is involved in the uptake of leucine, valine and isoleucine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 48900 Sequence Length: 449 Subcellular Location: Cell membrane
P0A1W9
MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAAIGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRTATVSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILSVAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEARLLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSFLLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLSHLIQISIPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAFGDMLPAWSQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH
Function: Liv-II branched chain amino acid transport system, which transports leucine, valine and isoleucine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 46221 Sequence Length: 439 Subcellular Location: Cell inner membrane
Q24157
MQSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVWNECRSANYA
Function: Neurogenic protein essential for the development and maintenance of epithelial structure. Required in the germline for establishing the follicular epithelium and for determining the dorsal-ventral polarity. Collaborates with Notch on the apical surface of follicle cells to mediate germline-follicle cell adhesion. Brn has a role in chorion formation. Catalytic Activity: ganglioside GM2 (d18:1(4E)) + UDP-alpha-D-galactose = ganglioside GM1 (d18:1(4E)) + H(+) + UDP Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 37620 Sequence Length: 325 Subcellular Location: Golgi apparatus membrane EC: 2.4.1.62
Q63K32
MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALVDLTRIAAEFVRIASTGAQPNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTLAVESIRFDLTALDPVKGMKRLFSWRSAKDAVKALLYVGVFALTVRVFADLYHADVFGLFRARPALLGHMWIVLTVRLVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELLSEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPVVRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVEAANRGGPPPETRAPTSAEPQARDGVAPPGDACADNAFPDDAPPGAAAPNAGSPDGPAPDGGAPARTGDQNA
Function: Part of the bsa type III secretion system, is involved in the intracellular replication of invading bacteria inside the host cell. Probably necessary for the lysis of the vacuole membrane and escape into the host cell cytoplasm. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 44458 Sequence Length: 411 Subcellular Location: Cell membrane
D1MX89
MIFLAPFEFLDPLRHALPLTCTGLIIIFAFYLSRHHSPKPAPNIPIHSYDREEYFRRGYELVQEGQKKHPSCFQLRTATGWKILVPIRFVEELRKNPSLSFARGNDKDAFIEYPGFEAMEAACHDDYFMQEVVRVKLTQTLNLLYSSVIDESAVAMSEVLGEDKIWRTLRIKDDINHIVARVTSRVFLGFPLCRNQKWLDIVVNHTKAVFMAQKRMRQTPPALRPLIHYFLPETKLLRQHLHAARTLISPELAKRRAAVEEALRHGKIPKESANAISWMVEVSQAQGRKIDVAVHVVSLSMTAIQTTSEVMTNCILQLCETPSIVDDLRAEIIFLLKEGGWTKYTLYKMRLLDSFIREVMRHHDFLRVTSWRGCTEDVVLSDGTVLPKGSCIYFDDSKVVDPEHYPDPEKFDPMRSFKKREQPGQEDRHQFVSLQTDHMAFGYGIHACPGRFFANMELKVMLCNFLLKYDVRLVPGEKRPVDILFEVQRMVPPDVRVQIKVRDQEPEVDLYSPISST
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Location Topology: Single-pass membrane protein Sequence Mass (Da): 59771 Sequence Length: 517 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
D1MX85
MEMATTFTHDVTTSGKPLLLFLILITLTYSLGIVFYRLFRHPLAKFPGPRIAAATYLYEIAFDYFGNGAYLFEIERMHHKYGPIVRLNPAELSIKDGEFYDKVYVNGNVRRTEALPSFGDGMDFNNSHGMTVDHHQHRQRRKPLEPFFSKAGVARFESNLASVVSTLVDRLRDYEGTGSVLRLDHAFAALAGDIITTMCIDSTSMTFLDDKDFSRGWYELFHTLIISMPVFMNFPWIIRLVRLIPTSILKRVDPRSQMFRDWSDMSVAEIKKSLQRKATGEMLTYQKGIIKAPTLFDHLVNSDLPTSDMSVERLASEAQVLMGAGTVTTAQSMSHLVVNVLLRPDVEKRLREEFAVLMKQLGEASLPKARELEKLPYLQACVKEGLRLSHGLMHRLPRISPDVALEFNGLIIPPGTPVGMSAYFMHMDETVYENPREFIPERWLGDVDPKMDRNYVPFSRGSRRCLAPNLAYTEISMVMAALFSPWSPAIRLQDTNASDVDPVCAFLLPLPRLDSKGVRVIVRKNKE
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Location Topology: Single-pass membrane protein Sequence Mass (Da): 59821 Sequence Length: 527 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
D1MX86
MESAQIHSTRDSLFILWLTTLLVSVLATAAYIKFQSRPRPYSGFPLVTLGGPSETDSSHAANWFRRGRALVNKGLSELSGAFQISNGSGYWIILPSKYMDELRNHPDMSLRDALREENFPNYRGFDGFRQAFKDSTFTQEVIRVKVTQSLGLITANLANECQHALQENLGESREWQQRFIIEDILNIVAQLTSRVFLGERLCRDKEWLQITKEYARNSFMGSEELRQCLPLTRPLMQFFMPACTQLRKFSAAARRLIDPEVQARKRRAEEAIKLGKKPPKVEDTIGWMVEVARGRQVDYVGGQLALSIAAIHSSTDNLSKAVVKLCEMPEIVAPLREEITTVLESTDGWSKPALYRMKLLDSFLKEVQRLAPFTIVGMHRRVMKGYVLSDGTHLPKNSRIMVMNDKLRDSSVYEDPDTFKYDRFARLREQPGQEDQHQLASTSSEFATFGHGEHACPGRFFAANQLKIIMACLLLKYDFCFQPGQAEKARVIPFEMVETIDPTLKIEVRRRSEELDVTKVAKETA
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Location Topology: Single-pass membrane protein Sequence Mass (Da): 59843 Sequence Length: 525 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
E0D7H5
MSQSTLVIIGAGGIGEAIARRVGPGKEVLLGDWSNALLQEATQRMKRDGFRVTSQHVNISSHDSVIQFAEKAQSLGQVMHVVISAGLSPVSSTRETILAVNLAGTGFCIAEFGKLIGHGGTCVVISSLAGYTLAQDVPHGVIQHLARTSPSDVLGLPLLRETVLDQWSAYGVSKRVNYVQVQDASLSWARRGARINSISPGAIQTPMLSLESQASKEEVVHDLAQNVPCKRVGDSGEVAHVAAFLLGSESSFVTGTDILVDGGALAYLSRDTSS
Function: Short-chain dehydrogenase/reductase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Sequence Mass (Da): 28830 Sequence Length: 274 Pathway: Mycotoxin biosynthesis. EC: 1.-.-.-
D1MX87
MLEGTLQDCWTSISKMQLHWTVLGLLPVLFIAILGPRVRQIWVNYVHLTKIPSPHKKDYFCFVTETTRAEFLNECARLLRKGFASGDVIRLHASWDHIVVLSPSYAECLRADEKFSPDTFSDKEMFGAVPGFEPYRFLCTHRDLVRNVISMRLNRCFVPATRYLSEAIDDALRKQMGNDSEWREVPLGNAVLKILTQSSFRALQGPELCYDDEWLDIATQYIVTSVTGVTALRKLPKFLVPLIHWFHPDAIKSRRLLSRARAKLIPFYEKRKKELYQARRNGTYRPEDADAFGWYEELADGRDYDPVVAQLTVAVAATHSTTDFMCQFLSDMVRYPEYIQPLRDELILALKEKGWKASTILQLPLLDSVMKESQRLKPVAMGFMRSIAQHDVYLQDAVKIPKNASVIVSAHSMRDATVYENPDSFDGYRFINPTKHPESRHFTSVSVNHMGFGFGKHACPGRFFVNLETKILIAHLLLKYDWKFANDGCPAIRTSGFDQVVDPSAKMLVRRRKEEIRIEALYE
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Location Topology: Single-pass membrane protein Sequence Mass (Da): 60169 Sequence Length: 523 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
C9K2Q2
MAVQETDLDKQLLQLSIQVADLAARTDSRGSQKIQDFLIKTQQSLESPWETLMRYYDLDFQHVAIRIGCDMQVFTTLTTADKPMKLQDIANVNGASERLLGRVLRYLASINTIEEVGKDTFEANHITRTLSKPGIEGGIRLSSACQRPTNSALPDLLVERGFQDITSATETAFNKAWASREPFFTWVRSQPKIFEYLRLALDVQFREDWLNAFPLESHLGDFASRADPEKVLFVDVGGNLGIQCRGLKAKFPHLSGRIILEDLQETIDVALALEGVETLAQDYLTEQKVKGAKFYYYRNIFHDNPDDRCRLILDALKPAMEESSLLLIDDKVLLNQGSHRHVTMLDLAMMAQVASHERTRAQWQALLEGAGWKIEDIFQYSHEYDSIIVVKPAAQNA
Function: 16-O-methyltransferase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Sequence Mass (Da): 44950 Sequence Length: 397 Pathway: Mycotoxin biosynthesis. EC: 2.1.1.-
Q08280
MDASSVPPKVDDYGMYTTEISHHNPIELKNLLSSSDSRRNSQDEDSLPNNTNLIKEIDWQGEKVKTYPLNYQTVPLVKLQVIACLIMFVVFGMNDQTVGALLPTLIEYYHISRVDVSNVFIVQLCGYVMASLSKERLNKHFGMRGGMLLAAGLCIVFLIILATAPSSFYVCMFCGLPLGLGIGILDSTGNVLMGSLLVHKNELMGIMHGLYGAAAMVTPPLVSYFVEWGHWSLFFLIPLFFSIIGMIVIFPAFKFETASKYDYLCSVENKESNNDVEEAGDNSLMESTKASPGFFELLRNPAIFLYSLYLFLYLGAEITTGSWFFSYLLETKSSNKVAMSYIAASFWTGLTVGRLCLGFVTERFFENEYKASKAYAFLTLSSYTLFVLVGLINSSSVFYFVVLFFVVFCCGTFIGPLFPNASIVALQVLPKRLHVSGVGVAVAVGGCGGAAIPYLAGVIAHTVGIQYIPLLCWIMVALFTLEWTLYPKFIKGHEEYF
Function: Probable transporter. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 55084 Sequence Length: 497 Subcellular Location: Golgi apparatus
D1MX88
MASILWTTSLKVLLALIVWIGTTIIYNIYFHPLHSFPGPVLARATRLYSAYIRAVGLSERKSLQWHNQYGGIVRIAPDELSFNTGSAWNDIYGTKSRKSQRLQKDPHFYMGATAPNGEKNMGAVGDEDHSRIRSVLAHAFTDTALHAQESLIRAHVDRLVQRLQDLHGKPTDIVRWMHHHSYDVIAHLCFGQDLDALGSKDWFPPARVVFEGIREGVTLIEVLRFVPFKATVLDILVQAFGKARRENFNASVARAMLRLRLAETTSIDFISYILRVKESAKELTRSELTANVALLIDAGSETTATMLSGCLFYLSLNRTTLEELTHKLREDFRTHDQLSLQNLAKMKLLTYVIQESLRIYPPLPATLPRLTPATGAMINGVLIPPKTRVGMNAFAAYHSTQNFADADMFIPQRWDNTNDRFARDQRHVHRPFSLGSRGCLGKNLAWAEIRLTLACLLWNFDVILEPGQEEWHGKQLTWFIWNKDPLYMRFAPRTK
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Location Topology: Single-pass membrane protein Sequence Mass (Da): 56346 Sequence Length: 495 Pathway: Mycotoxin biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
C9K2Q3
MKYQFSIIVDPATYDNEGLSNGIDLRKNNFTHLEDRGAIRAQQDWATHIAPIKQFKGTLGHDYSFMTVCVPECIPIRLEIISYANEFAFMYDDDTELDTENNTSAENDKLMGTFLAGTQGWSPPQDQSSSGKTRILKQLFSEMMEIDKECAIATMKAWAEFLRVGSSRQHGTVFTRLKDYLPYRIKDVGEMFWFGVVTFGMALHIPDHEMDACHKLMEPAWIAVGLANDVFSWPKERDASQRLGRTHVVNAVWVVMQEHGFSQEQARQYCRELAAQFVAQYLDNIRNIKNEESISPDLRTYVEAMQYSISGNVIWSKFCPRYNPEKRFNQTQLDWMQNGLPSTVELDGASNTSSSFLSTSTHGSPASGSQTTIESKDGWTADSSGIVSLLLNCSLPPLSHKVISAPLTYVDSLPSKGTRDMFLDALNHWLHVDEQRASQVKMAIRMLHNASLMLDDVQDGSRLRRSKPSAHRVFGVAQTTNSAAFLVNESIKLIRELAGDQGVAAVLEKLTSLFVGQAQDLHSSRNLSPPSLTEYIQTIDQKTSALFELASRLMCLCSTATVVPNSSLSRFCILLGRFFQIRDDYQNLTSPEYTKQKGFCDDLDSGTYTLPLVYAISQQSENFLLQNLLSTRLAEGTLDDDQKRLALDQMQLVKTNEFLRKILDSLYDELRAELQCISSSFASENPQMELMLMMLKL
Function: Multifunctional diterpene synthase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Catalytic Activity: geranylgeranyl diphosphate = diphosphate + fusicocca-2,10(14)-diene Sequence Mass (Da): 78573 Sequence Length: 697 Pathway: Mycotoxin biosynthesis.
D7UTD1
MASTSSTSTDGHLNIRPMVHGSDKKLNFGAYITGLDLNNASDAEVDQLREAILRHKIVVIKGQQAEKPDKNWEMIKKLDPMHHMITQEEFGQLFHPTGEGLIAMLKLATVPTTEHGHIHLMGKGYQGDDHYGLKKLNLGEAFAGNYYSKPLAEEDFRAGVTRFQSWHMDGPLYKVHPPYISSLRFIQLPDGEQTVEWADGSGLSLKTKPGRTAFFSTSQLYDMLTDEERAMVDNSAVEYMYYPYEWIRGCRGNPNGLNVADEGREKPLDAMEEIARDERWTKTYPMVWFNELTKEKSLQVQPNCVRRLLIRRSADQKEPEIIEGPERVREFMNKLQQRIVRPEYVYVGPEEEGDHVFWYNWGMMHSKIDYPIAYGPRIVHQGWIPSHRVPRGPTAVAH
Cofactor: Binds 1 Fe(2+) ion per subunit. Function: Alpha-ketoglutarate dependent dioxygenase; part of the gene cluster that mediates the biosynthesis of the diterpene glucoside brassicicene C . In the first step of the brassicicene C biosynthesis, the bifunctionnal diterpene synthase bsc8 that possesses both prenyl transferase and terpene cyclase activity, converts isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) that is further converted into fusicocca-2,10(14)-diene, the first precursor for brassicicene C . Fusicocca-2,10(14)-diene is then substrate of cytochrome P450 monooxygenase bsc1 for hydroxylation at the C-8 position . Oxidation at C-16 position to aldehyde is then catalyzed by the cytochrome P450 monooyxygenase bsc7, yielding fusicocca-2,10(14)-diene-8-beta,16-diol . Follows the isomerization of the double bond and reduction of aldehyde to alcohol catalyzed by the short-chain dehydrogenase/reductase bsc3 to yield the diol compound fusicocca-1,10(14)-diene-8 beta,16-diol (Probable). The next step is the oxidation at the C-3 position of fusicocca-2,10(14)-diene-8-beta,16-diol catalyzed by the alpha-ketoglutarate dependent dioxygenase bsc9, to produce a triol compound . Methylation of the hydroxy group at position 16 is performed by the methyltransferase bsc6 . 16-O-methylation is followed by oxidation at the C-13 position to ketone and an alkyl shift of the methyl group leads to brassicicene C (Probable). Although the probable acetyltransferase bsc4 is included in the gene cluster, no acetylation reactions are necessary for brassicicene C biosynthesis. However, the fact that brassicicene E, which is a structurally related compound having an acetoxy group at position 12, was previously isolated from another strain of A.brassicicola suggests that the ATCC 96836 strain might also produce a small amount of brassicicene E (Probable). Sequence Mass (Da): 45701 Sequence Length: 398 Pathway: Mycotoxin biosynthesis. EC: 1.14.11.-
Q6WRU0
MAPTFYHYHPLPMDQKEPGCGIRWRCLAAASVLILVALVIPLIIFAVKANSEACRDGLRAQEECSNTTRLLQRQLTRSQDNLAQAEAQASTCNRTVVTLQDSLEKKVSQIQEKQALIQEQEAQIKEQEAQIKEQEAQIKEQKAHIQEQQVRIQKLEGEVEEFEQKLKKLRTAEEASITSKQNSAGSMAVSSLLVLAVPLFLLF
Function: IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted. Its target viruses belong to diverse families, including retroviridae: human immunodeficiency virus type 1 (HIV-1), mouse mammary tumor virus (MMTV) and murine leukemia virus (MLV), filoviridae: ebola virus (EBOV), arenaviridae: lassa virus (LASV), and rhabdoviridae: vesicular stomatitis virus (VSV). Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration. Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection. Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells (By similarity). PTM: The GPI anchor is essential for its antiviral activity. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 22826 Sequence Length: 203 Domain: The extracellular coiled coil domain forms an extended 170 A long semi-flexible rod-like structure important for virion retention at the cell surface and prevention of virus spreading. Subcellular Location: Golgi apparatus
Q10589
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
Function: IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted . Its target viruses belong to diverse families, including retroviridae: human immunodeficiency virus type 1 (HIV-1), human immunodeficiency virus type 2 (HIV-2), simian immunodeficiency viruses (SIVs), equine infectious anemia virus (EIAV), feline immunodeficiency virus (FIV), prototype foamy virus (PFV), Mason-Pfizer monkey virus (MPMV), human T-cell leukemia virus type 1 (HTLV-1), Rous sarcoma virus (RSV) and murine leukemia virus (MLV), flavivirideae: hepatitis C virus (HCV), filoviridae: ebola virus (EBOV) and marburg virus (MARV), arenaviridae: lassa virus (LASV) and machupo virus (MACV), herpesviridae: kaposis sarcoma-associated herpesvirus (KSHV), rhabdoviridae: vesicular stomatitis virus (VSV), orthomyxoviridae: influenza A virus, paramyxoviridae: nipah virus, and coronaviridae: SARS-CoV . Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration . Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection . Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells. Isoform 1 and isoform 2 are both effective viral restriction factors but have differing antiviral and signaling activities . Isoform 2 is resistant to HIV-1 Vpu-mediated degradation and restricts HIV-1 viral budding in the presence of Vpu . Isoform 1 acts as an activator of NF-kappa-B and this activity is inhibited by isoform 2 . PTM: Monoubiquitinated by KSHV E3 ubiquitin-protein ligase K5, leading to its targeting to late endosomes and degradation. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 19769 Sequence Length: 180 Domain: The extracellular coiled coil domain forms an extended 170 A long semi-flexible rod-like structure important for virion retention at the cell surface and prevention of virus spreading. Subcellular Location: Golgi apparatus
Q8R2Q8
MAPSFYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTLVILTIYFAVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVVTLQESLEKKVSQALEQQARIKELENEVTKLNQELENLRIQKETSSTVQVNSGSSMVVSSLLVLKVSLFLLF
Function: IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted. Its target viruses belong to diverse families, including retroviridae: human immunodeficiency virus type 1 (HIV-1), mouse mammary tumor virus (MMTV) and murine leukemia virus (MLV), filoviridae: ebola virus (EBOV), arenaviridae: lassa virus (LASV), and rhabdoviridae: vesicular stomatitis virus (VSV). Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration. Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection. Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 19152 Sequence Length: 172 Domain: The extracellular coiled coil domain forms an extended 170 A long semi-flexible rod-like structure important for virion retention at the cell surface and prevention of virus spreading. Subcellular Location: Golgi apparatus
Q811A2
MAPSFYHYLPVAMDERWEPKGWSIRRWWLVAAILVVLIGVVLVCLIVYFANAAHSEACKNGLRLQDECRNTTHLLKHQLTRAQDSLLQTEMQANSCNQTVMDLRDSLKKKVSQTQEQQARIKELENKIERLNQELENLRTQKEISTTVQVNSGGSVVVSSLLVLVAVLFLHF
Function: IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted. Its target viruses belong to diverse families, including retroviridae: human immunodeficiency virus type 1 (HIV-1), mouse mammary tumor virus (MMTV) and murine leukemia virus (MLV), filoviridae: ebola virus (EBOV), arenaviridae: lassa virus (LASV), and rhabdoviridae: vesicular stomatitis virus (VSV). Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration. Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection (By similarity). Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells. PTM: N-glycosylated. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 19674 Sequence Length: 172 Domain: The extracellular coiled coil domain forms an extended 170 A long semi-flexible rod-like structure important for virion retention at the cell surface and prevention of virus spreading. Subcellular Location: Golgi apparatus
K4JY29
MGPAVVFDCMTADFLNDDPNNAELSSLEMEELESWGAWSDDTDQSV
Function: Bottromycin D is a ribosomally synthesized and post-translationally modified peptide (RiPP) that displays antibiotic activity against methicillin-resistant S.aureus (MRSA). PTM: The precursor peptide is first ribosomally synthesized and then highly tailored by specific enzymes to yield the final natural product. These modifications include several methylations, cyclization and the formation of t-Leu and Thia-beta-Ala residues. Sequence Mass (Da): 5083 Sequence Length: 46 Subcellular Location: Secreted
Q9LR78
MAPDQSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSHQLILFGGSTTAVANHNSSLPEISLDGVTNSVHSFDVLTRKWTRLNPIGDVPSPRACHAAALYGTLILIQGGIGPSGPSDGDVYMLDMTNNKWIKFLVGGETPSPRYGHVMDIAAQRWLVIFSGNNGNEILDDTWALDTRGPFSWDRLNPSGNQPSGRMYASGSSREDGIFLLCGGIDHSGVTLGDTYGLKMDSDNVWTPVPAVAPSPRYQHTAVFGGSKLHVIGGILNRARLIDGEAVVAVLDTETGEWVDTNQPETSASGANRQNQYQLMRRCHHAAASFGSHLYVHGGIREDVLLDDLLVAETSQSSSPEPEEDNPDNYMLLDDYLMDEPKPLSSEPEASSFIMRSTSEIAMDRLAEAHNLPTIENAFYDSAIEGYVPLQHGAETVGNRGGLVRTASLDQSTQDLHKKVISTLLRPKTWTPPANRDFFLSYLEVKHLCDEVEKIFMNEPTLLQLKVPIKVFGDIHGQYGDLMRLFHEYGHPSVEGDITHIDYLFLGDYVDRGQHSLEIIMLLFALKIEYPKNIHLIRGNHESLAMNRIYGFLTECEERMGESYGFEAWLKINQVFDYLPLAALLEKKVLCVHGGIGRAVTIEEIENIERPAFPDTGSMVLKDILWSDPTMNDTVLGIVDNARGEGVVSFGPDIVKAFLERNGLEMILRAHECVIDGFERFADGRLITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISSSEEDYTDKAWMQELNIEMPPTPARGESSE
Cofactor: Binds 2 manganese ions per subunit. Function: Phosphatase that acts as a positive regulator of brassinosteroid (BR) signaling . Dephosphorylates BES1, a transcription factor that regulates the expression of BR-response genes, thereby playing an important role in the regulation of response to BRs . Inactivates the negative regulator of BR signaling ASK7/BIN2 by dephosphorylation at 'Tyr-200' . PTM: Phosphorylated at Ser-395 and Ser-444. Phosphorylated at Ser-764 by CDG1 and CDL1. Catalytic Activity: H2O + O-phospho-L-seryl-[protein] = L-seryl-[protein] + phosphate Sequence Mass (Da): 87789 Sequence Length: 793 Subcellular Location: Nucleus EC: 3.1.3.16
P33532
MASKIASLFSPSETASKDQHENVAEDLELGTASSQSDGIHETNSEYDEKKREESPEVIDISNLISSDHPAHPQNWHWAKRWSIVFMFCLMQIYVIWTSNGFGSIEYSVMAQFNVSAQVATLCLSMNILGSGLGPMFLGPLSDIGGRKPVYFCSIFVYTVFNISCALPRNIVQMIISHFIIGVAGSTALTNVAGGIPDLFPEDTAGVPMSLFVWACAGGAIGAPMATGVDINAKYGWRWLYYINIIVGGFFLIVILIIPETLPIKVITRYENAKGRIVEGIPKNNLKEVLKKCKFVTTMGFRMMLTEPIILSMGLYNFYAYGISYFFLTAIWPVFYDTYKMSEMGASCTYLSGFVASTLLFLYQPIQDWIFRRDKAKNNGVARPEARFTSALFITLLFPAGMFLFAFTCHPPFPWMSPIVGNSMVTVANGHNWMCILNYLTDSYPLLSGSAVAAFTLPSFIGATVFAHVSQIMFNNMSVKWAVATMAFISISIPFIIYTFYFFGQRIRALSSLTGNKALKYLPLENN
Function: Thiamine-regulated, high affinity import carrier of pyridoxine, pyridoxal and pyridoxamine. Also imports, but does not export, amiloride and so confers sensitivity. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 58484 Sequence Length: 526 Subcellular Location: Membrane
O67791
MENLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFFPDHEVVGEEMGAEGSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSMRRPGAAAVDLCMVAEGIFDGMMEFEMKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYMEVAV
Function: Phosphatase with broad specificity; it can dephosphorylate fructose 1,6-bisphosphate, and both D and L isomers of inositol-1-phosphate (I-1-P). Catalytic Activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate Sequence Mass (Da): 29336 Sequence Length: 264 EC: 3.1.3.11
O30298
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Cofactor: Magnesium. Can also use manganese. Function: Phosphatase with broad specificity; it can dephosphorylate fructose 1,6-bisphosphate, both D and L isomers of inositol-1-phosphate (I-1-P), 2'-AMP, pNPP, inositol-2-phosphate, beta-glycerol phosphate, and alpha-D-glucose-1-phosphate. Cannot hydrolyze glucose-6-phosphate and fructose-6-phosphate. May be involved in the biosynthesis of a unique osmolyte, di-myo-inositol 1,1-phosphate. Catalytic Activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate Sequence Mass (Da): 27967 Sequence Length: 252 EC: 3.1.3.11
Q57573
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Function: Phosphatase with broad specificity; it can dephosphorylate fructose 1,6-bisphosphate, both D and L isomers of inositol-1-phosphate (I-1-P), 2'-AMP, pNPP, beta-glycerol phosphate, and alpha-D-glucose-1-phosphate. Cannot hydrolyze glucose-6-phosphate, fructose-6-phosphate, NAD(+) or 5'-AMP. May be involved in the biosynthesis of a unique osmolyte, di-myo-inositol 1,1-phosphate. Catalytic Activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate Sequence Mass (Da): 28578 Sequence Length: 252 EC: 3.1.3.11
O26957
MEESDIYYWKGVAVRMAEQVERAVSPLVGTEDAGEIIKMGADGTPTKLIDLVAEDEAVGVLESTGRPVTIISEEIGVLHINSEGDEPGIIFVVDPLDGTSNAIRNIPFYGISVAVAERHPDGAAPTLNNVLMGFVKNFATGDLYWAIKGQGAFLNEKAISSSSQSSLDRTSLGAFIYGTRFRRVDSICRVIRRMRILGSVALELAYVASGSYDAFMDLRENLRIVDIAASKLIVEEAGGVVTNERGGEIDGLLNVKARTSLVAAGNLELHEKIMQTLEVI
Function: Phosphatase with broad specificity; it can dephosphorylate fructose 1,6-bisphosphate, and both D and L isomers of inositol-1-phosphate (I-1-P). Catalytic Activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate Sequence Mass (Da): 30173 Sequence Length: 280 EC: 3.1.3.11
Q5JH93
MEFNWSEIALNTAKELEEKIMPLFGTKKAGENVGTNVSGDVTKYVDKVAEDIILKRLVPLGVNVVSEEVGTVDSGSDYTVVVDPLDGSYNFSAGIPIFAFSLGIFKGKKPVYGAIYEFLPENFYEAKPGKGAYLNGERIRVNEPEPGKEALSFYTRGRCLGLVKKVKRVRVLGAIAVELAYVARGSLDGVFDIRNYVRPTDVAAGVLLVREAGGIVTDERGREFEVKLSATEKTNIIAVANERLLNTILEAMKDEP
Function: Phosphatase with broad specificity; it can dephosphorylate fructose 1,6-bisphosphate (FBP) and inositol-1-phosphate (IMP). However, while possessing a high FBPase activity in vitro, does not participate in gluconeogenesis in vivo. Catalytic Activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate Sequence Mass (Da): 27985 Sequence Length: 256 EC: 3.1.3.11
O33832
MDRLDFSIKLLRKVGHLLMIHWGRVDNVEKKTGFKDIVTEIDREAQRMIVDEIRKFFPDENIMAEEGIFEKGDRLWIIDPIDGTINFVHGLPNFSISLAYVENGEVKLGVVHAPALNETLYAEEGSGAFFNGERIRVSENASLEECVGSTGSYVDFTGKFIERMEKRTRRIRILGSAALNAAYVGAGRVDFFVTWRINPWDIAAGLIIVKEAGGMVTDFSGKEANAFSKNFIFSNGLIHDEVVKVVNEVVEEIGGK
Function: Phosphatase with broad specificity; it can dephosphorylate fructose 1,6-bisphosphate, both D and L isomers of inositol-1-phosphate (I-1-P) but displaying a 20-fold higher rate of hydrolysis of D-I-1-P than of the L isomer, 2'-AMP, pNPP, inositol-2-phosphate, beta-glycerol phosphate, and alpha-D-glucose-1-phosphate. Cannot hydrolyze glucose-6-phosphate, fructose-6-phosphate, 5'-AMP and NAD(+). May be involved in the biosynthesis of a unique osmolyte, di-myo-inositol 1,1-phosphate. Catalytic Activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate Sequence Mass (Da): 28647 Sequence Length: 256 EC: 3.1.3.11
P18892
MAVFPNSCLAGCLLIFILLQLPKLDSAPFDVIGPQEPILAVVGEDAELPCRLSPNVSAKGMELRWFREKVSPAVFVSREGQEQEGEEMAEYRGRVSLVEDHIAEGSVAVRIQEVKASDDGEYRCFFRQDENYEEAIVHLKVAALGSDPHISMKVQESGEIQLECTSVGWYPEPQVQWRTHRGEEFPSMSESRNPDEEGLFTVRASVIIRDSSMKNVSCCIRNLLLGQEKEVEVSIPASFFPRLTPWMVAVAVILVVLGLLTIGSIFFTWRLYKERSRQRRNEFSSKEKLLEELKWKRATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKPERFDSWPCVMGREAFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPRRVGVFLDYESGDIFFYNMTDGSHIYTFSKASFSGPLRPFFCLWSCGKKPLTICPVTDGLEGVMVVADAKDISKEIPLSPMGEDSASGDIETLHSKLIPLQPSQGVP
Function: May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion (By similarity). Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 59277 Sequence Length: 526 Subcellular Location: Membrane
Q13410
MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGRETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPRRVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP
Function: May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane (By similarity). Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion (By similarity). PTM: N-glycosylated. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 58960 Sequence Length: 526 Subcellular Location: Membrane
Q9FMK7
MAITATQNDGVSLNANKISYDLVETDVEIITSGRRSIPAHSGILASVSPVLTNIIEKPRKIHGGSSKKVIKILGVPCDAVSVFVRFLYSPSVTENEMEKYGIHLLALSHVYMVTQLKQRCTKGVGERVTAENVVDILQLARLCDAPDLCLKCMRFIHYKFKTVEQTEGWKFLQEHDPFLELDILQFIDDAESRKKRRRRHRREQNLYLQLSEAMECIEHICTEGCTLVGPSSNLDNKSTCQAKPGPCSAFSTCYGLQLLIRHFAVCKKRVDGKGCVRCKRMIQLLRLHSSICDQSESCRVPLCRQYKNRGEKDKKMVEDTKWKVLVRRVASAKAMSSLSQSKKKKSEVLFKEEAEDLIRIRNKLM
Function: May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Also targeted for degradation by the 26S proteasome pathway. May be involved in gametophyte development. Sequence Mass (Da): 41480 Sequence Length: 365 Domain: The BTB/POZ domain mediates the interaction with some component of ubiquitin ligase complexes. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Nucleus
Q9KSL2
MDFHRLLQHKQQRWQRSSYLLIGLFLSVCVLYLLVGELWLSPFSAWSSLEQQLVWELRLPRLLAAAVIGASLAVAGATLQVLLGNVLAEPGVVGVSGGASVAMVILLLFFPSLNSPVAFMAAAVLGALLFTLLLVVMARKLRLTTARLLLVGVALGILSGAVVTWAFYFSDDLGLRQLMYWLMGSVAGVSWYQHLLSLVAVPVVIWLVLQGGVLDKLMLGEGHAKQLGIDIHRVRWRLILAIALLVGASVALGGVIGFVGLVVPHLLRLTLGSENRLLLPLSALCGALLLVSADLIARLALGSGELPLGVVTTTLGAPIFIWMLVRNHDSC
Function: Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Involved in the translocation of the substrate across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 35497 Sequence Length: 331 Subcellular Location: Cell inner membrane
B0R5G4
MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV
Function: Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system (By similarity). Catalytic Activity: an R-cob(III)alamin(out) + ATP + H2O = ADP + an R-cob(III)alamin(in) + H(+) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 40466 Sequence Length: 398 Subcellular Location: Cell membrane EC: 7.6.2.8
Q2HGY8
MAAADDAQFPPPKVLTYPASTPPTLITQGAEGRLYKTTHLTRDRPCALKYRPPKPYRHPVLDARLTKARLSSEAKVLERCWREGVPVPAVYAMDPAAGWMMMEWIEGIPVRVGINEWLGDRPEEGAEIPQVADETPIVDLMKRIGAAIGALHKTGVVHGDLTTSNMMLRPRGFNPVDGAPGDEGKAGSVEGDVVLIDFGLATQSMSDEDRAVDLYVLERAFASTHPRAERLFATLLESYKSTFKKASSVLIKLEDVRMRGRKRSMLG
Function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 29394 Sequence Length: 267 Domain: This protein is considered an atypical serine/threonine kinase, because it lacks the conventional structural elements necessary for the substrate recognition as well as a lysine residue that in all other serine/threonine kinases participates in the catalytic event (By similarity). BUD32 has protein kinase activity in vitro, but in the context of the EKC/KEOPS complex, the catalytic subunit KAE1 switches the activity of BUD32 from kinase into ATPase (By similarity). Subcellular Location: Cytoplasm EC: 3.6.-.-
P0CP73
MAASTPLLSRGTLIKQGAEAKVYALPSLFPEPTTYHPGSSSSFSAASPTPVILKHRFTKTYRHPTLDASLTSQRLTFEARALARAAKAGVTVPKVVWVDEKAGVIGMERIEGWSVREILGGGAEGEVEVIEEQEIEEDVENKAEDSAVREEPEGPESEGLKALKNLGVTQEHLMRSIGAALARLHKTMIIHGDLTTSNMMVRLTPGGSGPYEIVLIDFGLSSQAQFPENYAVDLYVLERAFASTHPRSEKLYAGVLETYAEGLGEKKWKPIQIKLKDVRRRGRKRDMTG
Function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 31670 Sequence Length: 289 Domain: This protein is considered an atypical serine/threonine kinase, because it lacks the conventional structural elements necessary for the substrate recognition as well as a lysine residue that in all other serine/threonine kinases participates in the catalytic event (By similarity). BUD32 has protein kinase activity in vitro, but in the context of the EKC/KEOPS complex, the catalytic subunit KAE1 switches the activity of BUD32 from kinase into ATPase (By similarity). Subcellular Location: Cytoplasm EC: 3.6.-.-
Q6BHA8
MTDHIVKKAQECLPNIPLTVISQGAEALVFYTDVHPYANEPYLQNRGKYVIKYRPSKPYRHPKVDSSITKSRTVGEVKFMYKLNKLNINSPRIISADYNNGIIWMEYIGYSLPNGDVSSFKNWLWYLERNNQDCTSESVEKMCFKVGQLIGKLHLHEMIHGDLTSSNILLNDDEPVLIDFGLSSYSGLAEDRAVDLYVLERAITSTHSVYAKEYNQWLLQGYEDVHKHKEFGKQGQKKLVEVLKKLDDVRLRGRKRSMLG
Function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 29991 Sequence Length: 260 Domain: This protein is considered an atypical serine/threonine kinase, because it lacks the conventional structural elements necessary for the substrate recognition as well as a lysine residue that in all other serine/threonine kinases participates in the catalytic event (By similarity). BUD32 has protein kinase activity in vitro, but in the context of the EKC/KEOPS complex, the catalytic subunit KAE1 switches the activity of BUD32 from kinase into ATPase (By similarity). Subcellular Location: Cytoplasm EC: 3.6.-.-
Q54W07
MDANECSNSENSATTTIPKSASPSTTISTKVVKLDEIGILISQGAEAKTYETDLYGLKCIVKERFSKAYRHPILDQKISSKRILQEVRSLNKCKKKGIQVPSLYLVDIGNNRIYMEFIKGETVKHYLYKNQESTQHQNQIESIMKELGNQIGIIHEMNVIHGDLTTSNMLLRESTNELVFIDFGLSYTSNSVEDKAVDLYVLERAFISTHPNSEQLFQTILSNYELTSSNSKIVIQKLNQVRLRGRKKTCFG
Function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Bud32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit osgep (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 28577 Sequence Length: 252 Subcellular Location: Nucleus EC: 3.6.-.-
Q5BAB7
MPPTNRPPPFSTILSSASLPSYSSTDELTPIYQGAEAHLYKTTFLSPSQPAALKIRPSKPYRHPILDRRLTRARILQEARCLQKLVKEGVSVPALLGVDWEPSAGDGSSWLVMEWIEGEPVRVILEEWEAYLKGIEREKRLGLGEGVQGSEEEKVRGLMRRIGRAVGGLHRAGVIHGDLTTSNLMLRPLGSADTTETIEERDQSPSMAGEVVMIDFGLAMQSSQDEDRAVDLYVLERAFGSSHPRTERFFEEVLVGYRESYKGAVSALKRLEDVRMRGRKRSMIG
Function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 31806 Sequence Length: 285 Domain: This protein is considered an atypical serine/threonine kinase, because it lacks the conventional structural elements necessary for the substrate recognition as well as a lysine residue that in all other serine/threonine kinases participates in the catalytic event (By similarity). BUD32 has protein kinase activity in vitro, but in the context of the EKC/KEOPS complex, the catalytic subunit KAE1 switches the activity of BUD32 from kinase into ATPase (By similarity). Subcellular Location: Cytoplasm EC: 3.6.-.-
Q8SVD9
MGFHFQGAESIISADGETVVKKRARKAYRIEALDLKIINGRTKREAKILRKLEALGIPAPRLISTYGDTIVMEKVEGTVLKEMIDSSDNPGALFRDLGALVSRLHIADIIHGDLTTSNFIHGSKIYAIDFGLSYISRKDEDKAVDLYVFEKAVGCAHDAKFLEDFYCGYMGEGSESVLKKLGTVRLRGRKREAMAFG
Function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 21847 Sequence Length: 197 Domain: This protein is considered an atypical serine/threonine kinase, because it lacks the conventional structural elements necessary for the substrate recognition as well as a lysine residue that in all other serine/threonine kinases participates in the catalytic event (By similarity). BUD32 has protein kinase activity in vitro, but in the context of the EKC/KEOPS complex, the catalytic subunit KAE1 switches the activity of BUD32 from kinase into ATPase (By similarity). Subcellular Location: Cytoplasm EC: 3.6.-.-