ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
P47818
MSIVALKNAVVTLIQKAKGSGGTSELGGSESTPLLRGSNSNSSRHDNLSSSSSDIIYGRNSAQDLENSPMSVGKDNRNGDNGSDNEKANLGFFQSVDPRVISDLIIGLSDGLTVPFALTAGLSSLGDAKLVITGGFAELISGAISMGLGGYLGAKSESDYYHAEVKKEKRKFYDNSNLINREIEDILLEINPNFSDETIVSFIKDLQRTPELMVDFIIRYGRGLDEPAENRELISAVTIGGGYLLGGLVPLVPYFFVSDVGTGLIYSIIVMVVTLFWFGYVKTKLSMGSGSSTSKKVTEGVEMVVVGGVAAGAAWFFVKLLG
Function: Has a role in both calcium and manganese homeostasis. Involved in the transfer of iron and Mn(2+) from the cytosol to the vacuole for storage of these metals. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 34250 Sequence Length: 322 Subcellular Location: Golgi apparatus membrane
D4B5N6
MLGGRHSHWSPQDLEEQAFSPYGTFPPSPTESTETSSSISSTRPRVNPRIVSDAILGLSDGLTVPFALSAGLSALGNSRVVVVGGLAELVAGAISMGLGGYVGSRSEVESYEATVRETKHLVKASPMETMNIIHQVFAPYNLPEEPVARMSHILYNSPEKLLDFLLTFYHKESKPGCHQAWISAITLALGYFIGGFIPLIPYFMVDQVLVALYYSIGIMIFTLLVFGYVKTCVVRGWTGKENIVAGIKGGLQMVVVGGLAAGASIALARAINPTGGALF
Function: Vacuolar iron transporter involved in the transfer of iron from the cytosol to the vacuole for intracellular iron storage . Plays an essential role in iron detoxification during high iron conditions . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 29779 Sequence Length: 279 Subcellular Location: Vacuole membrane
Q3IZ91
MALDVQSDIVAYDAPKKDLYEIGEMPPLGHVPKEMYAWAIRRERHGEPDQAMQIEVVETPSIDSHEVLVLVMAAGVNYNGIWAGLGVPVSPFDGHKQPYHIAGSDASGIVWAVGDKVKRWKVGDEVVIHCNQDDGDDEECNGGDPMFSPTQRIWGYETPDGSFAQFTRVQAQQLMKRPKHLTWEEAACYTLTLATAYRMLFGHKPHDLKPGQNVLVWGASGGLGSYAIQLINTAGANAIGVISEEDKRDFVMGLGAKGVINRKDFKCWGQLPKVNSPEYNEWLKEARKFGKAIWDITGKGINVDMVFEHPGEATFPVSSLVVKKGGMVVICAGTTGFNCTFDVRYMWMHQKRLQGSHFANLKQASAANQLMIERRLDPCMSEVFPWAEIPAAHTKMYRNQHKPGNMAVLVQAPRTGLRTFADVLEAGRKA
Cofactor: Despite some sequence similarity to zinc-containing alcohol dehydrogenases, this enzyme does not bind any metals. Function: Catalyzes the NADPH-dependent reductive carboxylation of crotonyl-CoA ((2E)-butenoyl-CoA) to (2S)-ethylmalonyl-CoA, in the presence of CO2 . This is a key reaction in the ethylmalonyl-CoA pathway for acetyl-CoA assimilation required for R.sphaeroides growth on acetate as sole carbon source . Is also able to accept acryloyl-CoA as an alternative substrate, yielding (2S)-methylmalonyl-CoA . To a lesser extent, when CO2 is absent, the enzyme also catalyzes the reduction of crotonyl-CoA to butanoyl-CoA . Catalytic Activity: (2S)-ethylmalonyl-CoA + NADP(+) = (2E)-butenoyl-CoA + CO2 + NADPH Sequence Mass (Da): 47684 Sequence Length: 430 EC: 1.3.1.85
P30551
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQILLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVMVVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQLSSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEEDGRTIRALLSRYSYSHMSTSAPPP
Function: Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 49657 Sequence Length: 444 Subcellular Location: Cell membrane
P70031
MESLRSLSNISALHELLCRYSNLSGTLTWNLSSTNGTHNLTTANWPPWNLNCTPILDRKKPSPSDLNLWVRIVMYSVIFLLSVFGNTLIIIVLVMNKRLRTITNSFLLSLALSDLMVAVLCMPFTLIPNLMENFIFGEVICRAAAYFMGLSVSVSTFNLVAISIERYSAICNPLKSRVWQTRSHAYRVIAATWVLSSIIMIPYLVYNKTVTFPMKDRRVGHQCRLVWPSKQVQQAWYVLLLTILFFIPGVVMIVAYGLISRELYRGIQFEMDLNKEAKAHKNGVSTPTTIPSGDEGDGCYIQVTKRRNTMEMSTLTPSVCTKMDRARINNSEAKLMAKKRVIRMLIVIVAMFFICWMPIFVANTWKAFDELSAFNTLTGAPISFIHLLSYTSACVNPLIYCFMNKRFRKAFLGTFSSCIKPCRNFRDTDEDIAATGASLSKFSYTTVSSLGPA
Function: Receptor for cholecystokinin. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Has high affinity for CCK-8 and low affinities for gastrin-17-I, CCK-4, and unsulfated CCK-8. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51157 Sequence Length: 453 Subcellular Location: Cell membrane
P0DOA0
MRPKWCKTTVLASFPRGSACTARQLKHSANRIYLDARASVPARRAGILNEDRIELPDDAIGASAERRSTRDLRKPSRAGIQHERAVGLMSRQTDNTYPKPLVMPKRGPSAALRLLIVGILLMGAAFIYFLFRDQLGDGFALVLMGVLSMVGVFYLFGAATGLIQFSQRSDHQDLAHSFMDTQPEGTVISDPRGQIVYANQAYARMTGATDADGIRPLDQVLASEPAASDAIYRLTNAVRDGLSAQEEVRISGGLSRGANGSLAPVWYRIKARALEGGAEFKGPLVAWQVADISEERAEQERFFQELQEAINHLDHAPAGFFSANPAGRIIYLNATLAEWLGVDLTQFTPGSLTLNDIVAGSGMALIKAVKAEPGTSRNTVIDLDLIKRNGQSLAVRFYHRVQTARDGMPGTTRTIVLDRAEGDDSSVAQRSAEVRFTRFFNSAPMAIAAVDAEGHTLRTNARFLDIFSGVVDRDAIDRRVKLENVVHERDRETFNKALAAAFAGQASISPVDTVLPGNEERHIRFYMSPVTDLGGEAAEEAAVISAVETTEQKALENQMAQSQKMQAVGQLAGGIAHDFNNVLTAIIMSSDLLLTNHRASDPSFPDIMNIKQNANRAASLVRQLLAFSRRQTLRPEVLDLTDVLADLRMLLARLVGKDIELKIDHGRDLWPVKADLGQFEQVAVNLAVNARDAMPEGGQITLRTRNIPAADAAKLHYRDLPEADYVVFEVEDTGTGIPADVLEKIFEPFFTTKEVGKGTGLGLSMVYGIIKQTGGFIYCDSEVGKGTTFKIFLPRLIEEKRADDAPVAAKEKKVEKATDLSGSATVLLVEDEDAVRMGGVRALQSRGYTVHEAASGVEALEIMEELGGEVDIVVSDVVMPEMDGPTLLRELRKTHPDIKFIFVSGYAEDAFARNLPADAKFGFLPKPFSLKQLATTVKEMLEKQD
Function: Component of a regulatory phosphorelay system that controls B.abortus cell growth, division, and intracellular survival inside mammalian host cells. This signaling pathway is composed of CckA, ChpT, CtrA and CpdR. CckA autophosphorylates in the presence of ATP on a conserved His residue and transfers a phosphoryl group to a conserved Asp residue on its C-terminal receiver domain. CckA-P transfers phosphoryl groups to the ChpT phosphotransferase. Catalytic Activity: ATP + protein L-histidine = ADP + protein N-phospho-L-histidine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 103190 Sequence Length: 945 Subcellular Location: Cell inner membrane
Q9TS44
AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF
Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. cholecystokinin 58 and cholecystokinin 8, but not cholecystokinin 58 desnonopeptide, stimulate amylase release from the pancreas. cholecystokinin 58, but not cholecystokinin 8, increases bile-pancreatic volume. PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Sequence Mass (Da): 6610 Sequence Length: 58 Subcellular Location: Secreted
O93464
MNAGICVCVLLAALSTSSCLSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain. PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Sequence Mass (Da): 13439 Sequence Length: 123 Subcellular Location: Secreted
Q9PU41
MYGGICICVLLAALSVSSLGQQPAGSHDGSPVAAELQQSLTEPHRHSRAPSSAGPLKPAPRLDGSFEQRATIGALLAKYLQQARKGSTGRFSVLGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear (By similarity). It also decreases food intake and regulates gastrointestinal physiological processes. PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Sequence Mass (Da): 14091 Sequence Length: 130 Subcellular Location: Secreted
P06307
MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Sequence Mass (Da): 12669 Sequence Length: 115 Subcellular Location: Secreted
O57312
MTAGLCVCVLLAVLCTSCLGHPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear (By similarity). PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Sequence Mass (Da): 14773 Sequence Length: 135 Subcellular Location: Secreted
Q9PU29
MYSGICICVFLAVLSASSFGQQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear (By similarity). PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Sequence Mass (Da): 14273 Sequence Length: 130 Subcellular Location: Secreted
Q21QL9
MKTVPTLSFSKLGCSRGGRQLFQNIDCVLESGHWLYVAGANGVGKTSLLRMVCGLAPIESGEIFWNGTPIHAQADAYRQDLCYLGHLNALQESMTVHENLAFTAALGGMAPDMAQTQSVLAHFGVAGRDRQLVRHLSQGQKRRVALSRLALSQARLWVLDEPFVAMDEAGVRMLADLIAAHLTQGGLAVLTSHQQVDIGAIPAQLLELRA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 22682 Sequence Length: 210 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q0VR80
MSQPATHSDAEPATRLVLEQLSCERDDRLLFSGLSFTASAGEIWQITGANGAGKTTLLRILVGLHGFYEGERQWWQPQWQQQLLYLGHEPGVREELNPLENLRYACALSQQGGDPMAALAAVGLQGFEEVPAAHLSAGQKRRIALARLWLDRKAVWVLDEPYTAIDQDGVAALDQQIQQAAEAGTLVIYTSHHQVGDGVRRLHLAHGQAEVTEGGRV
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23794 Sequence Length: 217 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q5E3S7
MLEIRNVTCIRDERVLFERLNFTISDGELIQIEGQNGAGKTTLLRIIAGLGYADEGDIFWKNESIKQNREEFHSDLLFLGHHTGVKRELTAFENLAFYQSMHDNYNEAAIWDALARVGLAGREDVAAGQLSAGQQRRVALARLWLSNHKLWILDEPLTAIDKQGVKVLEKLFMDHAKQGGIVLLTTHQDLFIDSNELKKIRLGE
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23140 Sequence Length: 204 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q0A808
MGDTALHLVAAPALEATGLQVARGGRPLFRGLGFRLARGGLLCVRGANGSGKTTLLRTLAGLSRPHRGRILRAGRCIRQAANDHRGTLQYRGHRDGLRGALTVLENLQWQAALYHHRPDREAVRTALAGMGMARHLDTLASQLSQGQRRRVVLASLALFPRCRLWLLDEPQAALDVEGAERFHALLARHCQEGGAVVACSHQHLRIGGIPCDELWLSDPAPAGARSAGDRVTGTEA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 25418 Sequence Length: 236 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q5PBP5
MLECSDVSCIRGDRLLFENLSFVAKGGSITLVVGNNGSGKTTLLRTIVGLIPAASGSVRLDGEDITISSKCILQITYVGHKSACTGNMTVQEILEFWAQCRGTGELIDAAACFFGLYPILDVRFKNLSSGWQKRVALSRLLVSNTRVWVVDEPFSNLDPDAVALVQNLILTRAERGGIVILADHKKNDLFTDAQIVQIPPTDCGTHST
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 22498 Sequence Length: 208 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q5P3L0
MVKSTPMLYAADLACLKGDRLLFRGLSLHVAPGAMLRIAGPNGFGKTSLLRILCGLAHPEAGEIRWNGRPIAGDRESFHRTLLYLGHAPALNDLLTPLENLRFACAAAGDDVDEDACVDALVRIGLADQLDLPARVLSQGQRRRVGLARLFLGIRRSLWVLDEPFTALDAAAVADLATTLSDHCAAGGVVILTTHQDAPFAVPPTVLDLSEVAA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 22776 Sequence Length: 214 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q6G529
MVLSGKDLTAYRNEDVLFQGLSFCLFPQQLMTITGPNGIGKSTLLRIIAGLFKAAEGHVSLKDQEQIYPVATACHYLGPQNAMKPFLSVIDNLQFWSAFYGQPLHSPHEVLADIGLSDLEHVPFNVLSTGQKRRIAIARLLLSYRPVWILDEPISGIDSYAQTLLTNIFQYHLNQGGMIIAATHSPLGIPENHKITLEKFLPPQEKIQ
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23164 Sequence Length: 208 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q7WIP8
MQNAEAAPALLAAHGLVGRRGGRRPLDLNLRPGQLVHVRGANGSGKTSLLRTLAGLLRPRRGEVRWNGADIHADLPGYYLHMAYLGHDNGCSDALTARENLRYALHVAGAPRAEPELERALRDWGLAAGADAPAARLSQGQGRRLALARVMLSRKRLWLLDEPDAGLDAASLQRLHGMLDAHLAGGGAAVLASHRGGGAWAGCTQTLELDEYAHAEVVGADCLA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23709 Sequence Length: 224 Subcellular Location: Cell inner membrane EC: 7.6.2.5
P30963
MQLSGRRVICVRGGREVFAGLDFEAVSGEAVAVVGRNGSGKTSLLRLIAGLLIPAGGTIALDGGDAELTLPEQCHYLGHRDALKPALSVAENLSFWADFLGGERLDAHESLATVGLDHATHLPAAFLSAGQRRRLSLARLLTVRRPIWLLDEPTTALDVAGQDMFGGLMRDHLARGGLIIAATHMALGIDSRELRIGGVA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 21132 Sequence Length: 200 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q8YEM5
MRLEAENLAGERGGETIFSHLSFTIGTGQALVVTGPNGSGKSTLLRIICGLLAPEAGEVKLTEGTQIVPVRAACHYLGHQNAMKPALSVRENLLFWQKFNGGEALDIGAALEAVDLAGVEHLPFGYLSTGQKRRVSIAKLLVSHRPLWIVDEPTAGLDKASEARFAELMREHMRQDGMIIAATHIPLGLDGAISTTGNGLVRSLDMAAFSVEDIA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 22908 Sequence Length: 215 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q9A298
MLRAVLIKDLAISRGERTLFSKLDLTLRAGEAATLVGRNGAGKTSLLRAVAGLLRPAAGSTAFEDANGPVEADTARAEHLHMLGHQDGLKSSRTAWEELRFQTLWTGGNEDSARAAAQRFDLRRLLDLEVRRLSAGQRRRLALARLAASPRSLWLLDEPMAPLDAGQRAAFGAVMAEHVAGGGMILASVHDPLPIPARSVEVGA
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 21813 Sequence Length: 204 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q87MK8
MLEVSNLTAIRDERVLFENLQFEIKPGELVQIEGRNGTGKTTLLRIITGLGDREEGMIKWKGEEVEKSRDVFHQDLLFLGHQTGVKRELTAFENLRFYQSIQNNSTSDEEIFTALTQVGLAGREDVPVAQLSAGQQRRVALARLWLSKQILWILDEPLTAIDKQGVKVLEALFAQHADNGGIVMLTTHQDMFADSPKLRKIKLGD
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23112 Sequence Length: 205 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q73HX8
MLECENLSCTRNNKVLFKNLSFKAELKSKILITGPNGSGKTSLIRSLSGLLPPVSGNIRHCGKDIYDDPKSYISSMVYIGHKNACKDSLTVAQNVEFWAGIRNTRELIVAAICCLQLQPVLNIRYGELSAGWKRRVALARLLISNANVWLIDEPFCNLDSATCELVLNLISIRSEQNGIVIITGHSSTEQLCDFTTIDIRNFNRLLV
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23014 Sequence Length: 207 Subcellular Location: Cell membrane EC: 7.6.2.5
Q9PAP0
MLCQYLPPDDRPPSSAPPLLAAHALTYSRNATPILGPLHFHINPGEALIVQGPNGIGKTTLLRILAGLLHSDSGHIDINTHHNTTAPERTRHIAYLSHLPGLKQDLSALENLHFLNALHGYHPQRTPSNALTLVGLTDHAQTLVRQLSAGQKKRLSLAQLWLSPAPLWLLDEPYANLDPEGITLLNHILTAHIHTQGGTLLTTPGARPTLPVPTRLLHLKKAP
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 24256 Sequence Length: 223 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q668T8
MLEAKNLTCIRDDRCLFQQLSFCIAPGEIVQIEGPNGAGKTSLLRILAGLAEADEGQVNWRDNNIRRDRAKYHQDLLFLGHQPGIKSVLTPFENLLFYQSVFQKVDSAAIWQALAQVGLVGYEDLPVSQLSAGQQRRVALARLWLSPAPLWILDEPLTAIDKQGVSTLLALFVQHAAKGGMVLLTTHQDLGAVSHNVRKICLANTQEKSCLSACCAVN
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23932 Sequence Length: 218 Subcellular Location: Cell inner membrane EC: 7.6.2.5
Q5NQX0
MGRKRLSDFGNARLACHDVSCLRGDRLLFTHLSFEVKAGEAVLITGANGIGKSSLLRLLAGFLKPFSGHIEKWGRVAFADEALAMDRHLPLEKALAYWAALDGVLGAEKEAMAVMALDILADSPVRLLSTGQRKRAVLARLLASQAAIWLLDEPANGLDAASVRALIEMIEHHRQKGGIILAVSHQGLDMADYKTLSLENFVANSGQSSGFFDLLDESHFS
Function: Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + heme b(in) = ADP + H(+) + heme b(out) + phosphate Location Topology: Peripheral membrane protein Sequence Mass (Da): 23936 Sequence Length: 221 Subcellular Location: Cell inner membrane EC: 7.6.2.5
P93280
MRRLFLELYYKLIFSSTPITSFSLFLLYIVVTPLMLGFEKDFLCHFHLGLIWISLLFSFLSAPFFRNEKEDGTLELYYLSTYCLPKILLLQLVGHWVIQISCVFCGFPMLQLLYQFGRSGMDWLNILLGSLVLTLLCGIHSCLALGITSSSGWNSLQNLTTLPTLLPLTVFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD
Function: May be involved in the export of heme to the mitochondrion for the biogenesis of c-type cytochromes. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 23637 Sequence Length: 206 Subcellular Location: Mitochondrion membrane
P30964
MTALSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLALLSRLGPAILWLGALLASLLTLDRLFMADHEDGSLDLITMSRTPLELACAAKALAHWLAAGLPLIVATPVLGLLLNLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGGLLMAVLVLPLSIPVLIFGVAASQAVIVGPMSFGAPFSILCALSLVSLVIGPFAAAASLRHGLD
Function: Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 22668 Sequence Length: 222 Subcellular Location: Cell inner membrane
P0ABM0
MMFWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALLSSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLGMDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAMDAASMHLPVDGYLAILGALLAGTATLSPFATAAALRISIQ
Function: Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 23619 Sequence Length: 220 Subcellular Location: Cell inner membrane
Q9I3N3
MNPVRKKRLIIVLAIVAGVGAAVGLALSALQQNINLFYTPTQIANGEAPTDTRIRAGGLVEKGSLQRSEDSLNVRFVVTDGAKEVTIAYHGILPDLFREGQGIVALGKLGGDGVLVADEVLAKHDENYMPPEVTKALKDSGQLKHYENGKAAGETSYNQEGK
Function: Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 17239 Sequence Length: 162 Subcellular Location: Cell inner membrane
Q8GQ96
MKPRNRRIALIVAGLSALGIATALVLNAFQSNLVFFFTPSQVSAGEAPLERTFRVGGMVERGSLKRQRGELAVQFVITDTVKAIPVTYSGILPDLFSEGKGVVVQGRLDSAGLFRAEEVLAKHDENYMPPEAQHALDEVQKKPASRKP
Function: Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 16103 Sequence Length: 148 Subcellular Location: Cell inner membrane
P0C1F6
MNPLRRKRLLIILAILAGVGIAVGLAMSALRENINLFYTPTQIANGEAPLDTRIRAGGMVEQGSLKRSGDSLDVTFVVTDFNKAVTITYRGILPDLFREGQGIVALGKLNADAVVVADEVLAKHDEKYMPPEVTKALKDSGQSRLARIRSLPRRAK
Function: Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 16967 Sequence Length: 156 Subcellular Location: Cell inner membrane
P48745
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Function: Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival . Acts by binding to integrins or membrane receptors such as NOTCH1 . Essential regulator of hematopoietic stem and progenitor cell function . Inhibits myogenic differentiation through the activation of Notch-signaling pathway . Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling . Ligand of integrins ITGAV:ITGB3 and ITGA5:ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival . Also plays a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5:ITGB1 and ITGA6:ITGB1 and induces fibroblast chemotaxis through ITGAV:ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts . Involved in bone regeneration as a negative regulator (By similarity). Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification . Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion (By similarity). Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway . Contributes to the control and coordination of inflammatory processes in atherosclerosis (By similarity). Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement . PTM: May be palmitoylated on Cys-244, which is important for extracellular secretion. Sequence Mass (Da): 39162 Sequence Length: 357 Subcellular Location: Secreted
Q64299
MSLFLRKRCLCLGFLLFHLLSQVSASLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI
Function: Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival. Acts by binding to integrins or membrane receptors such as NOTCH1. Essential regulator of hematopoietic stem and progenitor cell function. Inhibits myogenic differentiation through the activation of Notch-signaling pathway. Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling. Ligand of integrins ITGAV:ITGB3 and ITGA5:ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival. Also plays a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5:ITGB1 and ITGA6:ITGB1 and induces fibroblast chemotaxis through ITGAV:ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts (By similarity). Involved in bone regeneration as a negative regulator . Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification (By similarity). Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion . Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway (By similarity). Contributes to the control and coordination of inflammatory processes in atherosclerosis . Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement (By similarity). PTM: May be palmitoylated on Cys-241, which is important for extracellular secretion. Sequence Mass (Da): 38928 Sequence Length: 354 Subcellular Location: Secreted
P78396
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Function: May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells. PTM: Polyubiquitinated via 'Lys-11'-linked ubiquitin by the anaphase-promoting complex (APC/C), leading to its degradation by the proteasome. Deubiquitinated and stabilized by USP37 enables entry into S phase. Sequence Mass (Da): 52358 Sequence Length: 465 Subcellular Location: Nucleus
Q0WKY2
MSGYERKNTTANSITITKRKRNSISEQSENVYEKSNRKESITLKPHRSFTPGFSQRDCKPVRHSKSSLRRRRRTKEKISSSVEREWVFSANNFENLADKLVLVSYNLLGVDNASNHMDLYYNVPRKHLEWSRRKHLICKEISRYNASILCLQEVDRFDDLDVLLKNRGFRGVHKSRTGEASDGCAIFWKENLFELLDHQHIEFDKFGMRNNVAQLCVLEMNCEEDPKSKLRVRSSDPRRLVVGNIHVLFNPKRGDIKLGQVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDRRQISGQTEVEPKERSFRNHYAFSASASISGSLLNEWSQEELQLATGGQETTHVQHQLKLNSAYSGVPGTYRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPADVLRRTGGLPSENWGSDHLAIACELGFVNDWQ
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 52152 Sequence Length: 454 Subcellular Location: Nucleus EC: 3.1.13.4
Q8VYU4
MRRSRFVAQVFSDVTFADASTISAPIFTMSTRAPYRGARGRGRGRGGRSFSDRPYNDDAGRDQFVTGDSHFQSVHDANFRFRHGEPYRQHQPPLDQRQQPPFNQNYEFRPPPPSRGQWQQFRQPNQFPSNQNYAACPPPPFYQNQMSRPPPQQSFRQRPRSKPSDYREWEYAKTPPSPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGWRKSKLVFELSLWSADIMCLQEVDKFQDLEEEMKHRGYSAIWKMRTGNAVDGCAIFWRSNRFKLVHEESIQFNQLGLRDNVAQICVLETLLTSHTKENETPPPESSAGSHRVVICNIHVLFNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSPLYNFISDRKLDLSGLARDKVSGQVSAEFRPPRPENYTTRYQSANKSPQGQVQPPNLITNAHMENNSNIDVGTAPSEKTSELPCGDTILAGHEATSSSDQVLPCENMASDCQFGIENRKPDDSGNLSTAEDLSSLTISDTEPQHASSAREDLNTDRSVSSGLSETEQTPEEICSSDQDISSSLSTKVDTFVAEMKLDGLKLDEPVVFAQDEESLGEDGETFLAKLHDNNENLSQKGELVSEVPLKWSSEALNSDKITYSPSSWTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYIWRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAFCSSKTLPKS
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 84925 Sequence Length: 754 Subcellular Location: Nucleus EC: 3.1.13.4
Q4WQG5
MYSQTHQGQHVMMNGGQAHQRFGMQIPKFQSQSHHPHHTQQPHHHTHHNQASHNINHQHNFSSGALASATPHFTPSHIQNGAHTNVDEDIDESMNEHWQQQLQLAAESRQASSPHYHARSVAQQAKGIQIAPSQPETQEQVPDGQNGVVKAKASSRQGWHALDFGGQGLRALSTSLFNYIFLEKLYLNHNKLKALPPAIGQLRKLNHLDLSGNDLTELPEEIGMLTNLKKLYLFDNNIRTLPYEMGYLYRLETLGVEGNPLNDVLKSHIMKEGTKALIKYLKEEMPAFFFSCTTPLTLMAVHLPPPDRDWIVLDETASSSNHRTDKVTVLSYNTLCDSSATQSHYGYAPARVLSWEFRRELILNELRSHDSDIICLQEIDQGSYNEYFREQLAYNDYKGVYWPRGRAMGMQEEDAKCVDGCATFFKGSKFILLDKQLINFGQTAVRRPDAKGQDDIYNRLWQKDHIAVVVFLENRQTGARFIVVNAHLYWDPAFKDVKLIQTAILMEELTKLSETYAKWPPCTDKAAFRFSKEEGQSETPPLEEPAPSMQYASGDQIPLLMCGDLNSSPGSAAYNLIAHGRLDEEHPDLEKRLYGNLSKVGMTHPFKLKSAYGAIGELPFTNYTPDFKDILDYIWYSSNSLHVSALLGEVDKDYLQRVPGFPNYHFPSDHIALLAEFTVKGKKGKVVEADFGPQRN
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover (By similarity). Ccr4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA (By similarity). Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 78849 Sequence Length: 696 Subcellular Location: Cytoplasm EC: 3.1.13.4
Q5A761
MNITNKFQHTPIQGQPQSNLQAQQILLSQLHQGQAQQQQQQQQQQQQQQQSSAGVLGSGFQPSDNFGESLNQNIYQNNYQRAQPSLQQQFFPQFQQSQQQPSQQANNASQLQQPYQPAQQMVRQTSHFQQQQQQQPSSQQFYSQQQASVLQQQQQQQIQLQSAHQQQSSLLNMNSINVDNPNSVYWQHQQQLCQISRGSNVPHYYARQYASNSRKAKNPYSEVKSVGLVEATRSMVASLEDEEEKKKKPINYQGTPTTSAALLHNKKSTQDIFEDDSMEEQRMRLKTQGKQLWCQLDLSGQGLVNISSKLFHYDFLESLYLSNNKLNSIPSSISKLRNLRTLDLSHNRINELPEELGLCFNLRYLFLFDNNIKTLPYSFGNMIELLFIGIEGNPLEPSIANLIAEKGTKELIATLRDQTTVKRTPKPRCWLTLEDDGEVVDSDEVYKVEPESSDNFTVLSYNTLCQHYATPKMYKFTPSWALQWDYRKNLLEKEVLNYNTDIVCMQEVETKTFQEFWLPVMTANGYKGYFFSKTRSKTMSETDSKKVDGCATFFKNDKFSLIHKQNFEYNSVCMGSDKYKKTKDLFNRFMNKDNIALISYLQHKESGEKIAVVNTHLHWDPAFNDVKALQVGILLEELQGIIKKYRHTNSNEDIKNSSIVVCGDFNSVKDSAVYQLFSTGASKGHEDMNGRDYGKFTEDGFHHPFKLKSAYEAVGELPFTNLTPAFTDNIDYIWYSTPTLQVKGLLGGVDEEYTSHSIGFPDANFPSDHVPILAKFQLKKGKKNHSV
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover (By similarity). Ccr4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA (By similarity). Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 90325 Sequence Length: 787 Subcellular Location: Cytoplasm EC: 3.1.13.4
P0CP22
MFYPHHQSQQSTTTNPSKHHDSQDVRLPGTSSWSRHPSHPSFTPSLPMPSPSGYPPLGSGYPPGGHHHPNVNVHSGIHGPHPSFGSGMGGNGGMGHGQGFGMGMFQNGVQTSPPRGEPVPMTSHWQTQMMRAEASRSASSPHHRARAAAISSRATNKPSAVPIVDPNNRPSSSYGTNGLHRKNASSVFNGEPTGTPPLSDPSLTPAQNPAEPATPAPVAGQTESKDEEKPNEPWTGLDLGGIRLKRLSTALFSFTHVTSLYINHNALTSIPSAISSLRQLTLLDATGNELSTIPSEIGVLSKLKDLLLFDNNLTTLPFELGTLYQLDCLGIDGNPMNADYRKKLVEDGTRGLITYLRDHAPPPPPPPERQWIDLETDVDTPTSGKQESFSVLTYNILCASFAPATTYSYTPSWALDWDYRKRLLLEEIVTASADVVCLQEIDCKQYADYFYPMLKKEGYEGQHYPRSRAKTMSVDEQKLVDGCATFWKEEKFRLVETQVIEFNQLALQKTDMRTEDMFNRVMSRDNIAVVAALEFRASGGRLLVANSHIYWDHRYRDVKLVQIGMLMEELEKIVEQFSRYPVKLDTDPEYNNGKPPKYERSEKGRDIPLIMCVDLNSFSGSAVYDYLSSGSIPGDHEDFMSHLYGRYTASGLKHHLGLRSACAGIGEMRMTNFTPTFAAAIDYVFYTPRTMKVTSVLGDVDKAYLDKTVGFPNAHFPSDHIPVFTQFRIKGHLDPLPLNGDPYH
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover (By similarity). Ccr4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA (By similarity). Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 82377 Sequence Length: 744 Subcellular Location: Cytoplasm EC: 3.1.13.4
Q5B778
MYSQTHQQQHVIMNGGQAHQRFGMQMKFQTQNHHPHPAQQPHHHAHHNQPPQHVGHQHNFSSGALASATPHFTPSHIQNGTHTNIDEELDESMNEHWQQQLQLAAESRQASSPHYYARAVAQQTKGIQIAPSQPEAQENGVNQKNGITKTKPASRQGWHALDFGGQGLRALAPSLFKYAFLEKLYLSHNKLKVLPPQIGQLRKLTHLDLSANDLTELPEEIGMLTNLRHLLLFDNNIRTLPYEMGYLYRLEILGIEGNPLEDVLKSLIMKEGTKALIRYLKEEMPVHVPPPARDWLVLDETAATSPDKVSVLSYNTLCDSSATQSHYGYAPSRVLSWEFRRETILNELRAHDPDIICLQEIDQGSYNEFFREQLAYSDYKGVFWPRGRAMGMQEEDAKGVDGCATFFKGSKFILLDKQVINFGQTAVRRPDAKGQDDIYNRLWQKDHIAVIVFLENRQTGSRFIIVNAHLYWDPAFKDVKLIQTAILMEEITKHSEKYAKWPPCTDKAAFRFREAQGEQTMPEPAPSAEYASGDQIPLFMCGDFNSSPGSAAYNLIANGGLIEEHPDLEKRMYGNLSKVGMTHPFKLKSAYGAIGELSFTNYTPDFKDILDYIWYSSNTVHVSGLLGEVDKDYLQRVPGFPNYHFPSDHIALLAEFSVKGKKGKVVEADFGPQRN
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover (By similarity). Ccr4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA (By similarity). Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 76463 Sequence Length: 675 Subcellular Location: Cytoplasm EC: 3.1.13.4
Q8SU52
MAEECLVSRKKFGGKAMEVRSEMWTGLDLCSQGIKNISKSLFDMRFIRTLNLANNEIEVIPREICNLRHLEVLNLSKNKIRSIPPEIGKIVSLRELNLSDNLISNIPMEMGTLYNLEVFEIANNPLIVPFNTLIRDKKLLQFCREHNTGYPPPNDRLWIECTGKNVFYGDTVSVGTFNILSNIYATRMTYAPSWVINSEFRREGVLQEIVLYNVDILCLQEIELYSFFDFYKEQLEMRCNYDSIIYPRGRVKSVPDKKNVDGCAIFWRRSKFRLIAQFPIDFHQKVIQDTRFNTNQELLDRYGKKDNIAIGALLERPNGQQVLVMNTHIFWDPDYPDIKLLQVLLLVEEIKRVSSRHPNACLLLQGDFNSLRSSSVYKSITTPVIDFADFGDTMQHLSNQQFGDGLGLNDAYSNQDLGFTNFTPGFKGVIDYIFYGGGISLASVLSPVEDEYTENVAGLPNMHFPSDHIFLGAKFAFPNKNISQNAFGRNSRQ
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover (By similarity). Ccr4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA (By similarity). Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 56489 Sequence Length: 493 Subcellular Location: Cytoplasm EC: 3.1.13.4
B7XK66
MEEKIKKKDYNKDIDNCDDELEGLDMSFQGIKVIGKEITLLVSLKQLILNNNDIETIPEDISNLIRLEVLDFSYNKIEKIPTELGRLINLKELYLNNNMIVEVPMELGTLYKLENFSILNNPLVHPYGIMSKDKSLLRFCRENNTNYKQPNDRVWIDTVLKIDQSLETYSFGTFNILCSLYASNLTYAPSWVINLECRKDILMQTFIAYNLDILCLQEVDINVFNTFYKEQLAQKLDYDGVILPKKSFDKVTDQPKKFHGIVTFWKKNKFKLIEQVSIDFFQKIINDKRFKYLSDIHTRIFQKTNVGLITIFETCNTNIIIIVANVHLYWNPEFNDIKILQTIIYLEEIEFLKEKYKHAHIVLQGDFNSLQNSHVYQYIINRKLPTNIFDPWDYGSLNNGVTHSLTLRNAYDGHDITFTNFTPSFKAVIDYIFYSKYLNLISIISPIEDEYTKTTIGLPNIHFPSDHILIGAKFQFKSSKK
Function: Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover (By similarity). Ccr4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA (By similarity). Catalytic Activity: Exonucleolytic cleavage of poly(A) to 5'-AMP. Sequence Mass (Da): 56348 Sequence Length: 481 Subcellular Location: Cytoplasm EC: 3.1.13.4
P51679
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLNPIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
Function: High affinity receptor for the C-C type chemokines CCL17/TARC, CCL22/MDC and CKLF isoform 1/CKLF1. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival. PTM: In natural killer cells, CCL22 binding induces phosphorylation on yet undefined Ser/Thr residues, most probably by beta-adrenergic receptor kinases 1 and 2. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 41403 Sequence Length: 360 Subcellular Location: Cell membrane
Q7VA54
MKYLRKIINWLSSLKVAIVLLILIALGSALGTALPQGEKAESYLKNYEVTRFLGVINGDLLLQLQLDHVYSSFWFLFLLTWLSFSLIICSWKRQWPSLKKAIDWIDYKEPKQIQKLAISQSFRIQKNDNGINPLANYLENNGWQVKIKSSRLAARKGLIGRVGPPLVHFGLILLIIGATYGVLKGQRLEKFLAPERSLNLLSPNGISKVSVKLTDFKIDRDPTGKPEQFRSKLELHNNNINKSIYEEISVNHPLRFQGITLYQADWSLAAITIQINNSPKIQFPLNKIDELGDQVWGIVLPQMPDSDLKPLLLTLSSEQGPVRFFSEEGNPAGIGRPNGNPILIGTSKISIIDVIPSSGILLKYDPGVPIVYLGFAISLIGSVFSIISTKQLWIIQEEESRLMHIGGLSNRNLSGFANQFNSIIKAAYD
Function: Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 48044 Sequence Length: 429 Subcellular Location: Cellular thylakoid membrane
A6MVS2
MLIKINQYFRKSISVLGNLKLAIILLLMLALFSAFGTVIEQNQNVAFYENSYPNSAPLFGFLSANAILFLGLNNIYQTWWFTTLILLLAVSLFSCTLARQIPSLKMARLWQFYTKDQSLKKIGLSFNLQKTSLSKLAFTLKTDDYNVIQKGRFLYAYKGLPGKIGPIIVHASLIIILFGALLGNLSGFVSQELVPLGGVFHIQNIINSGTLSYVPQNFEGYVKDFKIAYNDEGSIDQFYSDLSILNSTGEEVRSKTIYVNEPLRYEGIVFYQTDWSITNLAINVDQQTNIQLPLKSINVKGEGKFWIASLPIANVEKATNDNILLVLEDLTGKILLYSSNQQLLAIVNVGENISLNGHSVKVTDIISSTGLQIKSDPGIPFVYIGFFLLMLSITLSYFSYSQVWAIKDNKTLYVSGRTNRAIYSFEQQITKMMNKLNSTYA
Function: Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 49475 Sequence Length: 441 Subcellular Location: Plastid
Q31RG5
MTSDPLASPSFADRWRRGQQLFWTWLADLRLAILLLLAIAIASATGTVIEQGQSLAFYQENYPTDPALFGFLSWRWILSLGLDHVYRAGWFLGLLILFGASLTACTFRRQWPALRAAQRWQFYQEPRQFTKLALSASLPQGKLDSLEPLLLQRRYRLFRADDVLYARRGLAGRVGPILVHAGMLVVLGGAIWGSLGGFYAQEMIPSGETFQVRNIVDAGPWSGSRIPQDWAVKVNRFWIDYAPDGRIDQFYSDLSVVDREGQEQDRQTIHVNQPLRYGGLTFYQADWAIAAAQVRLNNSPVLQLPMAQLPAAGRIWGTFVPTKPDLSSGVSLIAKDLQGTAVIYGSNGEPLGTLRKGMAIEVEGIRLSLVDLVGSTGLQIKSDPGIPWVYAGFLFVMVGVVCSYVSHAQVWALEQDGQLYIGGRSNRALVAFEQEMLAVLAQLDAQSNHSAETAIA
Function: Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 50461 Sequence Length: 456 Subcellular Location: Cellular thylakoid membrane
P38273
MRLHYITVFDPSRSTNENDTFKQLLLFHYFGTTDSIPSLNEKLSIIGVIQGIWSLTSSCVNKDGEDLEKIIELNNDIIFCIKVESRFFISLAISNISDDQSAIPLQYLSAYLWLSYRFFKLLNGSFSGFNKDFRKLTDLLNEFVIPFWNDIYLNLETVTNRSFTVMWPGFYKRANFQHSSYNPGEKNNVEESWDAIILQNILLDKKSYLGLKDILVYHLPKRTKAANRESMGTKTYGLVRNFTSDLNTLPDISNWLYHLHCTYGEISSHILTGNVHFKEELQVEEEQERSRDTNGRDEEESQEQQRREHQETTQNNTSELSLSERVIHNVTLPISFAYDAIHEVSTTTGVSGSLSMIMDYVPKPHWPFISSSNKSADKNNYSNSNDNANSNAPLMAQSEAVGGTIGNSRFGFLISPLNSDLLPSSYQALKLNLNFENSKDKEDFYNCLFWYFDDFLIVIVCDPDFNKICERDYLKDLSFQLCQSMECLNNEILNSQNCDNVESFAYVIRDNVTKEIDSSVPFGSPKFTSDESISTLQLAINGIDQFINDNSNSLSLANWNPITIMGGSNAISKKNTTEGFGNGVNDKTQKFKRKYLNFLNLMSAEKLWDLQVDVLQFLTSLQNSKRDPDYFQEERLLKLNNGVLCYIKENNSNLIIIIKNWFQNNGTSKAAKQRNRFSSDSSKGSSLFQSLGRDVTDWWESREI
Function: In complex with MON1, is required for multiple vacuole delivery pathways including the cytoplasm to vacuole transport (Cvt), autophagy, pexophagy and endocytosis. The CCZ1-MON1 complex acts at the fusion of vesicles with the vacuole, through its regulation of the SNARE complex during the coordinated priming and docking stages of fusion, and particularly at the stage of tethering/docking . The CCZ1-MON1 complex acts as a guanine nucleotide-exchange factor (GEF) for Rab-type GTPase YPT7, promoting nucleotide exchange on YPT7 and triggering endosomal maturation by activating YPT7 on late endosomes . Location Topology: Peripheral membrane protein Sequence Mass (Da): 80732 Sequence Length: 704 Subcellular Location: Endosome
Q3C2E2
MTTPRNSMSGTLPVDPMKSPTAMYPVQKIIPKRMPSVVGPTQNFFMRESKTLGAVQIMNGLFHIALGSLLMIHTDVCAPICITMWYPLWGGIMFIISGSLLAAADKNPRKSLVKGKMIMNSLSLFAAISGIIFLIMDIFNITISHFFKMENLNLIKAPMPYVDIHNCDPANPSEKNSLSIQYCGSIRSVFLGVFAVMLIFAFFQKLVTAGIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP
Function: B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR. PTM: Phosphorylated. Might be functionally regulated by protein kinase(s) (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 33056 Sequence Length: 297 Subcellular Location: Cell membrane
P11836
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Function: B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes . Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR . PTM: Phosphorylated on serines and threonines in resting B-cells. Protein kinase C/PKC can use CD20 as substrate. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 33077 Sequence Length: 297 Subcellular Location: Cell membrane
Q15762
MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV
Function: Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell . Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding . Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 38614 Sequence Length: 336 Subcellular Location: Cell membrane
Q8K4F0
MAYVTWLLAILHVHKALCEETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPIVGGLVSLLLVILIIIIFILYNRKRRRQVRIPLKEPRDKQSKVATNCRSPTSPIQSTDDEKEDIYVNYPTFSRRPKPRL
Function: Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding. PTM: Phosphorylated. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 38063 Sequence Length: 333 Subcellular Location: Cell membrane
P20273
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH
Function: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. PTM: Phosphorylation of Tyr-762, Tyr-807 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 95348 Sequence Length: 847 Domain: Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Cell membrane
P35329
MRVHYLWLLLILGHVASARYSSANDWTVDHPQTLFAWEGACIRIPCKYKTPLPKARLDNILLFQNYEFDKATKKFTGTVLYNATKTEKDPESELYLSKQGRVTFLGNRIDNCTLKIHPIRANDSGNLGLRMTAGTERWMEPIHLNVSEKPFQPYIQMPSEIRESQSVTLTCGLNFSCFGYDILLKWFLEDSEITSITSSVTSITSSVTSSIKNVYTESKLTFQPKWTDHGKSVKCQVQHSSKVLSERTVRLDVKYTPKLEIKVNPTEVEKNNSVTMTCRVNSSNPKLRTVAVSWFKDGRPLEDQELEQEQQMSKLILHSVTKDMRGKYRCQASNDIGPGESEEVELTVHYAPEPSRVHIYPSPAEEGQSVELICESLASPSATNYTWYHNRKPIPGDTQEKLRIPKVSPWHAGNYSCLAENRLGHGKIDQEAKLDVHYAPKAVTTVIQSFTPILEGDSVTLVCRYNSSNPDVTSYRWNPQGSGSVLKPGVLRIQKVTWDSMPVSCAACNHKCSWALPVILNVHYAPRDVKVLKVSPASEIRAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQEGRYLSFGSVSPEDSGNYNCMVNNSIGETLSQAWNLQVLYAPRRLRVSISPGDHVMEGKKATLSCESDANPPISQYTWFDSSGQDLHSSGQKLRLEPLEVQHTGSYRCKGTNGIGTGESPPSTLTVYYSPETIGKRVALGLGFCLTICILAIWGMKIQKKWKQNRSQQGLQENSSGQSFFVRNKKARRTPLSEGPQSQGCYNPAMDDTVSYAILRFPESDTHNTGDAGTPATQAPPPNNSDSVTYSVIQKRPMGDYENVNPSCPEDESIHYSELVQFGAGKRPQAKEDVDYVTLKH
Function: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. PTM: Phosphorylated on tyrosine residues by LYN. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 97181 Sequence Length: 868 Domain: Contains 3 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Cell membrane
Q9N1E6
MHLLGPWLLLLVLEYLAFSDSSKWAFEHPETLYAWEGACVWIPCTYRALDRDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHVNDSGQLGLRMESKTAKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGESVTMTCEVSSSNPEYTTISWLKDGTSLKKQNTLMLNLHEVTKDQSGKYCCQVSNDVGPGRSAEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPTPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWGNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESRLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGHSPLSTLTVYYSPETIGRRVAVGFGSCLAILILAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGYYNPMMEDGISYTTLRFPETNIPRTGDAETSEMQSPPPDCDDTVTYSVLHKRQMGDYENVIPDFSEDEGIHYSELIQFGVGERPQAQENVDYVILKH
Function: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid (By similarity). Upon ligand-induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling cascade key molecules. PTM: Phosphorylation of Tyr-762, Tyr-807 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 95274 Sequence Length: 847 Domain: Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Cell membrane
Q9N1E3
MHLLGPWLLLLEYLAFSDSSKWAFEHPETLYAWEGACVWIPCTYRALDGALESFILFHNPEYNKNTSKFDGTRLYESTKDGEVPSEQKRVQFLGDKSKNCTLSIHPVHVNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWFLEGVPVGQAAVNSTSLATKSVFTRSELKFSPQWSHHGKIVTCQLHGADGKFLSNDTVQLNVKHTPKLKIEVNPSDAIVREGDSVTMTCEVSSSNPKYTTVSWLKDGTPLKKQNALMLTLQEVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPE
Function: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid (By similarity). Upon ligand-induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling cascade key molecules. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 37257 Sequence Length: 330 Subcellular Location: Cell membrane
Q9BZW8
MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS
Function: Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor . Activating function implicates association with SH2D1A and FYN . Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2 . Stimulates NK cell cytotoxicity, production of IFN-gamma and granule exocytosis . Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells (By similarity). Acts as costimulator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1 . At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells . Involved in the regulation of CD8(+) T-cell proliferation; expression on activated T-cells and binding to CD48 provides costimulatory-like function for neighboring T-cells (By similarity). Inhibits inflammatory responses in dendritic cells (DCs) (By similarity). PTM: N-linked glycosylation is essential for the binding to its ligand CD48. Also O-glycosylated, in contrast, O-linked sialylation has a negative impact on ligand binding. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 41616 Sequence Length: 370 Domain: The ITSMs (immunoreceptor tyrosine-based switch motifs) with the consensus sequence T-X-Y-X-X-[VI] present in SLAM family receptors have overlapping specificity for activating and inhibitory SH2 domain-containing binding partners. Especially they mediate the interaction with the SH2 domain of SH2D1A and SH2D1B. A 'three-pronged' mechanism is proposed involving threonine (position -2), phosphorylated tyrosine (position 0) and valine/isoleucine (position +3). Subcellular Location: Membrane
Q07763
MLGQAVLFTTFLLLRAHQGQDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNFRFLPFGVIIVILVTLFLGAIICFCVWTKKRKQLQFSPKEPLTIYEYVKDSRASRDQQGCSRASGSPSAVQEDGRGQRELDRRVSEVLEQLPQQTFPGDRGTMYSMIQCKPSDSTSQEKCTVYSVVQPSRKSGSKKRNQNSSLSCTVYEEVGNPWLKAHNPARLSRRELENFDVYS
Function: Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor . Activating function implicates association with SH2D1A and FYN. Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2. Stimulates NK cell cytotoxicity, production of IFN-gamma and granule exocytosis . Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells . Regulation of NK cell activity by adapters Sh2d1b and Sh2d1b2 is reported conflictingly . Acts as costimulator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1. At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells (By similarity). Involved in the regulation of CD8(+) T-cell proliferation; expression on activated T-cells and binding to CD48 provides costimulatory-like function for neighboring T-cells . Inhibits inflammatory responses in dendritic cells (DCs) . PTM: N-linked glycosylation is essential for the binding to its ligand CD48. Also O-glycosylated, in contrast, O-linked sialylation has a negative impact on ligand binding (By similarity). Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 44836 Sequence Length: 397 Domain: The ITSMs (immunoreceptor tyrosine-based switch motifs) with the consensus sequence T-X-Y-X-X-[VI] present in SLAM family receptors have overlapping specificity for activating and inhibitory SH2 domain-containing binding partners. Especially they mediate the interaction with the SH2 domain of SH2D1A and SH2D1B. A 'three-pronged' mechanism is proposed involving threonine (position -2), phosphorylated tyrosine (position 0) and valine/isoleucine (position +3). Subcellular Location: Membrane
P01731
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. PTM: Palmitoylated, but association with CD8B seems to be more important for the enrichment of CdD8A in lipid rafts. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 27456 Sequence Length: 247 Subcellular Location: Cell membrane
P07725
MASRVICFLSLNLLLLDVITRLQVSGQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWAPLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV
Function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. PTM: Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 26196 Sequence Length: 236 Subcellular Location: Cell membrane
P79336
MQPGLWLLLATQLAALRGSSVLQQAPGSVMVQTNGMVIMSCEAKTSPTSTRIYWLRHRQAPSPDSHYECLAYWDPIKGIVYGQEVEPEKLTVFPDATRSILNLTSVKPADSGIYFCMTVGSPELTFGKGTRLSVVDVLPTNSQPTKKPTPRKKMCRPPSPVTQKGPSCGLLTLGLLVAGVLVLLVSLGVAIHLYRLKRRARLRLLKQFYK
Function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells. PTM: Phosphorylated as a consequence of T-cell activation. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 23105 Sequence Length: 210 Subcellular Location: Cell membrane
P10966
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells. PTM: Phosphorylated as a consequence of T-cell activation. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 23722 Sequence Length: 210 Subcellular Location: Cell membrane
P14209
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Function: Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes (By similarity). PTM: Extensively O-glycosylated. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 18848 Sequence Length: 185 Subcellular Location: Membrane
Q8VCN6
MARAAMEAAATVVLALALLGAAARGAASDDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQGLVPGVVAAVVAAVAGAVSSFVAYQRRRLCFREGGSAPV
Function: Involved in T-cell adhesion processes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 16783 Sequence Length: 175 Subcellular Location: Membrane
P21926
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Function: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion . Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (By similarity). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles . Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). Acts as a receptor for PSG17 (By similarity). Involved in platelet activation and aggregation . Regulates paranodal junction formation (By similarity). Involved in cell adhesion, cell motility and tumor metastasis . PTM: Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro). The protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids . Palmitoylation by ZDHHC2 regulates CD9 expression, association with other tetraspanin family proteins and function in cell adhesion . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25416 Sequence Length: 228 Subcellular Location: Cell membrane
P40240
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Function: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion . Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion . In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration . In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption . Acts as a receptor for PSG17 . Involved in platelet activation and aggregation . Regulates paranodal junction formation . Involved in cell adhesion, cell motility and tumor metastasis (By similarity). Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung . PTM: Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro). The protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids. Palmitoylation by ZDHHC2 regulates CD9 expression, association with other tetraspanin family proteins and function in cell adhesion. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25258 Sequence Length: 226 Subcellular Location: Cell membrane
Q8WMQ3
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNNSSFYTGVYILIGAGALMMVVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDQVIKEVQDFYRDTYNKLKGKDDPQRETLKAIHYALDCCGLMGEVEQLLADICPQRDVLSSLPMKPCPEAIKEVFQNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Function: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion (By similarity). Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (By similarity). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles (By similarity). Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). Acts as a receptor for PSG17 (By similarity). Involved in platelet activation and aggregation (By similarity). Regulates paranodal junction formation (By similarity). Involved in cell adhesion, cell motility and tumor metastasis (By similarity). PTM: Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro). The protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids. Palmitoylation by ZDHHC2 regulates CD9 expression, association with other tetraspanin family proteins and function in cell adhesion. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25201 Sequence Length: 226 Subcellular Location: Cell membrane
P40241
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCPDAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Function: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion (By similarity). Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (By similarity). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles (By similarity). Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). Acts as a receptor for PSG17 (By similarity). Involved in platelet activation and aggregation (By similarity). Regulates paranodal junction formation (By similarity). Involved in cell adhesion, cell motility and tumor metastasis (By similarity). PTM: Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro). The protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids. Palmitoylation by ZDHHC2 regulates CD9 expression, association with other tetraspanin family proteins and function in cell adhesion. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25215 Sequence Length: 226 Subcellular Location: Cell membrane
O65896
MDKPSFVIQSKEAESAAKQLGVSVIQLLPSLVKPAQSYARTPISKFNVAVVGLGSSGRIFLGVNVEFPNLPLHHSIHAEQFLVTNLTLNGERHLNFFAVSAAPCGHCRQFLQEIRDAPEIKILITDPNNSADSDSAADSDGFLRLGSFLPHRFGPDDLLGKDHPLLLESHDNHLKISDLDSICNGNTDSSADLKQTALAAANRSYAPYSLCPSGVSLVDCDGKVYRGWYMESAAYNPSMGPVQAALVDYVANGGGGGYERIVGAVLVEKEDAVVRQEHTARLLLETISPKCEFKVFHCYEA
Cofactor: Binds 1 zinc ion per subunit. Function: This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. Functions as a conventional cytidine deaminase. Has no affinity for RNA and is not involved in RNA-editing by C-to-U deamination. Catalytic Activity: cytidine + H(+) + H2O = NH4(+) + uridine Sequence Mass (Da): 32582 Sequence Length: 301 EC: 3.5.4.5
G0SDN0
MAPRRRRGAGQDGSDDGRSDSDAPKNRPPNTAFRQQRMRAWQCVLTPKLIVTVFSILAAIYLGFGAWLTYLAHTVRDLKIDYTDCLTSAPKDDFETIPQNHITAHFSAKDSTFDPYKAQWKTTEREVQVANYTDNRQFCIVRFNIPEDLQPTISFFYYLENFYQNHRRYVNSFNAKQLLGDAVDGKTINDSTCDPITHDPKGTGKIVYPCGLVANSIFNDTFSSPLALAVRNSSDSSRPYNMTTKGIAWPGLKDLYGKTSYSLDQIVPPPNWERRYKYGYQENNPPPDLKTDELFQNWMMLAAAPNFYKLYQKNDTHPMLAGQYEIEIESNFDVTVYKGRKAFVITTLSTMGSRNIWPGIIFLIVGGICLVLDIYFILSFFIWRPRKLGDPSYLSWNQPSAPGGHSS
Function: Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of phosphatidylcholine and phosphatidylserine from the lumen to the cytosolic leaflet of membranes and ensures the maintenance of asymmetric distribution of phospholipids. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 46402 Sequence Length: 407 Subcellular Location: Cell membrane
S7WII9
MGENSTTGLRGQADVSQFSDAAVEPTLSSPPTGQRQQSLPLFGEETCSISSAPSVGGGGGWPFQRQGSSRLTSRGTSLSSCSDAGSGLGALRQREDSFPEYHGVGLPLGGKYALDGTGLVLAPRVPFIFSHQLPSLTGLDEAGFSDTRKVPSTYQALAARFVHQVHQEAGNGMYPLWSAGVVLRLCLLGALFFVSVGAWLIFEDEQHVECKLNYAEKTLQEGSSRYLLKGISSAHCTREVNELKGEEISVYAEMGHFFQNDAQVLWSRNDRQLAGKIFTDPKDVRECEPLATAVVGNVTKVLHPCGALAWAVFTDKYQFLEGTPEGDNDQVPMKPIPLNQTQAVLLHSWPWQDMYKNPPAEDRAAVLDKVYFWMSPVDNDDGEDMYKTREEARAELLMDRLNYEEAGEMVENGHFIQWMQTAALGTFRKLYGSLEGPLKLPVSAHITVMYDVSSWKGKKAIVLVQKSRLGGRSLFIGIAYLSFGCLLTMLVFYMLWKKWQYRREGEEIRDLRWQTKTRGSKKTK
Function: In tachyzoites, required for the cellular trafficking of guanylate cyclase GC and UGO to the cell membrane . May play a role in the folding of the GC P-type ATPase-like domain to sense vacuolar changes in phosphatidic acid and pH levels which trigger parasite egress . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 58191 Sequence Length: 524 Subcellular Location: Membrane
P25656
MVSLFKRGKAPPLTKEGPTSKKPPNTAFRQQRLKAWQPILSPQSVLPLLIFVACIFTPIGIGLIVSATKVQDLTIDYSHCDTKASTTAFEDIPKKYIKYHFKSKVENKPQWRLTENENGEQSCELQFEIPNDIKKSIFIYYKITNFYQNHRRYVQSFDTKQILGEPIKKDDLDTSCSPIRSREDKIIYPCGLIANSMFNDTFSQVLSGIDDTEDYNLTNKHISWSIDRHRFKTTKYNASDIVPPPNWMKKYPDGYTDENLPDIHTWEEFQVWMRTAAFPKFYKLTLKNESASLPKGKYQMNIELNYPISLFGGTKSFVLTTNGAIGGRNMSLGVLYLIVAGLCALFGIIFLVKLIFQPRAMGDHTYLNFDDEENEDYEDVHAENTTLREIL
Function: Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of phosphatidylserine and small amounts of ethanolamine from the lumen to the cytosolic leaflet of the trans-Golgi network and ensures the maintenance of asymmetric distribution of phospholipids . Required for the formation of transport vesicles from endosomes . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 44982 Sequence Length: 391 Subcellular Location: Golgi apparatus
Q12018
MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCVNKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQSNSETFLQFYVKRWKRFTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQVTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQVFEKPFLKKTQEYYTQYTNDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSMALNKVLITDHIEKLENEFVVLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNENANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININEFALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITIFKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVALKNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILKWLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIAAAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGGHDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA
Function: Core component of multiple cullin-RING-based SCF (SKP1-CUL1-F-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The SCF complex associates with CDC34 as the E2 ubiquitin-conjugating enzyme. The functional specificity of the SCF complex depends on the type of F-box protein. SCF(CDC4) controls the G1-to-S phase transition; it directs ubiquitination of the phosphorylated CDK inhibitor SIC1 and of CDC6. SCF(CDC4) directs ubiquitination of GCN4. SCF(GRR1) directs ubiquitination of phosphorylated CLN1, CLN2 and GIC2. SCF(MET30) directs ubiquitination of MET4. SCF(DIA2) is specifically involved in the pheromone induced degradation of phosphorylated TEC1. SCF(MDM30) seems to direct ubiquitination of FZ01. Involved in the regulation of methionine biosynthesis genes. PTM: Neddylated; enhancing the ubiquitin-ligase activity. Sequence Mass (Da): 93944 Sequence Length: 815 Subcellular Location: Cytoplasm
Q99459
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
Function: DNA-binding protein involved in cell cycle control. May act as a transcription activator. Plays a role in pre-mRNA splicing as core component of precatalytic, catalytic and postcatalytic spliceosomal complexes . Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR) . As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable). PTM: Phosphorylated on serine and threonine residues. Phosphorylation on Thr-411 and Thr-438 is required for CDC5L-mediated mRNA splicing. Has no effect on subcellular location nor on homodimerization. Phosphorylated in vitro by CDK2. Phosphorylation enhances interaction with PPP1R8. Sequence Mass (Da): 92251 Sequence Length: 802 Subcellular Location: Nucleus
Q8SWM6
MSTKVELYMEIGTVITDLEYHTKYMLKKLLGRGAYAQCYLAEIESGEQYAMKVVRLKDIKSRKVHEKLESEIAIHSKLDNPNVVKMYRSFRSSEYVFMVLELCERGALDALLKRNGKLKERHVARFVKQTVEGLIYLHNSVSVVHRDLKLGNLFLDSKFNVKIGDFGLSAVIKDGEKKVTMCGTPNYIAPEVLFGKASGHSFEADIWSLGVIIYTLLVGVPPFQKKNVEDIYKMIKLNNYIFPENCDLSSEAIDLITQILNTNPLERPTLEHILSHKFLSKKEHFLMKIYRNLMTNRTEEGVVDTDYVLFSIPVTKLRGVGYVLKSGVYGIYFSDHRNLMLKPNRKSVIYLNSTIESGKRVFYKEEHLVEKIPAEIAESYKGLQYFIRTFDNGFSFLDVEPCFIVKIRKIECGFLFVMADSTIVFDFVDGWRVVLSRCGERVSCYNGLGLASFNQEIRGRCIEILRGCLGCG
Function: Protein kinase required for the cell cycle where it is involved in mitotic exit. Required to form a bipolar spindle, the actin ring and septum. Functions upstream of the whole septum formation pathway, including actin ring formation (regulated by late septation genes) and septal material deposition (regulated by early septation genes). Behaves as a 'septum-promoting factor', and could also be involved in inducing other late events of cell division (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 54024 Sequence Length: 472 Subcellular Location: Cytoplasm EC: 2.7.11.21
P32562
MSLGPLKAINDKQLNTRSKLVHTPIKGNTADLVGKENHFKQTKRLDPNNDHHHQPAQKKKREKLSALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIPEEQSLVNFKDCMEKSLLLESMSSDKIQRQKRDYISSIKSSIDKLEEYHQNRPFLPHSLSPGGTKQKYKEVVDIEAQRRLNDLAREARIRRAQQAVLRKELIATSTNVIKSEISLRILASECHLTLNGIVEAEAQYKMGGLPKSRLPKIKHPMIVTKWVDYSNKHGFSYQLSTEDIGVLFNNGTTVLRLADAEEFWYISYDDREGWVASHYLLSEKPRELSRHLEVVDFFAKYMKANLSRVSTFGREEYHKDDVFLRRYTRYKPFVMFELSDGTFQFNFKDHHKMAISDGGKLVTYISPSHESTTYPLVEVLKYGEIPGYPESNFREKLTLIKEGLKQKSTIVTVD
Function: Protein kinase required for the cell cycle where it is involved in mitotic exit. A component of the fear (CDC14 early anaphase release) network which promotes CDC14 release from the nucleolus during early anaphase. Phosphorylates SCC1/MCD1 and NET1. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 81031 Sequence Length: 705 EC: 2.7.11.21
O27463
MNIFDEIGDKESVFKDKKYLDHRFLPDRLPHREEQIRSIAKYWVEALNGVTPPDITIYGKTGTGKTAVAKFAMKQLKEASKDCDVNIRTEYIRCTDYTTEYQVIARLCQQLGRDVPYRGWTKAEIVNTFRNMFKKNAFGQDMILMVVLDEIDILLRNDGDGLLYTLTRTDNVSILSISNYVEFKKFIKPRVRSSLRDREIVFPPYGAQQLVDILEERSKMSFKEGALDDDVIPLCAALAAKEEGDARYALDLLRTAGEIADERDSDKVLGDFVREAKDYIEHNKITDIILTLPSQQQRVLEAILYLTKRKEEITSGRLYEVYKEIAKGDSVSYRRIFDFINELEMLGLISTNTVSRGRGKGRTNIIDLQCETSLLEDSLWGV
Function: Involved in regulation of DNA replication. May play an essential role in origin recognition. Binds to DNA, with a preference for origin-specific double-stranded sequences. Does not bind single-stranded DNA. Inhibits MCM helicase activity but does not affect its oligomeric state. PTM: Autophosphorylated on a serine. Phosphorylation is stimulated by binding to MCM. Both single-stranded DNA and double-stranded DNA inhibit the phosphorylation reaction. Sequence Mass (Da): 43875 Sequence Length: 382 Domain: The N-terminal AAA+ ATPase domain and the C-terminal winged-helix (WH) domain are both required for DNA binding.
Q3YL95
MKKKLFALLKYIIFFPMLCTVLGLLGIPIGLIVNFLRTGSFDFNLKDEIDVVLFTLKIGIPIGFILGLGLWGLSILDRK
Function: Immunity protein component of a toxin-immunity protein module, which functions as a cellular contact-dependent growth inhibition (CDI) system. CDI modules allow bacteria to communicate with and inhibit the growth of closely related neighboring bacteria in a contact-dependent fashion. Protects cells against CdiA from the same strain, its cognate toxin protein . Growth inhibition is reversible upon induction of this protein, occurring about 2.5 hours after induction, and requires an energy source . Does not protect against non-cognate CdiA from E.coli strain 563 / UPEC, D.dadantii strain 3937 or Y.pestis strain CO92 . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 8856 Sequence Length: 79 Subcellular Location: Cell inner membrane
Q74RU7
MKNLLYVVLLMAVCILGLLIVGTIFYLFLEVFMYFYVNAPISLESFQFTRLLKMSIYGGGILGLGIGLLRIFKIKGF
Function: Immunity protein component of a toxin-immunity protein module, which functions as a cellular contact-dependent growth inhibition (CDI) system. CDI modules allow bacteria to communicate with and inhibit the growth of closely related neighboring bacteria in a contact-dependent fashion. Protects cells against the CDI activity of CdiA, its cognate toxin protein, but not against non-cognate CdiA from E.coli strains 563, EC93 or D.dadantii strain 3937. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 8719 Sequence Length: 77 Subcellular Location: Membrane
Q54HX8
MGQDNINLNKVDGQPSSPPQEQQQQQQYPPQGYPQQQQYPPQQGYPPQQYPPQQGYPPQQYPPQQGYPQQQPPQQYPAPVGAPQQPYMATQQVVVQQVYVQPTFGVVPVDCICQHCQTRMSTKTSYKSGSMVWLVCVLLIIFGCWLGCCLIPFGIDSLKDVQHKCSHCKKVLYRFDRMSGK
Location Topology: Peripheral membrane protein Sequence Mass (Da): 20589 Sequence Length: 181 Domain: The LITAF domain is stabilized by a bound zinc ion. The LITAF domain contains an amphipathic helix that mediates interaction with lipid membranes. Subcellular Location: Late endosome membrane
Q9H305
MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC
Function: Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner. Location Topology: Peripheral membrane protein Sequence Mass (Da): 21892 Sequence Length: 208 Domain: The LITAF domain is stabilized by a bound zinc ion. The LITAF domain contains an amphipathic helix that mediates interaction with lipid membranes. Subcellular Location: Late endosome membrane
Q00534
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Function: Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation; promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation; prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans. May play a role in the centrosome organization during the cell cycle phases . PTM: Thr-177 phosphorylation and Tyr-24 dephosphorylation promotes kinase activity. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 36938 Sequence Length: 326 Subcellular Location: Cytoplasm EC: 2.7.11.22
Q64261
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA
Function: Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation; promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation; prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans (By similarity). May play a role in the centrosome organization during the cell cycle phases. PTM: Thr-177 phosphorylation and Tyr-24 dephosphorylation promotes kinase activity. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 37028 Sequence Length: 326 Subcellular Location: Cytoplasm EC: 2.7.11.22
G5EFV5
MSRRYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLKEIHHDNIIGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEFLHVHWILHRDLKPNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEELPLPKKQQPQKRSRRLDDDGTRPVRRLNFD
Function: Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Required for maintaining chromosome ploidy. May phosphorylate the large subunit of RNA polymerase II, ama-1. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 38353 Sequence Length: 330 EC: 2.7.11.22
P51953
MALDVKSRAKLYEKLDFLGEGQFATVYKARDKTTNTIVAIKKIKVGHRTEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLLCFMETDLEVIIKDTSLVLTPANIKAYILMSLQGLEYMHNHWILHRDLKPNNLLLDENGVLKLADFGLAKAFGSPNRVYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGSILAELLLRVPFLAGDSDLDQLTGIFEALGTPTEETWPGMSNLPDYVSFKLFPGTPLEHIFSAAGDDLLELLKGLFTFNPCTRTTASQALKMRYFSIRPGPTPGPQLPRPNSSTEALKEKENLLIGIKRKRDSIEQGTLKKKLVF
Function: Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of cdk1/cyclin-B during G2-M transition, and for activation of cdk2/cyclins during G1-S transition (but not complex formation). cdk7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. CAK activates the cyclin-associated kinases cdk1, cdk2, cdk4 and cdk6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (polr2a), allowing its escape from the promoter and elongation of the transcripts (By similarity). PTM: Phosphorylation of Ser-163 during mitosis inactivates the enzyme. Phosphorylation of Thr-169 is required for activity. Phosphorylated at Ser-163 and Thr-169 by CDK2 (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 38510 Sequence Length: 344 Subcellular Location: Nucleus EC: 2.7.11.22
P54685
MDKYNIEALIGEGTYGVVSRATVKATGQIVAIKKIRKILIQNQTDDGINFSAIREIKILQELKHDNVVNLLDIFAHKSNVYLVFELMQWDLQEVIEDKSIILKPADIKSYMKMLLQGIEACHRNWVLHRDLKPNNLLMSINGDLKLADFGLARQYGSPNKVFSPQAVTIFYRAPELLFGAKSYGPSVDIWSIGCIFAELMLRTPYLPGTGEIDQLRKICSALGTPNESNWPGVTCLPNYIKFTDHPATPFKQLFTAASDEAIDLISKMLLFNPSNRISAADALNHPYFTSGVKHTNPADLPVPFAKKASLLQQRQVLAQVQQQLLQKQQQQQQQQQQQIQSQPEPIQVDNVEQTQQAQQV
Function: Catalytic part of CAK which activates cyclin-associated CDK1/CDK2/CDK4 by threonine phosphorylation, thereby allowing MPF activation. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 40567 Sequence Length: 360 Subcellular Location: Nucleus EC: 2.7.11.22
P50613
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Function: Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts . Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition. PTM: Phosphorylation of Ser-164 during mitosis inactivates the enzyme. Phosphorylation of Thr-170 is required for activity. Phosphorylated at Ser-164 and Thr-170 by CDK2. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 39038 Sequence Length: 346 Subcellular Location: Nucleus EC: 2.7.11.22
P20911
MEGIAARGVDVRSRAKQYEKLDFLGEGQFATVYKARDKNTDRIVAIKKIKLGHRAEANDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDTSLVLTPAHIKSYMLMTLQGLEYLHHLWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRIYTHQVVTRWYRSPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPGMSSLPDYVAFKSFPGTPLHLIFIAAGDDLLELLQGLFTFNPCARCTASQALRKRYFSNRPAPTPGNLLPRPNCSIEALKEQQNLNLGIKRKRTEGMDQKDIAKKLSF
Function: Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of cdk1/cyclin-B during G2-M transition, and for activation of cdk2/cyclins during G1-S transition (but not complex formation). cdk7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. CAK activates the cyclin-associated kinases cdk1, cdk2, cdk4 and cdk6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (polr2a), allowing its escape from the promoter and elongation of the transcripts (By similarity). Involved in negative regulation of the meiotic maturation of Xenopus oocytes. PTM: Phosphorylation of Ser-170 during mitosis inactivates the enzyme. Phosphorylation of Thr-176 is required for activity. Phosphorylated at Ser-170 and Thr-176 by CDK2 (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 39691 Sequence Length: 352 Subcellular Location: Nucleus EC: 2.7.11.22
P0C661
MIDENFKKKLAVSRERVEDLFYFENSKEIGRGTYGLVYKAVPKHSNGRFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHVIKHHRTAKTKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHRDLKPANILLMGDGGPDMRGRVKIADLGFSRIFANPLKPMAELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDTDWPDMKKMPDHQRLLNDARNEGTPIQTFPNSLQRYFDKWKINSQSSPYRLLVKLLTVDPLKRVSCEEAMNDIYFRKMERPPRETDDVFNRYPIPYAKKEQQITIPIDQFQQQQQQQQQQQQQQQQQQQQQQQQQMQQPQIGPPQMMGQPQMGQPQMGQPQMGQPQMGQPQMGQPQMVPSQMGQPPMGGPHPGVVAPDGHAHQMMQQQHQSQHHMQYQQMHDSMQGGMDDGGPQAKMMRMGNVPVGRYGPMGPPYGPQDFHAPQGPPMMQMMPQPGPSGYYQQRPGQPPGPGPQGYMNPQMGMTMGMRPQGVPQQAYMPGRGMPPPQGPNPQQQQQWQQYHR
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 70642 Sequence Length: 612 Subcellular Location: Nucleus EC: 2.7.11.22
P90866
MTLMIDENFKKQLAQRRERVEDLFYFENSKEIGRGTYGLVYKAVPKKQNGQFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHVIKHHRTAKSKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHRDLKPANILLMGDGPPDMRGRVKIADLGFSRIYANPLKPMAELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDADWPDMKKMPDHQRLLSDARNEGTPIQTFPNSLHRYFDKWKINSQSSPYRLLVKLLTVDPTKRVSCEEAMNDIYFRKMERPPRETDDVFNKYPIPYAKKEQQMTVAPDQAQQQHQQQQVQMQQQPQMGQQQMMGQPQMVQPQMGQPPMGGAHPGVVAPDGHPHQMMQQQQHPQQHHMQYQGMHDPMQGGMDEGPQAKMMRMGNVPVGRYAPMPPPYGAPQDYHPQQGPPMVQMMQQPGPSGYYPQRPGQPTGAVPGPGPQGYMNPQMGMQMGMRAPGVPPQGYMPGRGMAPPQMGQQQPGPNQQQQQQWQQQYHR
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 67785 Sequence Length: 588 Subcellular Location: Nucleus EC: 2.7.11.22
Q95YH0
MNTHNQSSNQNGGGSGGGGGGGGSSTFSPIVLTSTYRLDVQEKYTFSYEIGSGTYGMVYKADDKKRPNNKVAVKKFRSTKEGEGLSLTAYREIGLLKELSNENIVKLLDVCLNPKDKLLYLIFDYAEFDLFGIIKYHRENGSHFSDATIKSLIWQVLNGIHYLHSNWVIHRDLKPSNILVMGEGKECGTVKIGDFGLARIFQSPLKPLNENGVVVTIWYRSPELLLGSKHYTRAVDIWAIGCIFAELITTKPLFPGKEKDPKIPSLFQDDQVEKIIRVLGKPTLDMWPDIKHLPEWKRLSSMEAFPNSLAKCVGIDENSQAYDLLSKMILYDPSKRITASEALDHPYFKELPLPLPNAFSKPIPYPPRLPINKKKREFDD
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity). Involved in cell aggregation, but not growth. Required for starvation-induced expression of genes essential for early development of acaA and/or other genes. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 42771 Sequence Length: 380 Subcellular Location: Nucleus EC: 2.7.11.22
Q9VT57
MDYDFKMKTQIERTKVEDLFNYEGCKVGRGTYGHVYKAKWKETSDGKEYALKQIDGTGLSMSACREIALLRELKHQNVITLIRVFLSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEHHTLTKDFKRSTYSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYFQEEPQPTQDVFAGCPIPYPKREFLTDDDQEDKSDNKRQQQQQQQQQQQQQQQQQQQQQQQQQQQQMNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQQQQQQQMMFNQQQNFQRFN
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. May phosphorylate the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex. Required for leg and eye development and macrochaete specification or differentiation. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 53682 Sequence Length: 454 Subcellular Location: Nucleus EC: 2.7.11.22
P49336
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex. Phosphorylates CCNH leading to down-regulation of the TFIIH complex and transcriptional repression. Recruited through interaction with MAML1 to hyperphosphorylate the intracellular domain of NOTCH, leading to its degradation. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 53284 Sequence Length: 464 Subcellular Location: Nucleus EC: 2.7.11.22
Q8R3L8
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLLKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDEKGDKKTQQQQQGNNHTNGTGHPGNQDSGHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex. Phosphorylates CCNH leading to down-regulation of the TFIIH complex and transcriptional repression. Recruited through interaction with MAML1 to hyperphosphorylate the intracellular domain of NOTCH, leading to its degradation (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 53210 Sequence Length: 464 Subcellular Location: Nucleus EC: 2.7.11.22
Q66KH9
MDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDRDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDFAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDKDWEDIKKMPEHSTLIKDFRRNTYTNCSLIKYMEKHKVKPDSKTFHLLQKLLTMDPIKRISSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDNSHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYQNPGPSTSQPQSSMGYTSTSQQPPQYSHQTHRY
Function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity). Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 47763 Sequence Length: 416 Subcellular Location: Nucleus EC: 2.7.11.22
A1RXB2
MRISVYACFLGLYFLVFSLIVYVILGAEFLVSVLQPGNVARSMLWVLPAYVANASPVVFSRLVRKRWRLHPMDFGLTFVDGQRLLGDNKTFEGFLGGMLSGVLVGILLAYARFVDGVSAFLLPLGALLGDLGGAFVKRRLRIKPGEPAILLDQLDFVAGALILQGLFSKLPAAEVVVAVVLLTPIVHLLTNMAAFVLGLKDVPW
Function: Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction is the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids. Catalytic Activity: 2,3-bis-O-(geranylgeranyl)-sn-glycerol 1-phosphate + CTP + H(+) = CDP-2,3-bis-O-(geranylgeranyl)-sn-glycerol + diphosphate Location Topology: Multi-pass membrane protein Sequence Mass (Da): 22173 Sequence Length: 204 Pathway: Membrane lipid metabolism; glycerophospholipid metabolism. Subcellular Location: Cell membrane EC: 2.7.7.67
Q9KVL2
MFTVSRLIPDLASANQVLETMDLPHGQSILVQIFSPLSREHVVQLARLIRSRHPQACLLGCSTEEVIFQGEVHHQVTLLQITVFEQTYLSRAVVDYSDDEAADAERLARQLELTSMSRAVVCFSWQMDTLQVARFALRDTQGAPVPVAGGAAKQTPSGRWVLLDEACYQNASVAIALHGEALYVETGGYTEWQPVGRTYRVTAVEGDRVLRLDDEPIEAIYQRNLGAQADLPHDWLISFPLMKGECRHQDLYLPLGLAEEGGLRFNRPLALQDEVRFCFDHPSLTLERVYLTAQQLQAKQCQQVWVFNCALRLNFMHENHELQPLQAVAPTDGCYCWGELLYEHGQQQVMHHSMTFLALREGAVRDDLVPIPLPSYPEGMTSPLFNLIRHAFHDLDAMTDNLAQQIRAQTSLLTASYRRDRRTGLPNRVVLRERLANFAANEHLIALKVTNFNQINEKYGYPVGDKLLRDLSEQFQVFLDQKLAGQSGLYAIGVGEWATVFRAKLDGKSIHSHFYQFVEQLEHVNFEPYGLPNVDYLSISLCAGLVSQGDFAEHSPDELLLRAIEARRYAFNNNHHFCNAARLKVQESVRQERLNWLSRVSRAVVRDDVVVYAQPICQARSHIVASYECLVRIEDEGEIILPGNFLPIITDTHLYTRLSRQMITHTFNMMRHRPEAFSINLSPQDLMSERTLQHLEAAIKSVADPARVGLEVLESEQIKDYGRMIEVCNHFRTLGATIIVDDFGSGYSNIDEIVKLEPQVIKLDGSLIRNIDQDVKQRRIAEQLVKLCQVLNAKTVAEFVHNQTVCRISEDMGVDYLQGYFLGRPSRLG
Function: Phosphodiesterase (PDE) that catalyzes the hydrolysis of cyclic diguanylate (c-di-GMP). Is involved in the modulation of intracellular c-di-GMP levels. Cyclic-di-GMP is a second messenger which positively regulates biofilm formation and negatively regulates virulence in V.cholerae, and is proposed to play an important role in the transition from persistence in the environment to survival in the host. CdpA functions as a repressor of biofilm formation but has no effect on colonization of the infant mouse small intestine. Does not possess diguanylate cyclase (DGC) activity, due to its inactive degenerate GGDEF domain. Catalytic Activity: 3',3'-c-di-GMP + H2O = 5'-phosphoguanylyl(3'->5')guanosine + H(+) Sequence Mass (Da): 94055 Sequence Length: 829 Domain: The EAL domain is required for c-di-GMP PDE activity, and the degenerate GGDEF domain is required for full PDE activity of the EAL domain . The GG(D/E)EF motif in CdpA is degenerate, having the sequence GVGEW. EC: 3.1.4.52
Q9HWS0
MLKRIPVTQLRLGMFVQSLCGSWLDHPFWKRGGFLLDSQADLQRLRESAVKEVWIDASKGLDLPEEAAVSAAAVLPVTMPAGPSPARVALEEEIRHAALLCSRAKAAVVSMFRDARMGQAIDTAHASDLVDEISASVLRHPNALLSLVRLKTSDEYTYMHSVAVCALMIALARQLELPDPLVREAGLAGLLHDIGKMAVPDPILNKPGKLTDPEFGLVRRHPQNGARMLLDCRQVSALVVDVCLHHHERIDGTGYPFGLAQEQISLLARMGAVCDVYDAITSDRPYKKGWNAAEAIRRMAEWNGHFDPQVFRAFVKAVGIYPVGALVRLESGRLGVVLEQHGRSLLTPRVKVFFSARSKVPIPQQVVDLGRAGQTDRIVGFEPAEAWNFRNLDEMWTGLAKSTGSYFDAGTGNP
Function: Phosphodiesterase (PDE) that catalyzes the hydrolysis of cyclic diguanylate (c-di-GMP) to GMP . Hydrolyzes c-di-GMP to GMP in a two-step reaction, via the linear intermediate 5'-phosphoguanylyl(3'->5')guanosine (pGpG). In vitro, can use pGpG as an alternative substrate and hydrolyze it into GMP . Acts in regulation of motility, synthesis of virulence determinants and biofilm architecture . Catalytic Activity: 3',3'-c-di-GMP + 2 H2O = 2 GMP + 2 H(+) Sequence Mass (Da): 45419 Sequence Length: 414 EC: 3.1.4.-