ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
Q820U0
MEKVLVIVGPTAVGKTALSIALAKKFNGEIISGDSMQVYRSLDIGTAKVTETEKEGIPHYLIDCREVSETYSAADFQKEGRQKIKEITEKGKLPIIVGGTGLYIQSLLYDFQLGSREIDDSPEIRETYNLFAEEKGNQALWLLLQQKDPLAANSIHFNNRKKVIRALEVFDKTGYSILTPKEKPARLYDYYLLGLETDRALLYERINQRVDQMMTEGLLEEAKQMFQQPHAQAAQGIGYKEFFPYFSGEQSLEMAVETVKQQSRRYAKRQLTWFRNRMAAHWWNLVQQPTDLPKLEKEVAEWLQQKESE
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35568 Sequence Length: 309 EC: 2.5.1.75
B0S1C3
MRKKCIVIVGPTGVGKTRLSIFLAKRLSSEIISADSMQIYKYMDIGTAKVEPKYQRVIKHHLIDIVEPYENFNVEQFKNLCIEKIEEISSKNKIPIIVGGTGLYINSITHKLEFNAVKSDDKLREELENISLQYGNEKLHEILEDIDPKSADKIHMNNVRRVIRAIEVCKLTGHKFSEINDKFDHYNDDYDFYIIGLNDDRQVLYERINKRVDEMIDEGFMAECKYIYEMTDENSQSIQAIGYREAFMYLNNKISFKDMISLMKKNSRKYAKRQLTWFRQDKRIHWMNLKDFREFEDIEQICLKNVKEWLYDKR
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 37372 Sequence Length: 314 EC: 2.5.1.75
A6H0V8
MNYLITIIGPTAIGKTSLSIALAKQYNCDIISCDSRQFFKEMRIGTAVPSDEELSQATHHFIQNKSIFEEYTVGDFEKEAITKLDELFSKNNIQIMVGGSGLYADAVLKGFDSFPNIKPEIREKIQEQYDENGIQYLQQKLQELDTEYYSKILSQNPQTLQNPQRMMRFVEVCLGTGKPYSSFLNKDKITRNFTTIIIGLEADREIMYDRINQRVDIMINEGLLAEAEKLYPNKDLNALQTVGYRELFSFFDADFTLNFAIEEIKKNTRRFSKRQITWFKRTENTIWFDYKADTSKIIEVINTKMKH
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35718 Sequence Length: 307 EC: 2.5.1.75
B0TZB0
MNKLIYGLAGPTASGKTSLSISIANKINAEIISVDSSLVYKGMNIGTAKPTLDEQGDIKHHLIDIIEPTESFSVADFITNVNKLKKEIWSRGKEVLLVGGTMLYFKGLIEGLSSLPESQLEIRQTLELERKAKGLQYLHQQLNKMDQESAQKINPNDQQRIFRALEVIMITGKKYSELVKTSKVGGLEEQLKLCALVPNDRSILHNNIELRFKQMLDQGFLDEVQSLRKNPKLTKETTAIRSVGYRQAWEYLDGDISYEEFVKKGIVATRQLAKRQLTWIRNWQDEINLVEVENQNKEQQILEYFDYK
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35218 Sequence Length: 308 EC: 2.5.1.75
A2BZ20
MLPSKPLVIVLIGPTASGKTELAIDIAKYFNIHIHNVDSRQIYRFMDIGTAKPTKVQQRAIKHFLIDVEDPSVKVNAKQFQEIATKSINRELNQKKTPFLVGGSGLYMNSIIKGFFAPDVPPQSFLRSQFEKLGQEKCWELLKVCDPELTKTINYADQIRTIRGLEVFYVTGKRMSSQRFQNPPPWRILELGINRVDLKERIFKRTKNMFEFGIIEETKNIINQYGSTLPLLETIGYKEAKNVIKENLTIEEAIELTTTKTIQFAKRQKTWFRNKNNAIWLNNKNLLKDAIIKIEYALG
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 34492 Sequence Length: 299 EC: 2.5.1.75
Q7TV89
MQNPKPLVIVLLGPTASGKTDLAIQIAKKIKVSIHNIDSRQLYKGMNIGTAKPTIEQQEEIKHYLLDLKDPNNPITLHEFKKEAELSLKNIFSKEKCGFLVGGSGLYLKSLTSGLCPPSVPAQEKLRKEFRRLGQKECHQILKKCDPIAWEKISPRDSIRTIRALEVFYSTGQTISSLKTLKPPDWNLLELGLDPRNLQQRIAKRTKILFQKGLIDETKALIHQYGEDLPLLQTIGYKEACTVIKGEYSITEAIEITTQRTNQFAKKQRTWFRRQHNPKWLNEKNSLEEALSLIQNVIG
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 34078 Sequence Length: 299 EC: 2.5.1.75
Q15NR1
MNQHTDNQQLPPAILLMGPTASGKTALAIELCQALPCEIISVDSALIYKGMDIGTAKPTAEELAQAPHRLIDILDPVQSYSVAEFRRDALAAMQDITQRGRIPLLVGGTMMYYKALTDGLSTLPQADPLVRAEIEKQAEKNGWQALHQELQGIDPVSAQRIHPNDPQRLSRALEIYRISGKSMTELSLNKQPSAPYQFSQFAIAPSDRHILHDRIAQRFDIMLNSGFEDEVIELKSRADLHLDLPSMRCVGYRQMWQYLDGENIYQEMREKGLAATRQLAKRQLTWLRSWQNLHWLDTFSKDNLTNVMKLSRIRT
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35733 Sequence Length: 315 EC: 2.5.1.75
Q0IDZ4
MNQINSEFGPDAGAKAPLVVALVGPTASGKTALALELAEHFQLEILNIDSRQLYREMDIGTAKPTAEQQQRVTHHLLDLRSPDQPITLQEFQQEATAAVSQVLKERGVAFLAGGSGLYLKALTQGLQPPAVPPQAELRRQLSSLGQANCHQLLQQADPQAAAKIAPADAVRTQRALEVLYSSGKPMSAQQSTNPPPWRVLELGLNPMELRSRIAQRTLQIYQEGLLEETRQLSQRYGPDLPMLQTIGYGEALEVLQGGLSEAQAIATTTRRTQQFAKRQRTWFRRQHSPHWLTGQDALSEAIRLIEAGLG
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 34056 Sequence Length: 310 EC: 2.5.1.75
Q0AYB0
MYKLAAIVGPTAVGKTNISLEVARQINGEIISCDSMQLYRGMNIGTAKASKEEQNIVAHHLIDIADPHENFTVARYQSLVKDLISTINARGKIPILVGGTGLYYQSVVDDYTFFPMEVRQSIRDKWNAIIQEKGLPHVYRLLEQIDPAYAQIISPNDQKRVVRALEVYELTGKAFSTLQDRAENTYYLAVVGLYLERRELYARIERRVDEMIKKGLIEEVAALREKGIDLSYNSMQALGYKQVFYFLEGFINREELLNEIKRETRRYAKRQLTWFKKDQRIKWFNVGDFSDEELLVKNICTFMEGQFGIV
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35812 Sequence Length: 310 EC: 2.5.1.75
P74040
MAKVPPLIVICGTTASGKSQLALDLAQRLNAVILGADSRQIYKELDIGTAKPTLGDRQTVPHYLIDICEPTENFTLAEYQRQAQELIASLNQPILLVGGTGLYIQAIVKGLKIPAVPPQTNLREQLANLGQPFCYQLLSQVDPVAQSKIEPADVVRTLRALEVFYATGRPISSLQGENPPSYPIVQIGLGLEPEQLQPRIVHRTHAMVEAGLVKEVEGLINQYGEDLPLLHTLGYAEIKQYLQGQISLTQATESIIVHTRQFAKRQRTWFRKDSAIHWFDANQPNLLDSVTKLVQVDVNEGMF
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 33562 Sequence Length: 303 EC: 2.5.1.75
A6LMU4
MKYTIISGPTAVGKTDLIIEISTKIGAQIISLDSRQIYKLMDIGTAKPTKEEQQKVKHHLIDHIYPDEYYNAFYFRQDALKLRKQLTKKGIIPLFVGGTGLYIDALVKGFFEGAPKDENIRKHLNKLEKKEPGTLRTMLQKYDPEYALKIHPSDMKRTIRALEVFFKTGKKISELQSQTKISNKYKIIVLTRNRQELYERINTRVEKMIKAGLIDEVEKLLELYPKDINAFQTIGYKELIHYFENKYDLKTAIHLIKRNTRHFARRQLIWLRRYKNAIWINLSEISRRETIEKIEKIINEV
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35500 Sequence Length: 301 EC: 2.5.1.75
Q9WYZ5
MKIAIVGGPTAVGKTDIMIEVCEEIGAEIISMDSRQIYRYMDIGTAKPTPEQRKRVLHHMIDIIDPDEYYNAFMYRKDSLRAMEDVLRRGKIPVYVGGTGLYADALVRGIFEGVPADENIRKELRELERREPGILRKMLEELDPEAATRIHPNDLKRTIRALEVYMKTGRRISELQKEAKGDDRFFIIVLTRERYELYERINKRVDKMIEMGLVDEVKRLLGMGYSKDLNSMKTIGYKEVIDYLEGKYDFDKMVHLIKRNTRHFARRQIIWFKRYKEAVWYNLTFEDVGEVKEKLKKLIVENFSV
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 35926 Sequence Length: 305 EC: 2.5.1.75
B9L505
MNKRKPVVALVGPTSVGKTATAIELALTFGGEVVSADSRYLYRGMDIGTDKPTLEERRGVPHHLIDILDPRDDYSLALFQRDAQRAIEEIHARGRLPIVAGGTPLYLRALLEGWRIPPAPPNPELRAQLELRARREGPEALHRELQTVDPVAAARIPPENVRRVIRALEIFLTTGRRMTELEGREAPPWRVLWLGLTMPRDELYRRIDERVDRQVARGLVEEVQRLLEQGVPPDAPAMTALGYRQIVAFLTGQLSLEEAIQRIKYDTHRYARHQLTWLRRMKQVEWYDVTQPGWYEQLRERVERSLREESDEGDVAVHQSGGGKEAPRA
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 37580 Sequence Length: 329 EC: 2.5.1.75
Q5SKS1
MEAIPVLAGPTGSGKTFLALRLGEEVPVEVVSADATMVYRGLDIGTDKPTPEERARVPHHLVDVLEPHEAMSVARFLALAEEAIAHVLSRGKLPLVVGGTGYYIRALSEGLHDLPPPDPGVQEALWAELEARGLEALLAELARASPEDARRVGKNPRRLVRALEVLRRTGTPPARFPKRPPRFRYKKLVLWPDRAWLFPRLEERAKAQFARGLVEEVRGLLERYPRMPTALQAIGYKEVAGHLLGAYGLEEALERDIRAVKAYAKRQYTWFRHEPGDVVYLPRGGEEAYVGFRDWLCLHFGL
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 33811 Sequence Length: 302 EC: 2.5.1.75
B5YK93
MKRKIVILLGPTGVGKTELSIKIAKLLNAEIISSDSMQIYKYMDIGTAKPTLEQRKEVIHHMIDIVNPWDYFSTGAYIEIVKEVIEKIFEREKIPLVVGGTGLYLRAMTEGIFEGPDADWNLRMELMNKERDNPGFLYNLLKEIDPIKADKIYPSDLRRILRALEVFFKEKKQISELQEKLTKPLSYNFIKIGVTRERKELYRIIEERVDKMICSGLIEEVRNVLTLIKRNATSLSPLPALQAIGYKEIAGCLADLYSIDEAVRLIKKRTKMYAKRQFTWFRKEKDIMWFDISGRHDFEIIAEQIYSALSEILHK
Function: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Catalytic Activity: adenosine(37) in tRNA + dimethylallyl diphosphate = diphosphate + N(6)-dimethylallyladenosine(37) in tRNA Sequence Mass (Da): 36666 Sequence Length: 315 EC: 2.5.1.75
Q3B6A6
MPEGRRFYIQTFGCQMNEADSGIIARVLLDAGFRRADTEQDADVVLLNTCAVRENAVEKIAHLLEHLKGAKKRRKTLQVGVLGCVPQHQREEMFSRFPAIDFIAGPDSYRRLPSLIDDAASAVRSAMLDFDPSETYVGIRQVREGRISAFIPVMRGCNNMCAFCVVPFTRGRERSQPLAMVTGEARELAEAGYREITLLGQNVNSYSDPASGATFSALLDAVALAAPDVRIRFTTSHPKDISVGLIDTIARRPNICRHVHLPVQSGSDSVLRRMNRGHGISEYLEKIRIIRDALPGVTLSTDIIAGFCGEREEDHRATLDLLRTVRFDAAFMFHYSTREGTLAARTLPDDVAETDKKRRLQEIIDLQQEISAENNRRQVGTVAEVLAESESRRSPGRLLGRTDGNRAVVFDRGECMPGDLVRVRLTSSTSATLSGSREGLIRAFLS
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 49431 Sequence Length: 446 Subcellular Location: Cytoplasm EC: 2.8.4.3
Q8KB05
MRQRMSRMPSSFYIHTFGCQMNQADSEIVTALLRAEGFVPSADETNADIVLLNSCAVRENAEERLGNILMHLKGRKRRCKELVIGVLGCVPQFERERVFSDYPFVDFIVGPDNYRELAGLVAGLREAVARPALLDYDQTETYAGIEPVRAGSISAFLPVMRGCNNHCAFCVVPVTRGRERSVGFERVVAEVVALEKAGFREVTLLGQNVNSWRDAEKGLDFAGLLEGVSLAVPSMRIRFTTSHPKDISEALVKVIAARPNLCNHIHLPVQSGSSRMLDLMKRGHTREEYLDRIAMIRSYIPEVAITTDLIAGFCTETEKDHRETLSLMEAVGYDTAFMFHYSVRPGTWAARNLPDDVPDTVKKARLQEIIELQNAISREIFQREIGKTVEVLAEAESKRSESMLMGRTPENRVVVFSRGRFNPSDTLLVKITGATSATLSGEAV
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 49472 Sequence Length: 444 Subcellular Location: Cytoplasm EC: 2.8.4.3
A8AJE9
MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGDHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGADRVLNLMGRTHTALEYKAIIRKLRAARPDIQISSDFIVGFPGETTQDFEQTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTVQRILVEGTSRKSIMELSGRTENNRVVNFEGTPEMIGKFVDVEITDVYTNSLRGKVVRTEDEMGLRVAETPESVIARTRKENEIGVGFYQP
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 53646 Sequence Length: 474 Subcellular Location: Cytoplasm EC: 2.8.4.3
B2A3X6
MTLYQLGNGKKFYTLTFGCQMNEHDSEVLAGMLDQMGFEKAASEEEADLLIINTCAVREKAEQKVLGKIGTLRYLKENKPDMKIAIGGCMVQQEHVANKIYRDFTHVDIIFGTHNINRFPQLLEHVMQKGKRVKEISQDDSQVFENLPHKREDSIKAWVVISYGCDNYCKYCIVPYVRGQQRSRDPEHIKYEVEKLAKEGLKEITLLGQNVNSYGKDLDQNISFTNLLEELSKIEGIERIRFMTSHPKDFDKELITTLKESNKICEHFHLPVQAGSNKILKKMGRGYTREHYVDIVNDIRAELPNASITTDIIVGYPGEEEEDFQETLDLVQNVKFDSAFTFVYSKRSGTPAAEMAEQVDEQTKKGRIQKLISVQQEISEQRNKDLENTVQRILVEGVSKNNEDMLSGRTRTDKLVHFPGDKELIGELVDVKITRGHSWNLYGEIFEDSLT
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 51725 Sequence Length: 451 Subcellular Location: Cytoplasm EC: 2.8.4.3
D5ZT17
MSSIDRSQSVGGTRTYEVRTYGCQMNVHDSERLAGLLEDAGYVRAPEGSDGDADVVVFNTCAVRENADNKLYGNLGHLAPKKARRPGMQIAVGGCLAQKDRDTIVKRAPWVDVVFGTHNIGKLPVLLERARVQEEAQVEIAESLEAFPSTLPTRRESAYAAWVSISVGCNNTCTFCIVPALRGKEKDRRPGDILAEIEALVAEGVSEITLLGQNVNAYGSDIGDREAFSKLLRACGRIDGLERVRFTSPHPRDFTDDVIAAMAETPNVMPQLHMPLQSGSDAVLKAMRRSYRQERYLGIIEKVRAAIPHAAISTDIIVGFPGETEEDFEQTLHVVREARFAQAFTFQYSKRPGTPAAEMDGQIPKKVVQERYERLVALQEEISWEENKKQVGRTLELMVAEGEGRKDDTTHRLSGRAPDNRLVHFTKPEQEVRPGDVVTVEITYAAPHHLLAEGPVRDVRRTRAGDAWEKRNAAEAAKPAGVMLGLPKVGVPEPLPAVTGGCAVD
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 55465 Sequence Length: 505 Subcellular Location: Cytoplasm EC: 2.8.4.3
Q67NJ9
MAQMQIDPEAGRRIHGKPEPRVHIETFGCQMNEHDSEIMYGILAQMGYVKAQGPDDADLLLFNTCAVRESAVEHAFGRIGQLKPLKYTNPDLIIGVCGCVPQVEGQVERIKRMFPYLDLIFGTHNIHRLPELVERARSERETVVDVWESMGDDFPDILPAAREGDLKAWVTIMYGCDKHCTYCIVPTTRGKERSRPYEVILAEVQELARQGFKEITLLGQNVNAYGKDLYGRHGEGAFDFGDLIELIDRNSPGIERIRFTTNHPKDFTRKMVEQIARAEKVCEWFHLPVQSGSDSVLRRMKRSYNRKQYLRLVGWIRELIPDAVITTDIIVGFPGETEEEFQETLSLVEEVQYDAAFMFMYSERAGTPAAQMEDRLSVPEKKERLQRLMEVQNRIARAKNEARVGKVYDILVEGLDKGKPDVVFGWTRGNILVTFPGDESLRGRIVPVRITRAGTWTLEGELVESPVTLA
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 53517 Sequence Length: 470 Subcellular Location: Cytoplasm EC: 2.8.4.3
Q2LT94
MMKSSNKSSGSLIRLDKKHIYIQTLGCQMNVHDSEQIAALMEEKGYICTEDANEADLIILNTCSIREKAAQKAKSQLGRYRNLKRKKRNLLIGVGGCLAQQLGDELLTKVPDIDFIFGTHNIHQLPDFISRIEKSRKKIVETTLHPSTPSIGVLALPCNGQVSSFVTIMQGCNNFCSYCIVPYVRGREESRPPEDIIHEIRMLADHGVKEVTLLGQNVNSYARKTSGEMGFAELLREIEKIKGIERMRFTTSHPKDLSEFLITAFSDLSKLCHHIHLPFQSGSDRILALMNRGYTKSDYLAKVERLRTVCPDISITADVIVGFPGESDEDFKETIDMMNQIRFDNLFSFKYSEREGTAAVKMDGKVSEPLKLERLQILQALQEQHTLEKNKAMEGKQEDVLVEGFSKNCRKDLTGRTSTNKIVNFSGCVDLIGDMVSVLIKEAYLHSLRGEMLCEEVVHAN
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 51938 Sequence Length: 461 Subcellular Location: Cytoplasm EC: 2.8.4.3
Q3A594
MKSFYLETFGCQMNVVDSEQIVGLVQSLGYSSVDSPEQANLIILNTCSIRARAERKVYGHLGRFKPLKQRRPELIIAVCGCVAQQEGQRMLEKVPYLDIVCGTHNIHRLADMVRDAELHRARHVEVDFLEADKRRRLFPERAPSAEVSRFVTVIQGCDNFCSYCIVPHVRGREVSRPSAEVLEEVRLLVEQGAREITLIGQNVNSYGCKEDDEISFASLLRKVAEVDGLERIRFMTSHPKDLSDELIDCFADLDKLCKHIHLPVQAGGDAVLKAMRRGYTRDQYLGRIERLRRVCPEIRMTSDVIVGFPGETESEFEQTMDLLERARFTEIYSFIFSARPGTSAADLPDDIPKEVKQQWFDRMLALQEEITRQYHQMDIGQVLPVLVEGSSRQGNGQLFGRTTWNRIVNFDGNPDLVGRIVPVRLTVAYRNSHLGERV
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 49911 Sequence Length: 438 Subcellular Location: Cytoplasm EC: 2.8.4.3
A0LFB7
MITPLAKTAPAPRYLYVRTFGCQMNEYDSQRALRLLCAVGYRPTSDIADADVIFLNTCSVRDKAEQKVYSFLGRLRRLKAHRPWLKIVVAGCVAQQLGDGLLKRFEHVDLVVGTRGIGSIASLLEEVERSKRRVAHLPAEELQGFTTDKCRTVGTGDVVAQVTIMQGCNNFCTYCIVPHVRGRERSRAPDDILREIDFLASRGAREVLLLGQNVNSYGRGLPDPISFPDLLRRIGKETSIRRVRFTTSHPKDLTEDLIECFAGLPFLCKHLHLPFQSGSDGILKLMHRGYTARQYLEKIARLREVCPEIALSTDVIVGFPAESEEDYLQTLRLIEEVRFDSLFSFRYSDRPLTRAAGFPDKVPMDVKVRRLARLQSIQADITLQKNLAETGTVREVLVEGPSKASNGQMTGRTQQNRIINFQCPVDLTGKIVPVRIVAAYSHSLKGELLSQPGKES
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 51141 Sequence Length: 456 Subcellular Location: Cytoplasm EC: 2.8.4.3
A5GML6
MLPSRERGSYWITTFGCQMNKADSERMAGILESMGYREASAELDADLVLYNTCTIRDNAEQKVYSYLGRQAQRKRTNPNLTLVVAGCVAQQEGESLLRRVPELDLVMGPQHANRLETLLQQVDSGQQVVATEEHHILEDITTARRDSSICGWVNVIYGCNERCTYCVVPSVRGKEQSRLPDAIKLEMEGLAAQGFKEITLLGQNIDAYGRDLPGITPEGRRQHTLTDLLHHVHDVEGLERIRFATSHPRYFTDRLIDACADLPKLCEHFHIPFQSGDNDVLRAMARGYTVERYRRIIDRIRERMPDASLSADVIVAFPGETDAQYRRTLALIEEIGFDQVNTAAYSPRPNTPAADWDNQLPEDIKVERLREINALVERCARERNGRYAGRVEEVLAEGINPKDPSQLMGRTRTNRLTFFSATGADDRRYQAGDLVNVHIDAVRSFSLSGTPLNC
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 51251 Sequence Length: 454 Subcellular Location: Cytoplasm EC: 2.8.4.3
Q0IC70
MALSSPVSPSLAKTNPASSTLDEGQRGSYWITTFGCQMNKADSERMAGILETMGYQEANAELDADLVLYNTCTIRDNAEQKVYSYLGRQAIRKRTNPNLTLVVAGCVAQQEGESLLRRVPELDLVMGPQHANRLETLLTQVQAGQQVVATEDHHILEDLTTARRDSSTCAWVNVIYGCNERCTYCVVPSVRGKEQSRLPESILLEMEGLAARGFKEITLLGQNIDAYGRDLPGITAEGRRQHTLTDLLHQVHDVEGIERLRFATSHPRYFTERLIDACADLPKVCEHFHIPFQSGDNELLKAMARGYTVERYRRIIDRIRKRMPDAAISADVIVAFPGETDAQYRRTLALIEEIGFDQVNTAAYSPRPNTPAADWNNQLSEEVKVARLQEINALVESTAKERNARYAGRIEQVLAEGMNPKDPSQLMGRTRTNRLTFFSAESPQGITHRAGDLVDVRIDQVRSFSLTGTPVIN
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine. Catalytic Activity: [sulfur carrier]-SH + AH2 + N(6)-dimethylallyladenosine(37) in tRNA + 2 S-adenosyl-L-methionine = 2-methylsulfanyl-N(6)-dimethylallyladenosine(37) in tRNA + 5'-deoxyadenosine + [sulfur carrier]-H + A + 2 H(+) + L-methionine + S-adenosyl-L-homocysteine Sequence Mass (Da): 52834 Sequence Length: 473 Subcellular Location: Cytoplasm EC: 2.8.4.3
P91928
MYRLAVRDQCKCALQRTLQQTTANNRQFGGSSSGSGGREQGRRQQEEQGQQGDQGYQGYQSLPPHMREAGFGKVVLFVSPLAAVGGVITYAKYDDDFRKLVEKNVPGAGSVIKVALQEEPPFKGITKNVNDQIDKVKSGIETVTSTVDSVTSKVTGLFGGGSGDDKSKKSKVEPVKATPAEEKRPSKPSEVSKTEAKPVSKPAAAAAPAPAAKPKDNPLPRDVVELEKAIELSAQLAVKEYNVAIGVLKGFNDDVRKVVDKAVENGENSLWTTLKNRASARDTAVATAERAAREAQEKIVACEIALSAAATAQNAKKVEAVRDKIKKLVDHIGNVKDELYRHKDTASVSDKYWRNVEKARNYFIDEIESIFPGLSLADKKLNLSKEDLDLFILHAYTHVLAYQKELQRLQTDGELRLKRAIDSVRGDNDSEALRAQLEYHLEAERRKLAVENQKKIFHIHAESDKLLRLQLKKQAEAHADHIKDIVAQRETDLTRSFKRELEDKLATEKANYKLQLAGMLGKLRGMDAALAERADAERTANQAQALWAACQALWASVRAATPGVHYKDRLRPLKNEINAIAKVAKGDDLVAAVLESVPKEAQERGVYPEDALRERFLNVERVARRLALVPEEGAGLPIYFLSYLQSLFILRPDNPISKDELENKPFDYSKLDTYDILNRARYHVDRSDFLQALKYMNLLQGASRKIAGEWMKEARLMLETQQAANTLMAHAAASGLLYL
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 82014 Sequence Length: 739 Subcellular Location: Mitochondrion inner membrane
Q5B6I7
MLRSSVLQGRHILSSSARPRPAPQWLARAGASSRLAGQRFFADAKSPTPVTPSSATPVPAETAAKSTAGPSATETPTPAPTRKTGRFRKFLIYLILTSGLAYGGGVFLALKSDNFHDFFTEYVPYGEESVLYFEERDFYRRFPNTLRNKNRLSPASRDEGSRVTIPSKSGLSSKEVEETGTDVSQPGPHMSAVTPAKADEATIKPAAAKPEEKTAAVKEAKKQAQEPEKPREEPKQEPKLPGSAPITTLEFANVSEGDEPIVQELVKTFNDIITVISADEDSAKYSKPVAKAKEELQKIGEQILSVRDEARRAAQEEIEKAHATFDESARELIRRFEEVRANDAAQYREEFEAERERLALAYQQKIQTELQRAQEIAEQRLQNELVEQAIELNRKYIHEVKDLVEREREGRLSKLSELTSSVSELETLVTGWREVIDTNLKTQQLQVAVDAVRSALERSTVPRPFVRELVAVKELAGDDPVVEAAIASINPAAYQRGIPSTSQIIERFRRVADEVRKASLLPEDAGIASHAASLVLSKVMFKKDAEAGSDDVESVLLRTENLLEQGNLDDAAREMNSLKGWAKILSKDWLADVRRVLEVKQALEVIETEARLQCLRVE
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 68634 Sequence Length: 618 Subcellular Location: Mitochondrion inner membrane
C7YIH6
MLRTSLRSVRVLGGRPSVAAAARQWPVAASRRAALVGQRHYAVDKKPESASSPSLPNTQSVASDKIHETTIDDVGETKAATVDAPKTTPPPPPPPPAPKKKGFFRRLRNFVFTLFVLGAVGFAGGVWYSCFSDNFHDFFTGYVPFGEQAVLYLEEMEYKKRFPNSATNAKSRDADGAVRIPAQSGASWRVADGTRRSSAGPVPAKQEEPKAEAPKPKAAEPKPTAKVVEKPAPTPAPAPTPRSESGFKAPEVNEPSRYPPLKPIDLLSLDDAREPVIQDLVHMVNDLILVINADGAHGRYGSSVNKAKNEITKVGGKLKGMKEQFEKKAAGQVRDKIDEFDKAATDLIDRVESAMITQESQWRHEFEEEMKKVRENYEDRVKVLLERERKLNEEKLQNQLLEQALALKKEFVKDVENQVEQERESRLGKLTALSSAVADLEKLTTGWNEVLDTNLQTQQLHVAVEAVRASLEDDHHPRPFIRELVALREIASDDPVVNAAIASVNPTAYQRGISTSSQLIDRFRRVANEVRKASLLPDEAGVASHASSWVLSHVMFKKQGLAEGNDVESVLTRTQTYLEEGDLDSAAREMNGLEGWAKTLSKDWLGEVRKVLEVQQALDVIATEARLQSLRVD
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 69945 Sequence Length: 633 Subcellular Location: Mitochondrion inner membrane
Q16891
MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKEELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELAEQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMRTQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIKANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology . Location Topology: Single-pass membrane protein Sequence Mass (Da): 83678 Sequence Length: 758 Subcellular Location: Mitochondrion inner membrane
Q6CSB8
MFRASKALGQRFASTNVPVKTARPFRNFLWKLGAATTVFYVGGVALSTYNYQFAELFTDNVPLAEELVQLVESYNDGTLNAPQLSLDEIRKKFGSITRKVQSVPHLGSTSSTVTESQSIASGSGSTAAAATTGTDSNSVVLSSVPPVGSVLLRLPHLKLDDDSNSFNNKSFVESFNKQVDSLNEKEFILPENAVESFLESYHGLSSQLNELNRDLADQLNSQLGQLSAELKQSVESDKVKEIESNKLQLMQQFEKDLSNLKVEFEQKFDSQLQSSLKANEQAMLAKHKNELAMLSIKQVQEFNKIISNKIENERNGRLKNLDELNGSVKTVSDSLAALEETLLRSECVNQLTNLVSSIKFKLNLDNTPSLDISKDLQKLTTLVNILPGKPNKCDAKEPQLIDVVVNELNSLTSAKENKQILSNEQLLNRWGLLQDKIREASLLPPNAGFLGHVSAKFFSLFLFNKSGISNENDIDSVISRVTENIKLNRLDKAVEDVVQLQGWSRLEADDWLQAARSKLELETLVDVVDHEIKTL
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 59391 Sequence Length: 535 Subcellular Location: Mitochondrion inner membrane
C4QXN2
MLRTIGTKASGITFRGVRFQSTNPTVKKSKPLRKFLFRLGLLTGVFYAGGVAVSLKNDIVQDAFIEHVPLGEALLDFTEYYVNHPEELSFSSTKQKLQNFDKTVLIPKRGVQSAKVEDVEHIKNVTRGSADESVSLSKTIYSNLNLPSIDLEFKDEVLQSSVEHLNHLIDTIRTQVNTVDLLPQVEQLKSSIKELGSKYNSFVTDRNTAVEEALAKLDDELKTKYQNKELALTDKYISDLQETKRQIELKHDQILAKELDTAQRRILLEAENIIVQARINTLSEFESIISDKIDNERNGKLKNLDALAKRVEELENVQIKLFDNISNAEKLTNLKKTVSKINRLLISSNDGVDAKTLINEVNKFKTYSKDLNNELISSVLLNLPNDKALSNGVLSQAQLLARWDLLTPELRSASLLPPNAGILGHLSSKLFSFFLLGKSGTPTSGNDIESVISRVHDNLLKNRLDDALEEVSSLKGWSRKLSEDWIVEARKKLELQVLVGVLENEVSLL
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 57129 Sequence Length: 509 Subcellular Location: Mitochondrion inner membrane
C5E325
MLRSRATINCVKSGRAGRALSRGMATFEGQPAARPNRLSKLLVRVGLATVGFYVGGVTLSLNNDQFGELFCDNVPLAESLVEMYEEFRDEKMQASRMSLDELKQKFGELGTKVDRIPNRGADPALTSQAVAALPASKEVRLEDESLVKLRLPEVEQLGSCKRATPLVESVNAAVAAVNEQSLLLPEDTYNAVHDAFTKLKSALQAINEDIRTNVAESVAVQYGQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSSEELASALKANEQALLAKQSNEVALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQELAEAVDQVDTLVMKSEVLSQLSLLTTLLKNKLHAGDESSVKIDSELARLKTLCDILPGRPSKCCSKNPQLLDVVVSQLDSLASQQLILSNEQLYNRWTLLQKDLSTSSLLPPNAGILGHISAKIFGFFLFNKNGAPVDNDIDSVIARVGQNLRLSKLDKAVEEVVALKGWPRVLCDEWVQEARKKLEIETLIDALDCEIRSS
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 58100 Sequence Length: 527 Subcellular Location: Mitochondrion inner membrane
Q7SFD8
MLRTSLRSVRALGSRPSAAVAGRQWQATVVRRAAVSGQRFFADDKKPVVPEPSQPAVLPASETLTSPSTPPPASPQVEPTSTVPPETTPLTPPTPEATVIPPVAEEPVVPPTLPTPRKKKGFFRRLRNFFLSLTILGAIAFGGGVYYSRINDAFHDFFTEYIPYGEQAVLYLEELDFKKRFPDVVSRVTGRPRDSGEQVKVPAQSGASWRVASGGEPAGRQSSSIKKAGAAAQDAVPKSEPAVVAAAKEDTAELPKTEATTTATPAEPAPAPAATDASGTPVKKPFKAPEVDEPSRWPPASPIDPLTVNGATDPIVQDLVKMLNDVITVINHDNANEKYAPTICKAKNELSKVADKINEMKAKVEADAAKQVKARVDGFDKAANELVSRVESAMAAQEAAWRREFEEEITRLKKSYDEKVHLIQDREHQIAEEKLNNRLLEQAIQLQRQFTENIKKHVEQERDGRLGKLNELHKAVAELERLTSGLNEVVDTNLRTQQLHVAVDAVRASLEDAHHPRPFIKELVALKEIAADDPVVDAAIASINPTAYQRGIPTTAELIDRFRRVATEVRKASLLPEDAGVASHASSYVLSKLMFKKEGLAAGDDVESILTRTQTYLEEGDLDNAAREMNGLKGWAKTLSRDWLGEVRKVLEVQQALDVIQAEARLQSLRVE
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 73443 Sequence Length: 672 Subcellular Location: Mitochondrion inner membrane
Q0V4H8
MLRASILRASPAVRPLARQTRPQWRVVQRCYADNKNLGETAVPNPAPTVTPSSTEKATIPSSDIPKPPPAPETAGASRSAPTIQPATTPPTGPGSASIAPDPKQPKPKKKGRIRRLLFWLTILSGLGYAGGVWYSLVSDNFHDFFTEYVPYGEDAVAYFEEREFRKRVPWPCWDSPRLQPQNLVRRTSSSILRPQWAEWRVLPTRATATSGTKGPHTIANVQEKKQEAAQTATVVKEEAAAPAPAKPVNHLDHLAVPDANDAVVQDVVKIVNDIITVINADSAHDGKYNSALDKAKSELGRVVSDINLMKANLRKESEEKVKSAHDEFEQAAKELVQRLDHQMQAQEAHWKEEFENERERLSQTYKDRLRSELEAAEKVYEQKTKNELLQQSIHLQKSFTASVRERVEAERDGRLGKLNELSSSVHELEKLTAEWNSVVDANLKTQHLVVAVEAVKSALETQATPKPFVTELAALKEIAADDPVVSAAIASINPAAYQRGIPSPALLIDRFRRVAAEVRKAALLPEDAGVASHIASLAMSKVLFKKSGLAVGQDVEAVLARTEVLLEEGDLDAAAREMNGLQGWAKVLSKDWLGECRRVLEVRQALDVIATEARLNSLLVD
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 68438 Sequence Length: 621 Subcellular Location: Mitochondrion inner membrane
A5D9S8
MLRARFSTSRSVLTKVVTPPPVVPPVLPPPVKPPKKSFSLPKFLFSATLIGSLAYGGTLYVATKNEKVMDYVIDYQPPFYEEILRMIETGSIDEIRDAWDSLRDRISNVDFSSSKSKIDKFANDLENRGEQLIQKTRQRWGQDTAPTPHEQLQKPVETTQKSPESLPLLSYKGINESVHATVASFNELIKSIDISGPGSNDLVKAIQDNVAKLSQKVDALTASFDDELKKNLKVSQNELLSSYTKKELELTENLLHQYNTERAQLEKKLNARLEQEIASAKEAISQAAVNAVTMVRIEQTKNFEKLVKDKVDGERSGRLANLDKLSSRLDELEQFAESLEQQIVANHNRSTINRSLAELRSLISSTEGTTPKSLAPYLGQLIEAVRPINDELIDATLKEIVPLLQHESSHSILSTSQLLARWELLSPELRSASLLPPNAGLLGHFTSFVFSKLLLPVKGAKPNGKDIESVIGRVEANLVRNELDLAVEEAASLKGWPRKLADDWVVEARKRLEAEFLLGLIEGEVRSL
Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity). Location Topology: Single-pass membrane protein Sequence Mass (Da): 58844 Sequence Length: 528 Subcellular Location: Mitochondrion inner membrane
P30290
MDSSTTIPITPTRTPCFFNISSSFNEHSPLNFYDEPIYNFSSGHEENQSHKSSKLTFFKPSNTKRSPHTPMQNNAKAIRLSTTVRHGIFKNSDLDGCSKPFAFSSGLKLSKKIVDASTPIDLKRKRAVTSLSTGLLSKREKWSLWEGNLTNPRSEQPHTPCKKGTKIKLKPPQSPLSPTTSLLARKCKHIDLDTFSRLDHPNSDSSDETFEMEELPSLSYGSEDLLEFCETPCKSQPIFLSSSHVNNWDEKDVPSSLSWTPTSPIFLNINSADDYEEEEDWTSDLRIRFQQVKPIHESDFSFVYHVSSINPPTETVYVVKMLKKNAAKFTGKERHLQEVSILQRLQACPFVVNLVNVWSYNDNIFLQLDYCENGDLSLFLSELGLLQVMDPFRVWKMLFQLTQALNFIHLLEFVHLDVKPSNVLITRDGNLKLGDFGLATSLPVSSMVDLEGDRVYIAPEILASHNYGKPADVYSLGLSMIEAATNVVLPENGVEWQRLRSGDYSNLPNLKDLLLSKEKVQINKVRCAESLQCLLQRMTHPYVDCRPTTQDLLAMPEMIFISEHSQKAAIIYEDHNSWLET
Function: Protein kinase that acts both on serines and on tyrosines. It acts as a negative regulator of entry into mitosis (G2 to M transition). Phosphorylates and inhibits cdc2. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 65934 Sequence Length: 581 EC: 2.7.11.1
Q93Z01
MTLNPPPSQQTSHSPRRIPNRRVLIVGNYCHDVLIQNGSVVAETLGGAASFISNVLDSSSVSCDLVSKVGHDFRYEVTHSPIVAPEKETTVFEAYFDLGIDGIGHADRVLKRVSACDPILPSDIPDSRFDFGMAVGVGGEILPETLEKMVEICDVVAVDIQALIRVFDPVDGAVKLVDLKESGFYHILHRIGFLKASSDEALFMDVEQMKHLCCVVVTNGEKGCRIYHKDDEMTVPPFLAKQVDPTGAGDSFLGGLIVGLVEGLTVPDAALLGNLFGSITVEHIGQPKFDLMMLQKVKDEVQRRKKQCNISSSHNNDHNEFHERLSPARFSCVDSQLQPKLLVNGHSCDDRSL
Function: Kinase that phosphorylates myo-inositol to produce multiple myo-inositol monophosphates. Participates in phytic acid biosynthesis in developing seeds. Phytic acid is the primary storage form of phosphorus in cereal grains and other plant seeds. Catalytic Activity: ATP + myo-inositol = 1D-myo-inositol 3-phosphate + ADP + H(+) Sequence Mass (Da): 38646 Sequence Length: 353 EC: 2.7.1.64
Q5GA22
MPLAAEPDDAHEERENQQLLITTKGGPGLEGLVVGSYCHDVLIRGGRIVGETLGGAAAFVSNVLDAASPQGAALNETSPFVVVAKVGHDFIYARAPASARHPPLLCSSPTTSFHAQFSETAASAHAPDRELRRVRACDPIYPADLPDRRFAYGLAVGVAGEVLPETLEQMIRLCRTVLVDAQALIRAFDGDGAVGHVALGDTPYARLLPRVAFVKASSEEAPYVGVETTRRQCCVIVTEGRDGCRLYWDGGEAHVAPFPAVQVDPTGAGDSFLAGFAAGLLWGLSATDAALLGNFFGAAAVSQVGVPTFHPKMLQAVKEILEEKTRKRSSPCMNGASFTLEKSNMHNELHAALQEAAVLMSEQQQADPANGSGGDICSA
Function: Kinase that phosphorylates myo-inositol to produce multiple myo-inositol monophosphates, Ins(1)P, Ins(3)P, Ins(4)P, Ins(5)P and Ins(6)P. Participates in phytic acid biosynthesis in developing seeds. Phytic acid is the primary storage form of phosphorus in cereal grains and other plant seeds. Catalytic Activity: ATP + myo-inositol = 1D-myo-inositol 3-phosphate + ADP + H(+) Sequence Mass (Da): 39898 Sequence Length: 379 EC: 2.7.1.64
Q84R36
MAPSPAAAMPLAAEPDEVVVEVEEEEERGVKGGGGVAGLDEVEGLVVGSYCHDVLLRGGRVVGETLGGAAAFVSNVLDAASPAGASLAVVSKVGHDFAYATAAAPARHPPVLCASPTTSFHARFSDDAASAHAPDRQLRRVHACDPIYPADLPDRRFAYGLAVGVAGEVLPETLERMIRLCRAVLVDAQALIRAFDGEAKGGGAVRHVALEATPYARLLPRVAFLKASSEEAPYVGVETARRRCCVIVTEGRDGCRLYWDGGEARVAPFPAVQVDPTGAGDSFLAGFASGLLWGLSATDAALLGNFFGAAAVSQVGVPTFDPKMLQAVKQILEKAVKRPCTHINGNTFTFQRSSMHDELHKSLQEAAMLVCEQKQANSPATDNGDVCSINELTSLPS
Function: Kinase that phosphorylates myo-inositol to produce multiple myo-inositol monophosphates. Participates in phytic acid biosynthesis in developing seeds. Phytic acid is the primary storage form of phosphorus in cereal grains and other plant seeds. Catalytic Activity: ATP + myo-inositol = 1D-myo-inositol 3-phosphate + ADP + H(+) Sequence Mass (Da): 41540 Sequence Length: 397 EC: 2.7.1.64
G3JUI7
MTTVPTTQRAVVVGPEDGSVVVAESIPLPDIEPDAVLVQVSAVALNPVDTKMMPGFLNPGNVLGLDFAGTVVAVGPAQPAWRSLQVGDRVFGCTDGCDSRRPRVGAFTQFTACRGSILIKMPDHMSFATAASMGNAIFSSGFALFHSLQLPGSLTATAEKSHWVLIYGGATATGTMALQFLRRAGHKPIAVCSAKHFDMAREYGAVAAFDYHSESHVQEIRDLTKNALSFAFDCVTTQSSVLACEEAMGRLGGRYTALDPFDPTLVSRKAVKLDWILTLTLMGRGSVWPKPFGCEPDEALLTWGTKLAEVAEGVLAEGDHVLKAHPMRIMEGGLDAIPSGIDAIRQGQVRGFKLVYLL
Function: Trans-enoyl reductase; part of the gene cluster that mediates the biosynthesis of cordypyrones A and B, 2 pyrones that show modest activities against pathogenic bacteria including methicillin-resistant Staphylococcus aureus (MRSA), Mycobacterium tuberculosis and Bacillus cereus . The HR-PKS milA catalyzes the formation of cordypyrones A via condensation of one acetate with 10 malonate units . Since milA lacks an enoyl reductase domain, the 2 beta-keto processing domains DH and KR of milA collaborate with the trans-enoyl reductase milB to catalyze the different levels of reduction . The cytochrome P450 monooxygenase milC then hydroxylates the C-22 of cordypyrones A to yield cordypyrones B . Catalytic Activity: acetyl-CoA + 3 AH2 + 18 H(+) + 10 malonyl-CoA + 8 NADPH = 3 A + 10 CO2 + 11 CoA + cordypyrone A + 8 H2O + 8 NADP(+) Sequence Mass (Da): 38191 Sequence Length: 358 Pathway: Secondary metabolite biosynthesis. EC: 1.-.-.-
G3JUI6
MAIHAAYIFIAATLIALYVARRMREQHARQKLARDQGCEPLTTAINKLPYGLDRKWQIVTHRGNILDDLITTRFAELGCYIYTDNQWGSPPIICAEPATMKAVLSTKFRDWDMDSNRYPALGPWLGRGVLVSSHQGKGSLWATARALLRPMFANTATYNHALIEPSVQEFLSILGHLNQAGAPDKDLLPFIRRLNVDIITTVFCGGSINEQQSGLAIAVGADAKHRKPVLEEAFDTIEPIAGLRLQTGSMYWLFTSKPFRDGCETFTGLADGWINRALSKRDEKPDLSQDEGAAAREKNFTEELVSSTDDRELLRDILVQLLFAGIDTSTSMLSFALVELGRHPSAWARLRAELAAHNMLSGGPETITAAQLKECAFLQNIIKETLRLYPPVPINSREAIRDTVLPSGGGADGSKPVFVPKGTSLKYSPYVMHRREDLYGPDALLWNPDRWIGRAPGWDYLPFNGGPRVCIGQKFALSSSAYVLARLAQQFDTCTALPTTGPIDSKLGAVLVPKAGVPVSLTNSTT
Function: Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of cordypyrones A and B, 2 pyrones that show modest activities against pathogenic bacteria including methicillin-resistant Staphylococcus aureus (MRSA), Mycobacterium tuberculosis and Bacillus cereus . The HR-PKS milA catalyzes the formation of cordypyrones A via condensation of one acetate with 10 malonate units . Since milA lacks an enoyl reductase domain, the 2 beta-keto processing domains DH and KR of milA collaborate with the trans-enoyl reductase milB to catalyze the different levels of reduction . The cytochrome P450 monooxygenase milC then hydroxylates the C-22 of cordypyrones A to yield cordypyrones B . Catalytic Activity: cordypyrone A + O2 + reduced [NADPH--hemoprotein reductase] = cordypyrone B + H(+) + H2O + oxidized [NADPH--hemoprotein reductase] Location Topology: Single-pass membrane protein Sequence Mass (Da): 57878 Sequence Length: 526 Pathway: Secondary metabolite biosynthesis. Subcellular Location: Membrane EC: 1.-.-.-
Q8N3F8
MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS
Function: Probable lipid-binding protein with higher affinity for phosphatidic acid, a lipid enriched in recycling endosome membranes. On endosome membranes, may act as a downstream effector of Rab proteins recruiting cytosolic proteins to regulate membrane tubulation. May be involved in a late step of receptor-mediated endocytosis regulating for instance endocytosed-EGF receptor trafficking. Alternatively, may regulate slow endocytic recycling of endocytosed proteins back to the plasma membrane. May indirectly play a role in neurite outgrowth. Location Topology: Peripheral membrane protein Sequence Mass (Da): 93441 Sequence Length: 863 Domain: Probably exists in a closed and an opened conformation due to interaction of the C-terminal RAB-binding domain (RBD), also described as bivalent Mical/EHBP Rab binding (bMERB) domain, with the N-terminal calponin-homology (CH) domain. The conformational change is regulated by RAB13 and may modulate MICALL1 interactions with functional partners. Subcellular Location: Recycling endosome membrane
Q8BGT6
MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAPPSPTSTSPAVQPGEEAQGDDLSPDSLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFRCRQCSSTLVPGSYSSGPEEGTFVCAERCTRLGPGSRSGTRLLSQQRQQPAAAEAKDAEDNDPSLSVAAVAEADRLQASSEVQFHTPTKPPLPSKPQELASPPGGRPTPAPRKASESSALTPPTPRPRSSLQQDGTVEQSVSSGLVNGRLQEPPVPKPRGTPKLSERMAAPRKDPPWITLVQTEPKKKPAPQPPSSGPGPLSQAYRQVEDGGLEEQTQKSSGTEPEPKPYNPFEEEEEEEGEPAPPVPSPSLAPPVPSPSPAPPVPSPAPAPSEATPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLAIHASRLSHSEPPSATPSPALSVESLSSESSSHTANAEPLEPPAVPKSSSDPAVHVPGTPGTSGNSVTPSANSSLSSSGELGQPSGEQMLQARTKGSAGTHSTKPFSGATPTPFLLAGDRNPAPPVGSASPQLQIKSSCKENPFNRKPSPSASPTVRKATKGAKPVRPPAPGHGFPLIKRKVQADQYIPEEDIYGEMDNIERQLDALEHSGVLLEEKLRGGANEGSEDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDEDRAREKVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKMLETMIKKKDFQREAESDSKKKGKFKTIKVLKFLGNKREAKSKAPGDKS
Function: Probable lipid-binding protein with higher affinity for phosphatidic acid, a lipid enriched in recycling endosome membranes. On endosome membranes, may act as a downstream effector of Rab proteins recruiting cytosolic proteins to regulate membrane tubulation. May be involved in a late step of receptor-mediated endocytosis regulating for instance endocytosed-EGF receptor trafficking. Alternatively, may regulate slow endocytic recycling of endocytosed proteins back to the plasma membrane. May indirectly play a role in neurite outgrowth. Location Topology: Peripheral membrane protein Sequence Mass (Da): 94079 Sequence Length: 870 Domain: Probably exists in a closed and an opened conformation due to interaction of the C-terminal RAB-binding domain (RBD), also described as bivalent Mical/EHBP Rab binding (bMERB) domain, with the N-terminal calponin-homology (CH) domain. The conformational change is regulated by RAB13 and may modulate MICALL1 interactions with functional partners (By similarity). Subcellular Location: Recycling endosome membrane
Q3TN34
MAAIKALQEWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFSALRKENIYENNKLAFQVAEEQLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGIKRPSSDSTEELSGKKGLSQPAKLPSPAQTQRSPLSPARTNPVVQRNEGGSQRPSPKAAPGTAGSSVSSICGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSSTLHSGAYRATGEPGVFVCTHHSSEVTSVSPKSSNLASRKPGGVTADTRPFGVSWTVQEANGEGTPLRVRTAAWEHAGGNTTAKGFVQTELKPPSTSQVHVGSSAGPKLPTITVTTTSVTSKALTHVTNSSPIGWSSPAQSSPANFNSRPVVSPSARNTHLPGSQGQTASKGVKTQLNLNSESSNTAVTPAWTSSASKTQQAREKFFQTPPSAPAPASAPAPAPTSKVPTVVTVPTSKVPNVVTAPTSKVPTVVTVPTSKVPTVVSAPTSKVPTVVSAPTSKVPTVVNSTNSRVTTVVNAPTSKVPTVVSATNGRVPTVVTAHTGRVPAVMNTSASKVSPVVDAPAQESSREQALSVLRKALPALTGSGTQAPNRSFPATSSVLVTLPKNEVPQKVPSDKLSALTTQTPNFTIKLEPSAPVNVGNTAVFLQAGKKSPSISPRVGKTSVGSRPQAEVAGVKGPGPISQEGQEEGPEGWRARLKPVDKKTPAGRSLEQKEPVLAEPRIGDTSRKASSSSDSSVHITLTSIQHKRKPCPAGSGPSPAALSPSPSHRKKLAVPPSLDVSADWLQPEPKKQEDGTRSCKEEKSPTRWSRERSAVLDSGLAPPGEAVTSPVRLHPDYIPQEELQRQLQDIESQLDALELRGVELEKRLRAAEGDASEDSLMVDWFRLIHEKQLLLRLESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLKSPQDRQREQELLSQYVNTVNDRSDIVDFLDEDRLREQEEDQMLENMIQNLGLQRKKSKSFLSKIWSSKSKSGQA
Function: Effector of small Rab GTPases which is involved in junctional complexes assembly through the regulation of cell adhesion molecules transport to the plasma membrane and actin cytoskeleton reorganization. Regulates the endocytic recycling of occludins, claudins and E-cadherin to the plasma membrane and may thereby regulate the establishment of tight junctions and adherens junctions. In parallel, may regulate actin cytoskeleton reorganization directly through interaction with F-actin or indirectly through actinins and filamins. Most probably involved in the processes of epithelial cell differentiation, cell spreading and neurite outgrowth. Location Topology: Peripheral membrane protein Sequence Mass (Da): 108288 Sequence Length: 1009 Domain: Probably exists in a closed and an open conformation due to interaction of the C-terminal coiled-coil domain with an N-terminal region including the calponin-homology (CH) and the LIM zinc-binding domain. The conformational change is regulated by RAB13. Subcellular Location: Cell membrane
Q8HWE5
MKASSGKPREFRPAVLLLILGLLLRDSRGSSIQGFLADVEVHGSSRLTRTHTLRYNVRAHSLEGSEKTQLLVLIYVDEELFLKYNGDSRETEPLGCWIKGHGGNETCARETNNLLKVEEKLRGMMAEVINQKSQEEGLHTLQATLGCELLSNGSTRGFWHLGYDGQNFLTFDQKTLTWTVDGPSTQQNKMFWKTHAPRADLVKTFLDDICPAHLQRYLASLRNGLQDTGPPMVTVTCRNYPVGRVTLTCRAFNLYTREATLVWLQDGKPVQQKTFRSETILPSGDGTYQARVSIRVLPGQEPQFSCNLRHGNHSIMQTAVSGHAAEDSQDVASSATASAGSALPVVLAVALARAN
Function: Binds to heparan sulfate proteoglycans on the surface of fibroblast (NIH-3T3) cells. PTM: N-glycosylated. Location Topology: Lipid-anchor Sequence Mass (Da): 39224 Sequence Length: 355 Subcellular Location: Cell membrane
F4KDA5
MWKLTRRLQPHINSTRWLVRNFRNGGAGDATGLYGFDHLKTAKGFQRFVADAIERSGELVSYISGMPSSPEIIKAMDEISDTVCCVVDSAELCRQTHPDREFVEEANKAAIEMNDYLHHLNTNHTLYAAVKKAEQDSNLLTKEASRTAHHLRMDFERGGIHLDPEKLDKVNNLTTNIFQLCREFSENIADDPGHVDIFPGSRIPRHLHHLLNPTYRSTSGGSRGSTRSAHKSKQKGFRINTDPRTVSSILQWTSDEEVRKMVYIQGNSVPHANHGVLEKLIAARHELSQMMGCNSYADIMVEPNLAKSPKVVTSFLQELSKTVKPKADEEFIAIRDFKREKCGNPSAELEPWDETYYTSMMKSSINDVDTAVVASYFPLPQCIEGLKVLVESLFGATFHTIPLAPGESWHPNVVKLSLHHPDEGDLGYLYLDLYSRKGKYPGCASFAIRGGRKISETEYQLPVIALVCNFSRACDSSIVKLNHSEVEVLFHEFGHALHSLLSRTDYQHFSGTRVALDLAEMPSNLFEYYAWDYRLLKRFARHYSTGETIPEKLVNSLQGARNMFAATEMQRQVFYALIDQMLFGEQPETARDVSHLVAELKRQHTSWNHVEGTHWYIRFSHLLNYGAGYYSYLYAKCFASTIWQSICEEDPLSLNTGTLLREKFFKHGGAKDPAELLTDLAGKEIISVHGEGIVPATTYLLNELRL
Cofactor: Binds 1 zinc ion. Function: Aminopeptidase which cleaves preproteins, imported into the mitochondrion, to their mature size. Could cleave both preproteins and preprotein intermediates already cleaved by the mitochondrial processing peptidase (MPP). Sequence Mass (Da): 79925 Sequence Length: 706 Subcellular Location: Mitochondrion EC: 3.4.24.-
P28238
MRELRSSSFWRAILAEFLGSLLYTLLGLGASLRWAPGPHGVLGSALAFGLAQATLVQALGHVSGGHINPAITLAFLLASQLSLPRALGYLLAQLLGALAGAGVLYGVTPAAVRGTLGLSALHPSVGPGQGTVVELLLTAQFILCVFASFDDRHDGRPGSAALPVGFSLALGHLFGIPFTGAGMNPARSFAPAVITRNFTNHWVFWAGPLLGAALAALLYELALCPRARSMAERLAVLRGEPPAAAPPPEPPAEPLELKTQGL
Function: Water channel. May be responsible for regulating the osmolarity of the lens. Interactions between homotetramers from adjoining membranes may stabilize cell junctions in the eye lens core. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 27072 Sequence Length: 262 Domain: Aquaporins contain two tandem repeats each containing two membrane-spanning helices and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA). Each tandem repeat contains a loop and a short helix that enter and leave the lipid bilayer on the same side (By similarity). Subcellular Location: Cell membrane
P26623
MKNILSWMLMFAVALPIVGCDNGGGSQTSATEKSMVEDSALTDNQKLSRTFGHLLSRQLSRTEDFSLDLVEVIKGMQSEIDGQSAPLTDTEYEKQMAEVQKASFEAKCSENLASAEKFLKENKEKAGVIELEPNKLQYRVVKEGTGRVLSGKPTALLHYTGSFIDGKVFDSSEKNKEPILLPLTKVIPGFSQGMQGMKEGEVRVLYIHPDLAYGTAGQLPPNSLLIFEVKLIEANDDNVSVTE
Function: PPIases accelerate the folding of proteins. Catalytic Activity: [protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0) Sequence Mass (Da): 26663 Sequence Length: 243 Subcellular Location: Cell outer membrane EC: 5.2.1.8
P51752
MKRLILPFLSVGLLLGTTAHAATPLKTEQDKLSYSMGVMTGKAFRKHDIKIDPQTFSMGLSDAYLGKETQMTEAEMRQTLQQFEKQSLQKMQHKMKQTAQQNAEKSRAFLTANKNKPGVKTLANGLQYKVLQAGQGQSPTLNDEVTVNYEGRLINGTVFDSSYKRGQPATFPLKSVIKGWQEALTRMKPGAIWEIYVPPQLAYGEQGAPGVIGPNEALIFKVNLISVKKK
Function: May be an essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity. Catalytic Activity: [protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0) Sequence Mass (Da): 25518 Sequence Length: 230 Subcellular Location: Secreted EC: 5.2.1.8
P30301
MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL
Function: Water channel . Channel activity is down-regulated by CALM when cytoplasmic Ca(2+) levels are increased. May be responsible for regulating the osmolarity of the lens. Interactions between homotetramers from adjoining membranes may stabilize cell junctions in the eye lens core (By similarity). Plays a role in cell-to-cell adhesion and facilitates gap junction coupling . PTM: Subject to partial proteolytic cleavage in the eye lens core. Partial proteolysis promotes interactions between tetramers from adjoining membranes (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 28122 Sequence Length: 263 Domain: Aquaporins contain two tandem repeats each containing two membrane-spanning helices and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA). Each tandem repeat contains a loop and a short helix that enter and leave the lipid bilayer on the same side (By similarity). Subcellular Location: Cell membrane
Q0U3N7
MSSITETFGVRIDATNSLVQAAIYGFLLAGVAAFAAPIVSTIRVLLSLFVLPGKSLSSFGPRGTWALITGASDGIGKEFALALAAKGYNLILVSRTQSKLDSLAADISSKYGPKISTKTLAMDFAQNKDSDYNNLKKLVDGLDVSILINNVGLSHSIPVPFAETPKQEMTDIIMINCMATLRVTQLLTPGMISRKRGLILTMASFGGFFPTPLLATYSGSKAFLQQWSSALGSELEPHGVHVQCVQSHLITTAMSKIRKPSALVPNPKQFVKATLSKLGRSGGAQNVAFTSTPYWSHGIMQWFLSRFLGERSPIVVKINRGMHEDIRRRALRKAERDAKKQ
Function: Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. Catalytic Activity: a very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + H(+) + NADPH Location Topology: Single-pass membrane protein Sequence Mass (Da): 36959 Sequence Length: 341 Pathway: Lipid metabolism; fatty acid biosynthesis. Subcellular Location: Endoplasmic reticulum membrane EC: 1.1.1.330
Q10245
MDGEVLANKSCCGAVVTAFSVIGIVFTILKFTSFASFVYKTFFAKGVKLSVYGAKKGYWAVVTGATDGIGKEYATQLAMSGFNVVLISRTQEKLDALAKELETVAKVKTRTIAIDYTKTTAETFEKLHQDLVGTPITVLINNVGQSHYMPTSFAETTVKEMDDIMHINCFGTLHTTKAVLSIMLRERQKNEKGPRCLILTMGSFAGLLPSPYLSTYAGSKAFLSNWSASLGEEVKKQGIDVWCFNSYLVVSAMSKVRRPTLTIPTPKKFVRAALSSIGLQRGGTNPYISQPYPSHAVMSWSLEQLLGSAKGFVVSQVAAMHLSIRKRALRKEARLQAQNQA
Function: Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. Catalytic Activity: a very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + H(+) + NADPH Location Topology: Single-pass membrane protein Sequence Mass (Da): 37307 Sequence Length: 341 Pathway: Lipid metabolism; fatty acid biosynthesis. Subcellular Location: Endoplasmic reticulum membrane EC: 1.1.1.330
Q4P622
MAIEQHIDGLLRHVGLRVDHGLTPVSASLVLLAGIGALSVGTFALRLVRLFADVYILPGNSVSKYGANKKDLTRASWAVVTGATDGIGREFALQLARKGFNIVLVSRSPEKLGSVAAEIEAATPGVRTKTQAIDFALGDERQYEGLEHTVKGLNVGVLVNNVGKSHNMPVTFTETSEEEMEDIIEINVVSVLRVSKMIIPGMVDRKRGLVLNLGSFAGQVTTPMLATYAGSKAFLSGWSQALGEEVKRSNVDVSLLNTYFVVSNLSKIRKSSAMIPTPKQYVTQVLKTLGRNGGAVGRPYTATPWPGHALVDWATTFVLPRGWLLSYTYGQQVATRKRALNKAHKAVKSA
Function: Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. Catalytic Activity: a very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + H(+) + NADPH Location Topology: Single-pass membrane protein Sequence Mass (Da): 37725 Sequence Length: 350 Pathway: Lipid metabolism; fatty acid biosynthesis. Subcellular Location: Endoplasmic reticulum membrane EC: 1.1.1.330
P38286
MTFMQQLQEAGERFRCINGLLWVVFGLGVLKCTTLSLRFLALIFDLFLLPAVNFDKYGAKTGKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRNIITINNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQVKKE
Function: Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. Catalytic Activity: a very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + H(+) + NADPH Location Topology: Single-pass membrane protein Sequence Mass (Da): 38708 Sequence Length: 347 Pathway: Lipid metabolism; fatty acid biosynthesis. Subcellular Location: Endoplasmic reticulum membrane EC: 1.1.1.330
Q5AAG6
MDQQEAPIYYGRSVNKVYNQEFIIDSRFKIVKELGHGAYGIVCSAKYDNGSKKVPDSNNGNASSSANASFVAIKKITNIFSKNILCKRALRELKLLQFFRGHKNITCLYDLDIIPNPMTGEFNEIYLYEELMECDMHQIIRSGQPLSDQHYQSFIYQVLCGLNFIHSADVLHRDLKPGNLLVNADCELKICDFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGKPLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPITRKASYEELFPDANPLALDLLERMLTLDPRERITVRDALNHKYLELWHDPKEEIECQVKFDFKSFETVDGLDEMKQLIMDEVQKFREFVRKPIEEQQRIQMQLHMQKREEQRQEEEEKELLEQQRQFPAQESMDISQTPYNNLETNIGTPQVEDDYPRPQELDEFTFSNLESSSSMNLFQDMAKPSGEEYIKLEEELGFGLDGAMFNNYCNDHQ
Function: Serine/threonine protein kinase component of the cell integrity pathway, a signal transduction pathway that plays a role in yeast cell morphogenesis and cell growth. Participates in cell wall construction, azole resistance, and host interaction. Required for the signaling for invasive filamentous growth and biofilm formation, and plays a crucial role in virulence. PTM: Activated through phosphorylation of Thr-211 and Tyr-213 from the TXY motif (By similarity). Phosphorylated in a PKC1-dependent manner in response to cell wall perturbations, oxidative stress, osmotic stress, and low temperatures. Also activated in response to physical contact leading to contact-dependent cellular behaviors such as invasive hyphal growth and biofilm development. Phosphorylation is also PBS2- and HOG1-dependent. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 59036 Sequence Length: 509 Domain: The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases. EC: 2.7.11.24
P53379
MKLSVLTFVVDALLVCSSIVDAGVTDFPSLPSNEVYVKMNFQKKYGSSFENALDDTKGRTRLMTRDDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTKKKDTTGSSFKQVNKDALASVVESVFTEISYDTTIVTSEATATFDSTASTSQLIDCATYGTFNTSKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQLVTDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEIIESAVPSALKAPGYSSTWSTYESIVSGGNMFSTAANSSISYFASTSHSATSSSSSKGQKTQTSTTALSISKSTSSTSSTGMLSPTSSSSTRKENGGHNLNPPFFARFITAIFHHI
Function: Cleaves proteins C-terminally to the most C-terminal basic residue. Can process the alpha-mating factor precursor. Required for cell wall integrity. Catalytic Activity: Hydrolyzes various precursor proteins with Arg or Lys in P1, and commonly Arg or Lys also in P2. The P3 amino acid is usually non-polar, but otherwise additional basic amino acids are favorable in both non-prime and prime positions. Location Topology: Lipid-anchor Sequence Mass (Da): 64269 Sequence Length: 596 Subcellular Location: Cell membrane EC: 3.4.23.41
Q54MY9
MDNNSTLNNITITVASSHNNTTTNSNNNNNNNNGSNSNNNNEQLNTLSNSITSLKSLNISGSGVITNNSEVNTPSEGNITPLPLLSLSDALSPLRELYSCLYVGDIRALMSNQYLKFEENEKIRILGFPEPHLEIDEKTQKYFSYQIIEFESDEDILSIAKSFEQYSQLILGRTPTQPVVIQECCFGLVLASIYFIKYELFSLPQAHDLIGYNDFFGTSKKHSHFEKVDSCTLINDITSYYYNNMSSKRKTTIFSNNISFTNLQTTTPPTTTTTTTTTTTTSSSNNSEQIESTSKNNSSGITSPTSIKPKNKVGLLKKLFNKMDKESSNNNNNKEKVEKIKEKKESKKEREAREAKEEKEREEREKEHQLALKNIPPAELYKHHMEQIQKIQKQQIAELNATSPDGGNDLSNGSNGSKNGNNNNNNNNSNNNNNNNNSNEPNSQHQNHNPITNLMDQELIENYDDGSDRMKNSKTIISPNFESLPDEYKTMVKTWDIKQESVDEHFEIILSLLHFHTKQRFYSSDPTNLPDKPKYYNVGNVCGNCTPPMILDPAGSGQMVVAKSFYKRPFDQICKKPTNEMKKLYTFREKVGKGGFGTVYLVRNNMDKSKSRIAIKKLPHVRKKEKKFNVKEIRVLEFTNHPNIITYYNSHMLHDEVWIAMEFMEGGTLAEASNQYPFQESNIAYVAREVLQGLAYLHGIQLVHRDLKSQNIMMTTSGEIKLIDFGLCANLSKGERIRMCGSPIWMPPEMIQQKQHGYTCDIWSTAICLLELANRNNKLRKNPIKTMFMVGSEGIKDPFEDPHKWSDEFHDIINKCLQMDPHKRPSAQELLKHPFIQLADNKKKMGKILSSIFLKSIVGI
Function: Coordinates organism morphology with cellular differentiation during development. Negative regulator of sporulation, synchronizing encapsulation with culmination. May have an additional function in prestalk cells. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 97846 Sequence Length: 860 EC: 2.7.11.1
P64605
MQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAMVLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK
Function: Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. MlaD functions in substrate binding with strong affinity for phospholipids and modulates ATP hydrolytic activity of the complex. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 19576 Sequence Length: 183 Subcellular Location: Cell inner membrane
P45029
MRQTIKYEFWVGLFLLLGIGALVFLGLRVANVQGFAETKSYTVTATFDNIGGLKVRAPLKIGGVVIGRVSAITLDEKSYLPKVSIAINQEYNEIPENSSLSIKTSGLLGEQYIALTMGFDDGDTAMLKNGSQIQDTTSAMVLEDLIGQFLYGSKKSDGNEKSESTEQ
Function: Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. MlaD functions in substrate binding with strong affinity for phospholipids and modulates ATP hydrolytic activity of the complex. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 18111 Sequence Length: 167 Subcellular Location: Cell inner membrane
P45030
MIVNFISALGKQVIDFFRALGRAGFMLFGALIGKPQIRKHFPLLVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLIDFSAETSLGQLVALSLLRELGPVVTALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPVLSILFIAIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYDCMPTSEGISQATTRTVVHASLVVLGLDFILTAIMFGAG
Function: Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. Probably responsible for the translocation of the substrate across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 28015 Sequence Length: 261 Subcellular Location: Cell inner membrane
P45031
MNQNLIEVKNLTFKRGDRVIYDNLNLQVKKGKITAIMGPSGIGKTTLLKLIGGQLMPEQGEILFDGQDICRLSNRELYEVRKRMGMLFQSGALFTDISTFDNVAFPIREHTHLPENLIRQIVLMKLEAVGLRGAAALMPSELSGGMARRAALARAIALDPDLIMFDEPFTGQDPISMGVILSLIKRLNEALNLTSIVVSHDVEEVLSIADYAYIIADQKVIAEGTSEQLLQSQDLRVVQFLKGESDGPVRFKYPAQDYVKELFE
Function: Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. Responsible for energy coupling to the transport system. Location Topology: Peripheral membrane protein Sequence Mass (Da): 29395 Sequence Length: 264 Subcellular Location: Cell inner membrane EC: 7.6.2.-
Q15049
MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHKTWVFSVLMGSCLLVTSGFSLYLGNVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQILFVSTFAVTTTCLIWFGCKLVLNPSAININFNLILLLLLELLMAATVIIAARSSEEDCKKKKGSMSDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHLSVTFFWILVACFPSAIASHVAAECPSKCLVEVLIAISSLTSPLLFTASGYLSFSIMRIVEMFKDYPPAIKPSYDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ
Function: Regulates the response of astrocytes to hypo-osmosis by promoting calcium influx. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 41141 Sequence Length: 377 Subcellular Location: Membrane
Q60HE7
MTQEPFREELAYDRMPTLERGRQDPASYAPDTKPSDLQLSKRLPPCFSPKTWVFSVLMGSCLLVTSGFSLYLGNVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQILFVSTFAVTTTCLIWFGCKLILNPSAININFNLILLLLLELLMAATVIMSARSSEEYCKKKKGSMSDGTNILGEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHLSVTFFWILVACFPSAIASHVTAECPSKCLVEVLIAISSLTSPLLFTASGYLSFSVMRIVEMFKDYPPAIKPSYDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQSGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ
Function: Regulates the response of astrocytes to hypo-osmosis by promoting calcium influx. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 41158 Sequence Length: 377 Subcellular Location: Membrane
P10916
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Function: Contractile protein that plays a role in heart development and function . Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity). PTM: N-terminus is methylated by METTL11A/NTM1. Sequence Mass (Da): 18789 Sequence Length: 166 Subcellular Location: Cytoplasm
P51667
MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Function: Contractile protein that plays a role in heart development and function . Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity) . During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly . PTM: N-terminus is methylated by METTL11A/NTM1. Sequence Mass (Da): 18864 Sequence Length: 166 Subcellular Location: Cytoplasm
P08733
MSPKKAKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Function: Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force . During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity). PTM: N-terminus is methylated by METTL11A/NTM1. Sequence Mass (Da): 18880 Sequence Length: 166 Subcellular Location: Cytoplasm
A5U029
MVNDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTLEEAQIAKIDLALGKLGLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQAAHVQKSFDEMDTPRDRRVLLAGWEQFNEPVDRIVSIGAFEHFGHDRHADFFARAHKILPPDGVLLLHTITGLTRQQMVDHGLPLTLWLARFLKFIATEIFPGGQPPTIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWAEALQEHKSEAIAIQSEEVYERYMKYLTGCAKLFRVGYIDVNQFTLAK
Function: Catalyzes the conversion of a double bond to a cis cyclopropane ring at the distal position of an alpha mycolic acid via the transfer of a methylene group from S-adenosyl-L-methionine. MmaA2 also catalyzes the biosynthesis of the cis-cyclopropanated methoxymycolates. Cyclopropanated mycolic acids are key factors participating in cell envelope permeability, host immunomodulation and persistence. Catalytic Activity: 1-acyl-2-(9Z)-enoyl-sn-glycero-3-phospholipid + S-adenosyl-L-methionine = 1-acyl-2-(9-cyclopronane)-acyl-sn-glycero-3-phospholipid + H(+) + S-adenosyl-L-homocysteine Sequence Mass (Da): 32724 Sequence Length: 287 Pathway: Lipid metabolism; mycolic acid biosynthesis. EC: 2.1.1.79
Q7U1K1
MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERLDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
Function: Involved in the biosynthesis of hydroxymycolate, a common precursor of oxygenated mycolic acids (methoxymycolate and ketomycolate). Probably transfers a methyl group from the S-adenosylmethionine (SAM) cofactor and, subsequently or simultaneously, a water molecule onto the double bound of ethylene substrates, leading to the formation of the hydroxylated product at the distal position. Sequence Mass (Da): 34636 Sequence Length: 301 Pathway: Lipid metabolism; mycolic acid biosynthesis. EC: 2.1.1.-
Q8IVH4
MPMLLPHPHQHFLKGLLRAPFRCYHFIFHSSTHLGSGIPCAQPFNSLGLHCTKWMLLSDGLKRKLCVQTTLKDHTEGLSDKEQRFVDKLYTGLIQGQRACLAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFRVGLSGPPGAGKSTFIEYFGKMLTERGHKLSVLAVDPSSCTSGGSLLGDKTRMTELSRDMNAYIRPSPTRGTLGGVTRTTNEAILLCEGAGYDIILIETVGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVAVTKSDGDLIVPARRIQAEYVSALKLLRKRSQVWKPKVIRISARSGEGISEMWDKMKDFQDLMLASGELTAKRRKQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFLLKAFKSRD
Function: GTPase, binds and hydrolyzes GTP . Involved in intracellular vitamin B12 metabolism, mediates the transport of cobalamin (Cbl) into mitochondria for the final steps of adenosylcobalamin (AdoCbl) synthesis . Functions as a G-protein chaperone that assists AdoCbl cofactor delivery from MMAB to the methylmalonyl-CoA mutase (MMUT) . Plays a dual role as both a protectase and a reactivase for MMUT . Protects MMUT from progressive inactivation by oxidation by decreasing the rate of the formation of the oxidized inactive cofactor hydroxocobalamin (OH2Cbl) . Additionally acts a reactivase by promoting the replacement of OH2Cbl by the active cofactor AdoCbl, restoring the activity of MMUT in the presence and hydrolysis of GTP . Catalytic Activity: GTP + H2O = GDP + H(+) + phosphate Sequence Mass (Da): 46538 Sequence Length: 418 Subcellular Location: Mitochondrion EC: 3.6.-.-
Q8C7H1
MTISTLLLSPNRRLLTCLSRVPSPWLLHSSHPAPGPPGALPNCFGHHCTKRVLLSDGFRRTLCVQATLKDHTEGLSDKEQRFVDRLYTGLVKGQRACLAEAITLVESTHTRKRELAQVLLQRVLALQREQELRNQGKPLTFRVGLSGPPGAGKSTFIECFGKMLTEQGHRLSVLAVDPSSCTSGGSLLGDKTRMIELSRDMNAYIRPSPTSGTLGGVTRTTNEAIVLCEGGGYDIILIETVGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVVITKSDGDLIVPARRIQAEYVSALKLLRRRSEVWRPKVIRISARSGEGITEMWDTMREFQHQMLASGELAAKRQTQHKVWMWNLIQENVLEHFKTHPSIREQIPLMERKVLSGALSPGRAADLLLKAFKSRH
Function: GTPase, binds and hydrolyzes GTP (By similarity). Involved in intracellular vitamin B12 metabolism, mediates the transport of cobalamin (Cbl) into mitochondria for the final steps of adenosylcobalamin (AdoCbl) synthesis (By similarity). Functions as a G-protein chaperone that assists AdoCbl cofactor delivery from MMAB to the methylmalonyl-CoA mutase (MMUT) (By similarity). Plays a dual role as both a protectase and a reactivase for MMUT (By similarity). Protects MMUT from progressive inactivation by oxidation by decreasing the rate of the formation of the oxidized inactive cofactor hydroxocobalamin (OH2Cbl) (By similarity). Additionally acts a reactivase by promoting the replacement of OH2Cbl by the active cofactor AdoCbl, restoring the activity of MMUT in the presence and hydrolysis of GTP (By similarity). Catalytic Activity: GTP + H2O = GDP + H(+) + phosphate Sequence Mass (Da): 45932 Sequence Length: 415 Subcellular Location: Mitochondrion EC: 3.6.-.-
Q5MFW3
MAMLLPHPHPDFLKGLLKAPFRCYRFIFHSSTHLGSGIPCAQPFNLLGLHYAKWMLLSDGLKRNLCVQTTLKDHKEGLSDKGQRFVDKLFTGLIQGQRACLAEAKTLVESTHSRKKELAQVLLQKVLLFQREQEQPNKGNPLAFRLGLSGPPGAGKSTFIEYSGKLLTERGHKLSVLAVGPSSCNSGGSLLGDKTRMTEFSRDMNAYIRPSPTRGNLGGVPRTTNEVILLCEGAGYDIILIETVGVGQSEFAVADTVDILFYYCHQLEEMNCRVSKEVYLRWQHGSNNYVCWRLDCASSKDTGRVCDALKLLRRRLAVWRPKVVRISARSWRGGHWNVGYDARILGPNTCQRGAACQTTKATESLDVEPHSGKRVRAFQESPHSPGADSCSGTKGPPWGPGPRASSRFVVEGF
Function: GTPase, binds and hydrolyzes GTP (By similarity). Involved in intracellular vitamin B12 metabolism, mediates the transport of cobalamin (Cbl) into mitochondria for the final steps of adenosylcobalamin (AdoCbl) synthesis (By similarity). Functions as a G-protein chaperone that assists AdoCbl cofactor delivery from MMAB to the methylmalonyl-CoA mutase (MMUT) (By similarity). Plays a dual role as both a protectase and a reactivase for MMUT (By similarity). Protects MMUT from progressive inactivation by oxidation by decreasing the rate of the formation of the oxidized inactive cofactor hydroxocobalamin (OH2Cbl) (By similarity). Additionally acts a reactivase by promoting the replacement of OH2Cbl by the active cofactor AdoCbl, restoring the activity of MMUT in the presence and hydrolysis of GTP (By similarity). Catalytic Activity: GTP + H2O = GDP + H(+) + phosphate Sequence Mass (Da): 45682 Sequence Length: 413 Subcellular Location: Mitochondrion EC: 3.6.-.-
Q58D49
MAVWGPGGRLGLRGCLGARKLLCPRFQSRGPQGVEDGDRPQPSSKTPKVPKIYTKTGDKGFSSTFTGERRSKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVEELQKIQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDKYSRQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDYLFTLARYTAMKEGNPEKIYKKNDLSDRT
Function: Converts cob(I)alamin to adenosylcobalamin (adenosylcob(III)alamin), a coenzyme for methylmalonyl-CoA mutase, therefore participates in the final step of the vitamin B12 conversion . Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer that is stimulated by ATP-binding to MMAB and gated by MMAA (By similarity). Catalytic Activity: ATP + cob(I)alamin-[corrinoid adenosyltransferase] = adenosylcob(III)alamin + apo-[corrinoid adenosyltransferase] + triphosphate Sequence Mass (Da): 26587 Sequence Length: 241 Subcellular Location: Mitochondrion EC: 2.5.1.-
Q96EY8
MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Function: Converts cob(I)alamin to adenosylcobalamin (adenosylcob(III)alamin), a coenzyme for methylmalonyl-CoA mutase, therefore participates in the final step of the vitamin B12 conversion . Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer that is stimulated by ATP-binding to MMAB and gated by MMAA (Probable). Catalytic Activity: ATP + cob(I)alamin-[corrinoid adenosyltransferase] = adenosylcob(III)alamin + apo-[corrinoid adenosyltransferase] + triphosphate Sequence Mass (Da): 27388 Sequence Length: 250 Subcellular Location: Mitochondrion EC: 2.5.1.-
Q8N119
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRARSRRSPRAPLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFGRGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKVAVHEIGHVLGLPHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRVLNSYPKRITEVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSWLPANGLFPKKFISEKWFDVCDVHISTLNM
Cofactor: Binds 1 zinc ion per subunit. Function: Plays a specialized role in the generation of left-right asymmetry during embryogenesis. May act as a negative regulator of the NOTCH-signaling pathway . Cleaves alpha-1-antitrypsin . PTM: The precursor is cleaved by a furin endopeptidase. Sequence Mass (Da): 65043 Sequence Length: 569 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Secreted EC: 3.4.24.-
O93470
MPSIKLLVWCCLCVISPRLCHSEKLFHSRDRSDLQPSAIEQAELVKDMLSAQQFLAKYGWTQPVIWDPSSTNENEPLKDFSLMQEGVCNPRQEVAEPTKSPQFIDALKKFQKLNNLPVTGTLDDATINAMNKPRCGVPDNQMAKKETEKPTAAQSLENKTKDSENVTQQNPDPPKIRRKRFLDMLMYSNKYREEQEALQKSTGKVFTKKLLKWRMIGEGYSNQLSINEQRYVFRLAFRMWSEVMPLDFEEDNTSPLSQIDIKLGFGRGRHLGCSRAFDGSGQEFAHAWFLGDIHFDDDEHFTAPSSEHGISLLKVAAHEIGHVLGLSHIHRVGSIMQPNYIPQDSGFELDLSDRRAIQNLYGSCEGPFDTAFDWIYKEKNQYGELVVRYNTYFFRNSWYWMYENRSNRTRYGDPLAIANGWHGIPVQNIDAFVHVWTWTRDASYFFKGTQYWRYDSENDKAYAEDAQGKSYPRLISEGFPGIPSPINAAYFDRRRQYIYFFRDSQVFAFDINRNRVAPDFPKRILDFFPAVAANNHPKGNIDVAYYSYTYSSLFLFKGKEFWKVVSDKDRRQNPSLPYNGLFPRRAISQQWFDICNVHPSLLKI
Cofactor: Binds 1 zinc ion per subunit. Function: Plays a specialized role in the generation of left-right asymmetry during embryogenesis. May act as a negative regulator of the NOTCH-signaling pathway. PTM: The precursor is cleaved by a furin endopeptidase. Sequence Mass (Da): 70146 Sequence Length: 604 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Secreted EC: 3.4.24.-
O75900
MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG
Cofactor: Binds 1 zinc ion per subunit. Function: Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity). PTM: N-glycosylated. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 43935 Sequence Length: 390 Domain: The ShKT domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4 (By similarity). Subcellular Location: Endoplasmic reticulum membrane EC: 3.4.24.-
Q9Y5R2
MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
Cofactor: Binds 1 zinc ion per subunit. Function: Metalloprotease that mediates cleavage of N-cadherin (CDH2) and acts as a regulator of neuro-immune interactions and neural stem cell quiescence. Involved in cell-cell interactions between nociceptive neurites and mast cells, possibly by mediating cleavage of CDH2, thereby acting as a mediator of peripheral thermal nociception and inflammatory hyperalgesia. Key regulator of neural stem cells quiescence by mediating cleavage of CDH2, affecting CDH2-mediated anchorage of neural stem cells to ependymocytes in the adult subependymal zone, leading to modulate their quiescence. May play a role in axonal growth. Able to activate progelatinase A. May also be a proteoglycanase involved in degradation of proteoglycans, such as dermatan sulfate and chondroitin sulfate proteoglycans. Cleaves partially fibronectin, but not collagen type I, nor laminin (By similarity). PTM: Cleaved by a furin endopeptidase in the trans-Golgi network. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 73231 Sequence Length: 645 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Cell membrane EC: 3.4.24.-
Q9R0S2
MPRSRGGRAAPGQASRWSGWRAPGRLLPLLPALCCLAAAAGAGKPAGADAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLLVLLYTIFQFKNKAGPQPVTYYKRPVQEWV
Cofactor: Binds 1 zinc ion per subunit. Function: Metalloprotease that mediates cleavage of N-cadherin (CDH2) and acts as a regulator of neuro-immune interactions and neural stem cell quiescence . Involved in cell-cell interactions between nociceptive neurites and mast cells, possibly by mediating cleavage of CDH2, thereby acting as a mediator of peripheral thermal nociception and inflammatory hyperalgesia . Key regulator of neural stem cells quiescence by mediating cleavage of CDH2, affecting CDH2-mediated anchorage of neural stem cells to ependymocytes in the adult subependymal zone, leading to modulate their quiescence . May play a role in axonal growth . Able to activate progelatinase A. May also be a proteoglycanase involved in degradation of proteoglycans, such as dermatan sulfate and chondroitin sulfate proteoglycans. Cleaves partially fibronectin, but not collagen type I, nor laminin . PTM: Cleaved by a furin endopeptidase in the trans-Golgi network. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 70460 Sequence Length: 618 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Cell membrane EC: 3.4.24.-
Q9NPA2
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAAGRWPAPIPLLLLPLLVGGVASR
Cofactor: Binds 1 zinc ion per subunit. Function: May activate progelatinase A. PTM: The precursor is cleaved by a furin endopeptidase. Location Topology: Lipid-anchor Sequence Mass (Da): 62554 Sequence Length: 562 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Cell membrane EC: 3.4.24.-
Q3U435
MCFPGSQISPARLYYLVSAPWICTGSLTSSRLPRRRESGPLRVPPRSVQAERILRLPAFGLPLLALLLVPLLPVRAQNPDAKVVSMGVEWLTRYGYLPPADPVHAQMQSLEKLQDAIKVMQRFAGLPETGQMDPMTIKTMRKPRCSLPDVLGAAGLVRRRRRYSLSGSVWKKRTLTWSIRSFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEPDIIIHFARAYHQDSYPFDGSGGTLAHAFFPGEHPISGDTHFDDEETWTFGSTDDNGIDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYGRVSQNPNARPTRKPLVPPPQPPAMPPDSPATPVPDRCEGNFDAVANIRGEIFLFKGPWFWRLQPSGQLVSPRPAGLHRFWEGLPTHVKVIQAAYARPLDGRIILFSGPQFWVFQERQLEGAARPLVEFGLPPGEDVDAVFSWPHNGKTYLIRGQKYWRYDEVAARPDPGYPRALSLWDGAPFAPDDVTISNTGDTYFFKGTHFWRFAEGSVKAESDSPQPIGPKWLDCPAPNSDPRVTSPPKTTSKTRSCDCHCELNQASEQLSPLLLPLLPLVAGEVFSY
Cofactor: Binds 1 zinc ion per subunit. Function: May activate progelatinase A. PTM: The precursor is cleaved by a furin endopeptidase. Location Topology: Lipid-anchor Sequence Mass (Da): 68496 Sequence Length: 615 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Cell membrane EC: 3.4.24.-
Q9NRE1
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
Cofactor: Binds 1 zinc ion per subunit. Function: May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B. Sequence Mass (Da): 29708 Sequence Length: 261 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Secreted EC: 3.4.24.-
Q9H306
MKRLLLLFLFFITFSSAFPLVRMTENEENMQLAQAYLNQFYSLEIEGNHLVQSKNRSLIDDKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTPDMARAAVDEAIQEGLEVWSKVTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVSLDPRKYPLSQDDINGIQSIYGGLPKEPAKPKEPTIPHACDPDLTFDAITTFRREVMFFKGRHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHFPGISIRVDAAFQYKGFFFFSRGSKQFEYDIKTKNITRIMRTNTWFQCKEPKNSSFGFDINKEKAHSGGIKILYHKSLSLFIFGIVHLLKNTSIYQ
Cofactor: Binds 4 Ca(2+) ions per subunit. Function: Matrix metalloproteinases degrade protein components of the extracellular matrix such as fibronectin, laminin, gelatins and/or collagens. PTM: N-glycosylated. Location Topology: Peripheral membrane protein Sequence Mass (Da): 59026 Sequence Length: 513 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Endoplasmic reticulum membrane EC: 3.4.24.-
Q9H239
MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Cofactor: Binds 1 zinc ion per subunit. Function: Can degrade casein. Could play a role in tissues homeostasis and repair. PTM: The precursor is cleaved by a furin endopeptidase. Sequence Mass (Da): 58939 Sequence Length: 520 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Secreted EC: 3.4.24.-
Q90611
MKTHSVFGFFFKVLLIQVYLFNKTLAAPSPIIKFPGDSTPKTDKELAVQYLNKYYGCPKDNCNLFVLKDTLKKMQKFFGLPETGDLDQNTIETMKKPRCGNPDVANYNFFPRKPKWEKNHITYRIIGYTPDLDPETVDDAFARAFKVWSDVTPLRFNRINDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGPGIGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFWFNGKEYNSCTDAGRNDGFLWCSTTKDFDADGKYGFCPHESLFTMGGNGDGQPCKFPFKFQGQSYDQCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFIFLGNKYDSCTSAGRNDGKLWCASTSSYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTKNFRLSQDDIKGIQELYEVSPDVEPGPGPGPGPGPRPTLGPVTPELCKHDIVFDGVAQIRGEIFFFKDRFMWRTVNPRGKPTGPLLVATFWPDLPEKIDAVYESPQDEKAVFFAGNEYWVYTASNLDRGYPKKLTSLGLPPDVQRIDAAFNWGRNKKTYIFSGDRYWKYNEEKKKMELATPKFIADSWNGVPDNLDAVLGLTDSGYTYFFKDQYYLQMEDKSLKIVKIGKISSDWLGC
Cofactor: Binds 4 Ca(2+) ions per subunit. PTM: The propeptide is processed by MMP14 (MT-MMP1) and MMP16 (MT-MMP3). Catalytic Activity: Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln. Sequence Mass (Da): 74941 Sequence Length: 663 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Secreted EC: 3.4.24.24
P08253
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Cofactor: Binds 4 Ca(2+) ions per subunit. Function: Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14. PTM: Phosphorylation on multiple sites modulates enzymatic activity. Phosphorylated by PKC in vitro. Catalytic Activity: Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln. Sequence Mass (Da): 73882 Sequence Length: 660 Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Subcellular Location: Secreted EC: 3.4.24.24
Q49W90
MNRQKNNLIFQYSAVVIFFLIVMFGLSLFLAGHYTPGGGFVGGLLLSSALVIITVAFDIKTMRKIFPWDFKILIGIGLLFCLATPMASWFYNKNFFTHTPFEIPLGILPPMEMHTATFFDLGVMCAVVGTVMTIILSIGENE
Function: Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 15794 Sequence Length: 142 Subcellular Location: Cell membrane
Q9PJ66
MKILVAMSGGVDSTVTAYKLKNLGHEVIGCYMKLHGKPNYHEENIKKVEKVANFLQIPYHILDLQEDFKNKVYMPFVDTYKEGKTPNPCALCNRFIKLGKLLEFAKSLGCEKLATGHYARLENNLIKTAVDESKDQSYFLASADKEALKYLIFPLGEMKKEDVKKFASTIEVLKSFATQKESSEICFVEDTYVQVLDQFMDTKIPGEVLDSSGKVVGKHEGYMHYTIGKRRGFEVRGAHEPHFVLKINPKQNQIIVGTKEELKISEFNLKNINLFIDAKELDCEVKIRYRSKSTPCKVEIYEDKSAKIILKDPVYGLASGQMAVFYDHDKVIASGFIE
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 38420 Sequence Length: 338 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q7MBC9
MTSSPKIVAALSGGVDSSVAAALVRKQGYRVCGVTLWLMRGKGSCCSDGMKDAARVCEQLDIPHHIVDIRQQFEETIVDFLVEGYREGITPLPCSRCNKELKFGLLLEYARRKLGIGTVATGHYARTGFDGQTGRHWLARAVDRTKDQSYFLYDLSQEQLASAVFPLGEMTKDQTRTLAAELGLSVAHKPESMDLCLVEAAGSMRNFLNAHIDTRRGEIVDTSGKILGEHDGAHHYTVGQRRGLGVAAPYPLYVVAVDAANNRVVVGAREEATACECTVGQVNWVSMAEPEAPIQAEVQVRYRSQPVQATIIPLPARGARIAFDDAPQFAISPGQAAVWYAGERVLGGGIILASGRS
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 38614 Sequence Length: 357 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q5FR73
MRILVAMSGGVDSSVVAALLKRQGHEVIGATLQLYDHGQAAKPGACCAGRDIMDARAVADRLGFPHYVIDAESRFRDSVVESFADAYARGETPVPCVACNQGVKFTDLLGMARDLGCEAMATGHYVRRVEGPEGAEMHRPVDAERDQTWFLFATTKDQLDYLRFPLGEMPDKAHVRALAQELGLEIAAKPDSQDICFVPSGSYAELVEKLRPEVRGEGEIVDEDGRVLGRHEGVARYTVGQSKRLGDIHTATGERQMVTRIDVPKRRIVVGPRVQVSEADSRRSVRLRDMNWLIDAPAEGVRCGVQIRAREKLREALVKPLENGGALVELTEAAMPAPGQACVLYDGSRVLGGGFITAGDA
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 39220 Sequence Length: 361 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q2SJL8
MSTHRNQRVIVGISGGVDSSVSAYLLKALGYEVEGLFMKNWDEDDGTEYCTALSDLEDAQKVCDKLGIKLHTASFSAEYWDRVFEHFLDEYRAGRTPNPDILCNKEIKFKAFLDYAQALGGDLIATGHYAQFSRFGEHTYLMKGADPSKEQSYFLHAVPGQALARTLFPVGGLLKKEVRRIARELDLITHDKKDSTGICFIGERKFSDFLKTYLPAQPGKIVTDKGEEIGRHQGLMYHTIGQRQGLGIGGLKGYDDAPWYVVEKDLDNNELVVAQGGDHPRLFSAGLTASKLDWINGVPAKSSFSCYAKTRYRQPDQLCRVDVQDGGVRVTFDKRQRAVTPGQSVVFYDGARCLGGGVIESVFK
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 40487 Sequence Length: 364 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q9KDF2
MEAKRPEQTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYQDVVQVCNQLGIAYYAVNFEKEYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLNHALTLGADYVATGHYAQVKNVDGQYQLIRGKDPNKDQTYFLNALSQQQLSRVMFPLGHLEKKEVRAIAERAGLATAKKKDSTGICFIGKRDFKEFLSSYLPAQPGEMQTLDGEVKGTHDGLMYYTLGQRQGLGIGGSGEPWFVIGKNLEKNILYVGQGFHHPGLYSEGLRAIKVNWILRRESDEPFECTAKFRYRQPDQKVTVYPQSDGAVEVLFAEPQRAITPGQAVVFYDGDVCLGGGTIDHVLKKKEDRESA
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 41625 Sequence Length: 371 Subcellular Location: Cytoplasm EC: 2.8.1.13
A1WWV9
MTESPKRIVVGLSGGVDSAVAALRLVRAGHEVIGLFMKNWEDDDTLTQCSAEDDIAAAVAVAEHLGIPIRRVNFAAHYRREVFEHALQELRAGRTPNPDILCNRHVKFDRFLRHAREQFEADAVATGHYARTGRAGDGEPALLRGIDPSKDQSYFLAGVPRQALDAVRFPLGDSTKETVRAEARSAALPNFDRPDSTGICFIGERDFTQFMQRYIDPHPGPILTEDGREIGRHCGLAFYTLGQRRGLGIGGDRNRDSSAPWYVAGKDARRNALFVVQGHDHPWLQSAAVSTEPFHWLAPVPAEGARLHAQVRYRQEPQAGQLSHAEGGRVVFRFDEPQRAATPGQHLVLYDREQCLGGGVIDTAHPADRSAPPALQTQSTEVV
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 42167 Sequence Length: 383 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q98HL0
MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCCAGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFADLLATAKELGADALATGHYIRSGANGAHRALYRPVDADRDQSYFLFATTQAQIDYLRFPLGGLSKPQVRAIAEEMGLTVAAKQDSQDICFVPQGKYSDIIAKLKPAAANPGDIVHIDGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDAERARVVVGPREALETHKIYLRNMNWLGDGPLGDIPEGGLELFAKVRSTRPPRPAVLRYVAGVTSVELADGESGIAPGQACVLYSDDGNEARVFGGGFIERSERGAEAEAMLTKLAARPAQIPAE
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 42537 Sequence Length: 396 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q7TTZ4
MSRVVLAMSGGVDSSVAAHLLLRDGHEVIGVFMRHGEASAAACRIDSDEPQNTNPLNLPVLGDSAGGKRADHKQGCCSATDAADARRVAMSMGIPFYSLDLQEDFRKIVDYFVDDYLAARTPNPCVKCNHWIKFGRLFDYADGVDAEFVATGHYARMVHSNGRSELHRGLDGHKDQSYALFGIDPARLSRMMLPVGDFTKPEIREMATSLGLGVSDKKDSQEICFVTQGHHSDFVKSRRPEMVGATAGEIVTTGGKVVGEHKGFEAFTIGQRKRLGVAMGEPHFVIRIEPDTRRVVIGRAEELLRPGLVADQCNWFVTREELADAQSVGIQIRYNGQPHPGHVVMDGSDPTRMKVMFDDPQAAVAPGQAAVVYDGERVLGGGWITHAIDHIADGSPPPA
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 43371 Sequence Length: 399 Subcellular Location: Cytoplasm EC: 2.8.1.13
Q07SU0
MLNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGEAIHRKGACCAGQDIHDARTVAERIGIPHYVLDYESRFRESVIDSFATSYATGETPVPCIECNRSIKFRDLLSTARELGAAVLATGHYVSSRRLPDGSRALVCAADADRDQSYFLFATTREQLDFLRFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPSGRYSDVVGRLKPNAMEPGDIVDLDGRVLGKHHGIVHFTVGQRRGLGIASHAPLYVLRLEPSTRRVVVGPRAALRMDRILLRDVNWIGDNSLDLAVGDGLEMFVRVRSTRRPQPAWLRAIDGEYQVELIAGEDGVSPGQACVFYDAPEGQARVLGGGFIKSAAPRAANKDARGAAAANRPLAAGVRG
Function: Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. Catalytic Activity: AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine(34) in tRNA = 2-thiouridine(34) in tRNA + A + AMP + diphosphate + H(+) + L-cysteinyl-[protein] Sequence Mass (Da): 43369 Sequence Length: 400 Subcellular Location: Cytoplasm EC: 2.8.1.13
A1TRM7
MSEPIDWLPDGTPFNPRFGDRYHSHTGLAQAREVFLRGCGLPGAWAGQAMWRVLETGFGCGLNFLATWAAWRADPARPRLLHFVSCEAFPVSADDLLRSMQGHGELEPLARALHAQYWGLLPGVHRLAFEGGQVLLTLYIGDAQAMLRQQQPVADAVYLDGFSPQVNPELWDVHTLKAVARCCRRGTRLATWSVAGAVREGLAQCGFRVQKVPGLPPKRSNLQAEFDPAWEPRPVQPELPDVRVAGGPSSVLVIGGGLSGAAVAASLARRGWQVRVLDQGAEPAAGASGLPAGVFAPHVSPDDSLLSRLSRCGVRATLQALEASGLSEGEDWSACGVLEHEVDGKHRLPPAWAGDAAVGAEWSRPADAAALEAAGLPGATVAYWHARGGWLRPARLVRALLAHPGIHWQGRSAVARLEPVAAPGGATHWQAYGSDGTVLAEAPHVVVAAGYGSRPWLPARYPIHPLRGQVSWGTRADSPAAAWPPFPVNGHGNLVPHAGTAGGGIWVMGSTFERGQTELPPAPQEQAQAHAANAAKLEQLLPALAQGLAPAIAGPGAAPGHWAAVRCTAPDRLPFVGPVDAARQAGLWVCAAMGARGLTLSQLCGELLAARMMGEPLPVEVRLARALSTERLPAD
Function: Catalyzes the last two steps in the biosynthesis of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at the wobble position (U34) in tRNA. Catalyzes the FAD-dependent demodification of cmnm(5)s(2)U34 to nm(5)s(2)U34, followed by the transfer of a methyl group from S-adenosyl-L-methionine to nm(5)s(2)U34, to form mnm(5)s(2)U34. Catalytic Activity: 5-aminomethyl-2-thiouridine(34) in tRNA + S-adenosyl-L-methionine = 5-methylaminomethyl-2-thiouridine(34) in tRNA + H(+) + S-adenosyl-L-homocysteine Sequence Mass (Da): 66954 Sequence Length: 635 Subcellular Location: Cytoplasm
B0V636
MNKSNRIQTAELDWESIDGIEVPISKQFGDVYFSKDNGLLETRHVFLNGNDLSERLANLQDFEYFSVGETGFGTGLNILALWQLWQQVRPNNHSHLHAISVEKFPLSKADLIRALNVWDELKPLSKQLIEQYPLPLAGCHRLSFPEERFSIDLWLGDAQDIFPSMVKTKAVNAWFLDGFAPSCNPDMWEQNVLNNIVRLSNYGTTFASFSVAGVLKRGLKAHGIDISRPRGFGHKREMLKAIWKAPVSEEILFEPVSDTFHFTQQRIAIIGAGIAGLSTAWAFAQRGHQVTLFERTAPLSGASGNPLALLNPKLCPIEQSHEHLMTLSWQHALNFYKNFQAFRPIQIQQMALKNAQDLLDLTNQYPADIVTQQTSSLESDYPHIILTEAGAVSPHQLRDEILQHPGIELKIANITTLVSFENKVQLKSGNETTLEADHVVVCCARESAALFENYPLLKPIRGQVSWVDNSFATLPLHEAYSYGGYCMQLNTSELILGASFYPNRDDQEVLLDDHVHNFELIHSVFPHYAKQLPPVEQWQGRASVRAQSPDYFPVVGKMQNESRISTFAGLGSKGFLFAPLCSEVLVAQILGEAYPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ
Function: Catalyzes the last two steps in the biosynthesis of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at the wobble position (U34) in tRNA. Catalyzes the FAD-dependent demodification of cmnm(5)s(2)U34 to nm(5)s(2)U34, followed by the transfer of a methyl group from S-adenosyl-L-methionine to nm(5)s(2)U34, to form mnm(5)s(2)U34. Catalytic Activity: 5-aminomethyl-2-thiouridine(34) in tRNA + S-adenosyl-L-methionine = 5-methylaminomethyl-2-thiouridine(34) in tRNA + H(+) + S-adenosyl-L-homocysteine Sequence Mass (Da): 70136 Sequence Length: 623 Subcellular Location: Cytoplasm
A1W6V9
MSEPIEWLEDGTPYSPRFSDRYHSEHGGLEQARGTFLAGCGLPQAWQNQPQWRVLETGFGLGLNFLVTWAAWRADPHRPQRLHFVSCEAWPVSAADLLRAAPIDSTLQSLAQQLAAQYWGLLPGVHRLSFDGGQVLLTLYIGDAQALLRQQQPTADSVYLDGFDPQHNPQMWDIHTLKAVARCCRRGTRLATWTVARGVRDGLVQCGFEVQKVPGVRPKRDNLQATYAPRWEPRAGQPVLPDATVAAPARCLVVGAGLAGAAVAASLAHRGWQVQVLDRADHPAAGASGLPAGVFAPNVSQDDNLISRLSRAGVRITLNTLAQLPAETRGTDWSACGTLEHRVDGTTGLAWSDGPGLDWSRPATPAQLQANGLSADTVACWHEHAGWVRPPQLIAHLLNDPAIRWRGSAAVAELRRTTVDGQPLWQALDAEGHVLAEAELAVVCAGHHTGPLTHAHWPMNPLRGQLAWGLHAQAPAGAPWPPQPLNGNGNLVPRVPLQDGAGWVLGSTFERLKTALPPSPDDHAKGLATNQAKLHALLPPLGAAMDAAFSQAATAPDGPVRTWAAVRCGALDRRPIVGPVDSVRQPGLWLCTAMGARGLTLSLLCGELIAARLHSEPLPLDAPLARALSSERWLGYEPQ
Function: Catalyzes the last two steps in the biosynthesis of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at the wobble position (U34) in tRNA. Catalyzes the FAD-dependent demodification of cmnm(5)s(2)U34 to nm(5)s(2)U34, followed by the transfer of a methyl group from S-adenosyl-L-methionine to nm(5)s(2)U34, to form mnm(5)s(2)U34. Catalytic Activity: 5-aminomethyl-2-thiouridine(34) in tRNA + S-adenosyl-L-methionine = 5-methylaminomethyl-2-thiouridine(34) in tRNA + H(+) + S-adenosyl-L-homocysteine Sequence Mass (Da): 68618 Sequence Length: 639 Subcellular Location: Cytoplasm
Q21WM8
MVELAAATCLHECGLPQAWCKQEAWRILETRFGQGLHFLTTWQAWRNDPQRPRMLHYVAVTAAPPDIDELLAGMASSPELLLLAKELAPQCLGLSTGFQRLTFDGGHVLLTLCVGDLTAMLRAQQFAADSIYLTPDPTDCPDRCAASNWRVWTAKALARCCRRGTTLVAPVDADHLYADLTQCGFELSTIQAGQPTGPEAAPTNISLRAQFNPRWTIKNTRNTLPARAMAVSSCAVIGAGLAGASVAASLARRGWQVQVLDQAHTPAAGASGLPVGLVVPHVSADDCVLSRLSRSGVRLMLQQARSLLRQGQDWDATGVLERRLDGPPGVPDIWHPQAAWLKPTQLVRAWLAQLGITFQGDAKVAALRQRGDEWELLDTDGGMLHRASRVVFANAGGAMALLDTLQARLPALNIRVNQFPVMQGVRGQVSWAMHTGLPDETFPPFPINGAGSIVPWVPVDEDCGQNLAWFVGASYQPDSQPPAPDEKNHATNLARLHKLSPKLGQALAGKFAAGAVNAWKNTRCVTADRLPAVGPLDQVDHPGLWMCAGMGSRGLSFSMLCAELLAARWSGEPLPIDAGLARTLEARRGADCHRNRLDRSPELPVSCAP
Function: Catalyzes the last two steps in the biosynthesis of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at the wobble position (U34) in tRNA. Catalyzes the FAD-dependent demodification of cmnm(5)s(2)U34 to nm(5)s(2)U34, followed by the transfer of a methyl group from S-adenosyl-L-methionine to nm(5)s(2)U34, to form mnm(5)s(2)U34 (By similarity). Catalytic Activity: 5-aminomethyl-2-thiouridine(34) in tRNA + S-adenosyl-L-methionine = 5-methylaminomethyl-2-thiouridine(34) in tRNA + H(+) + S-adenosyl-L-homocysteine Sequence Mass (Da): 65624 Sequence Length: 609 Subcellular Location: Cytoplasm