contestId
int64
0
1.01k
index
stringclasses
40 values
name
stringlengths
2
54
type
stringclasses
2 values
rating
int64
0
3.4k
tags
listlengths
0
7
title
stringclasses
393 values
time-limit
stringclasses
7 values
memory-limit
stringclasses
6 values
problem-description
stringlengths
0
2.97k
input-specification
stringlengths
4
1.87k
output-specification
stringlengths
4
1.12k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
3.5k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
1 value
testset
stringclasses
9 values
passedTestCount
int64
1
402
timeConsumedMillis
int64
15
8.06k
memoryConsumedBytes
int64
0
514M
code
stringlengths
11
61.4k
prompt
stringlengths
297
7.35k
response
stringlengths
25
61.4k
score
float64
2.82
3.99
189
A
Cut Ribbon
PROGRAMMING
1,300
[ "brute force", "dp" ]
null
null
Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting.
The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide.
Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists.
[ "5 5 3 2\n", "7 5 5 2\n" ]
[ "2\n", "2\n" ]
In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
500
[ { "input": "5 5 3 2", "output": "2" }, { "input": "7 5 5 2", "output": "2" }, { "input": "4 4 4 4", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "4000 1 2 3", "output": "4000" }, { "input": "4000 3 4 5", "output": "1333" }, { "input": "10 3 4 5", "output": "3" }, { "input": "100 23 15 50", "output": "2" }, { "input": "3119 3515 1021 7", "output": "11" }, { "input": "918 102 1327 1733", "output": "9" }, { "input": "3164 42 430 1309", "output": "15" }, { "input": "3043 317 1141 2438", "output": "7" }, { "input": "26 1 772 2683", "output": "26" }, { "input": "370 2 1 15", "output": "370" }, { "input": "734 12 6 2", "output": "367" }, { "input": "418 18 14 17", "output": "29" }, { "input": "18 16 28 9", "output": "2" }, { "input": "14 6 2 17", "output": "7" }, { "input": "29 27 18 2", "output": "2" }, { "input": "29 12 7 10", "output": "3" }, { "input": "27 23 4 3", "output": "9" }, { "input": "5 14 5 2", "output": "1" }, { "input": "5 17 26 5", "output": "1" }, { "input": "9 1 10 3", "output": "9" }, { "input": "2 19 15 1", "output": "2" }, { "input": "4 6 4 9", "output": "1" }, { "input": "10 6 2 9", "output": "5" }, { "input": "2 2 9 6", "output": "1" }, { "input": "6 2 4 1", "output": "6" }, { "input": "27 24 5 27", "output": "1" }, { "input": "2683 83 26 2709", "output": "101" }, { "input": "728 412 789 158", "output": "3" }, { "input": "3964 4 2916 176", "output": "991" }, { "input": "3399 2035 2 3334", "output": "683" }, { "input": "3455 244 3301 3", "output": "991" }, { "input": "595 2263 3625 1", "output": "595" }, { "input": "4000 1 1 1", "output": "4000" }, { "input": "3999 2 2 3999", "output": "1" }, { "input": "25 6 8 11", "output": "3" }, { "input": "4000 500 1000 2000", "output": "8" }, { "input": "53 10 11 23", "output": "5" }, { "input": "100 100 1 1", "output": "100" }, { "input": "17 3 4 10", "output": "5" }, { "input": "413 101 102 105", "output": "4" }, { "input": "490 4 49 50", "output": "111" }, { "input": "3999 2 3 3", "output": "1999" }, { "input": "8 3 8 4", "output": "2" }, { "input": "5 1 3 3", "output": "5" }, { "input": "100 3 17 22", "output": "27" }, { "input": "4000 2 3 4", "output": "2000" }, { "input": "4000 3 3 5", "output": "1332" }, { "input": "13 4 6 7", "output": "2" }, { "input": "4000 5 2 2", "output": "2000" }, { "input": "3999 2 2 3", "output": "1999" }, { "input": "4000 33 7 3333", "output": "564" }, { "input": "60 33 20 9", "output": "4" }, { "input": "100 9 11 99", "output": "10" }, { "input": "2009 6 8 9", "output": "334" } ]
1,697,217,095
2,147,483,647
PyPy 3-64
OK
TESTS
58
93
2,150,400
n, a, b, c = map(int, input().split()) lst = list(set([a, b, c])) dp = [0] * (n + 1) dp[0] = 1 for k in range(n + 1): for i in range(len(lst)): if (k + lst[i]) <= n and dp[k] != 0: dp[k + lst[i]] = max(dp[k + lst[i]], dp[k] + 1) print(dp[n] - 1)
Title: Cut Ribbon Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting. Input Specification: The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide. Output Specification: Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists. Demo Input: ['5 5 3 2\n', '7 5 5 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
```python n, a, b, c = map(int, input().split()) lst = list(set([a, b, c])) dp = [0] * (n + 1) dp[0] = 1 for k in range(n + 1): for i in range(len(lst)): if (k + lst[i]) <= n and dp[k] != 0: dp[k + lst[i]] = max(dp[k + lst[i]], dp[k] + 1) print(dp[n] - 1) ```
3
43
A
Football
PROGRAMMING
1,000
[ "strings" ]
A. Football
2
256
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]
[ "ABC\n", "A\n" ]
none
500
[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]
1,667,455,112
2,147,483,647
Python 3
OK
TESTS
34
62
0
n=int(input()) has={} for i in range(n): x=input() if x in has: has[x]=has[x]+1 else: has[x]=1 x=max(has.values()) for i in has.keys(): if has[i]==x: print(i)
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none
```python n=int(input()) has={} for i in range(n): x=input() if x in has: has[x]=has[x]+1 else: has[x]=1 x=max(has.values()) for i in has.keys(): if has[i]==x: print(i) ```
3.9845
358
D
Dima and Hares
PROGRAMMING
1,800
[ "dp", "greedy" ]
null
null
Dima liked the present he got from Inna very much. He liked the present he got from Seryozha even more. Dima felt so grateful to Inna about the present that he decided to buy her *n* hares. Inna was very happy. She lined up the hares in a row, numbered them from 1 to *n* from left to right and started feeding them with carrots. Inna was determined to feed each hare exactly once. But in what order should she feed them? Inna noticed that each hare radiates joy when she feeds it. And the joy of the specific hare depends on whether Inna fed its adjacent hares before feeding it. Inna knows how much joy a hare radiates if it eats when either both of his adjacent hares are hungry, or one of the adjacent hares is full (that is, has been fed), or both of the adjacent hares are full. Please note that hares number 1 and *n* don't have a left and a right-adjacent hare correspondingly, so they can never have two full adjacent hares. Help Inna maximize the total joy the hares radiate. :)
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=3000) — the number of hares. Then three lines follow, each line has *n* integers. The first line contains integers *a*1 *a*2 ... *a**n*. The second line contains *b*1,<=*b*2,<=...,<=*b**n*. The third line contains *c*1,<=*c*2,<=...,<=*c**n*. The following limits are fulfilled: 0<=≤<=*a**i*,<=*b**i*,<=*c**i*<=≤<=105. Number *a**i* in the first line shows the joy that hare number *i* gets if his adjacent hares are both hungry. Number *b**i* in the second line shows the joy that hare number *i* radiates if he has exactly one full adjacent hare. Number *с**i* in the third line shows the joy that hare number *i* radiates if both his adjacent hares are full.
In a single line, print the maximum possible total joy of the hares Inna can get by feeding them.
[ "4\n1 2 3 4\n4 3 2 1\n0 1 1 0\n", "7\n8 5 7 6 1 8 9\n2 7 9 5 4 3 1\n2 3 3 4 1 1 3\n", "3\n1 1 1\n1 2 1\n1 1 1\n" ]
[ "13\n", "44\n", "4\n" ]
none
2,000
[ { "input": "4\n1 2 3 4\n4 3 2 1\n0 1 1 0", "output": "13" }, { "input": "7\n8 5 7 6 1 8 9\n2 7 9 5 4 3 1\n2 3 3 4 1 1 3", "output": "44" }, { "input": "3\n1 1 1\n1 2 1\n1 1 1", "output": "4" }, { "input": "7\n1 3 8 9 3 4 4\n6 0 6 6 1 8 4\n9 6 3 7 8 8 2", "output": "42" }, { "input": "2\n3 5\n9 8\n4 0", "output": "14" }, { "input": "7\n3 6 1 5 4 2 0\n9 7 3 7 2 6 0\n1 6 5 7 5 4 1", "output": "37" }, { "input": "1\n0\n1\n4", "output": "0" }, { "input": "1\n7\n1\n7", "output": "7" }, { "input": "8\n7 3 3 5 9 9 8 1\n8 2 6 6 0 3 8 0\n1 2 5 0 9 4 7 8", "output": "49" }, { "input": "6\n1 2 0 1 6 4\n0 6 1 8 9 8\n4 1 4 3 9 8", "output": "33" }, { "input": "1\n0\n0\n0", "output": "0" }, { "input": "1\n100000\n100000\n100000", "output": "100000" } ]
1,547,795,454
2,147,483,647
Python 3
OK
TESTS
29
109
614,400
""" Created on Fri Jan 18 12:23:03 2019 @author: nm57315 """ n = int(input()) a,b,c = (list(map(int,input().strip().split())) for x in range(3)) d,e = a[0],b[0] for x in range(1,n): d,e = max(e+a[x],d+b[x]),max(e+b[x],d+c[x]) print(d)
Title: Dima and Hares Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dima liked the present he got from Inna very much. He liked the present he got from Seryozha even more. Dima felt so grateful to Inna about the present that he decided to buy her *n* hares. Inna was very happy. She lined up the hares in a row, numbered them from 1 to *n* from left to right and started feeding them with carrots. Inna was determined to feed each hare exactly once. But in what order should she feed them? Inna noticed that each hare radiates joy when she feeds it. And the joy of the specific hare depends on whether Inna fed its adjacent hares before feeding it. Inna knows how much joy a hare radiates if it eats when either both of his adjacent hares are hungry, or one of the adjacent hares is full (that is, has been fed), or both of the adjacent hares are full. Please note that hares number 1 and *n* don't have a left and a right-adjacent hare correspondingly, so they can never have two full adjacent hares. Help Inna maximize the total joy the hares radiate. :) Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=3000) — the number of hares. Then three lines follow, each line has *n* integers. The first line contains integers *a*1 *a*2 ... *a**n*. The second line contains *b*1,<=*b*2,<=...,<=*b**n*. The third line contains *c*1,<=*c*2,<=...,<=*c**n*. The following limits are fulfilled: 0<=≤<=*a**i*,<=*b**i*,<=*c**i*<=≤<=105. Number *a**i* in the first line shows the joy that hare number *i* gets if his adjacent hares are both hungry. Number *b**i* in the second line shows the joy that hare number *i* radiates if he has exactly one full adjacent hare. Number *с**i* in the third line shows the joy that hare number *i* radiates if both his adjacent hares are full. Output Specification: In a single line, print the maximum possible total joy of the hares Inna can get by feeding them. Demo Input: ['4\n1 2 3 4\n4 3 2 1\n0 1 1 0\n', '7\n8 5 7 6 1 8 9\n2 7 9 5 4 3 1\n2 3 3 4 1 1 3\n', '3\n1 1 1\n1 2 1\n1 1 1\n'] Demo Output: ['13\n', '44\n', '4\n'] Note: none
```python """ Created on Fri Jan 18 12:23:03 2019 @author: nm57315 """ n = int(input()) a,b,c = (list(map(int,input().strip().split())) for x in range(3)) d,e = a[0],b[0] for x in range(1,n): d,e = max(e+a[x],d+b[x]),max(e+b[x],d+c[x]) print(d) ```
3
509
B
Painting Pebbles
PROGRAMMING
1,300
[ "constructive algorithms", "greedy", "implementation" ]
null
null
There are *n* piles of pebbles on the table, the *i*-th pile contains *a**i* pebbles. Your task is to paint each pebble using one of the *k* given colors so that for each color *c* and any two piles *i* and *j* the difference between the number of pebbles of color *c* in pile *i* and number of pebbles of color *c* in pile *j* is at most one. In other words, let's say that *b**i*,<=*c* is the number of pebbles of color *c* in the *i*-th pile. Then for any 1<=≤<=*c*<=≤<=*k*, 1<=≤<=*i*,<=*j*<=≤<=*n* the following condition must be satisfied |*b**i*,<=*c*<=-<=*b**j*,<=*c*|<=≤<=1. It isn't necessary to use all *k* colors: if color *c* hasn't been used in pile *i*, then *b**i*,<=*c* is considered to be zero.
The first line of the input contains positive integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100), separated by a space — the number of piles and the number of colors respectively. The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) denoting number of pebbles in each of the piles.
If there is no way to paint the pebbles satisfying the given condition, output "NO" (without quotes) . Otherwise in the first line output "YES" (without quotes). Then *n* lines should follow, the *i*-th of them should contain *a**i* space-separated integers. *j*-th (1<=≤<=*j*<=≤<=*a**i*) of these integers should be equal to the color of the *j*-th pebble in the *i*-th pile. If there are several possible answers, you may output any of them.
[ "4 4\n1 2 3 4\n", "5 2\n3 2 4 1 3\n", "5 4\n3 2 4 3 5\n" ]
[ "YES\n1\n1 4\n1 2 4\n1 2 3 4\n", "NO\n", "YES\n1 2 3\n1 3\n1 2 3 4\n1 3 4\n1 1 2 3 4\n" ]
none
0
[ { "input": "4 4\n1 2 3 4", "output": "YES\n1 \n1 1 \n1 1 2 \n1 1 2 3 " }, { "input": "5 2\n3 2 4 1 3", "output": "NO" }, { "input": "5 4\n3 2 4 3 5", "output": "YES\n1 1 1 \n1 1 \n1 1 1 2 \n1 1 1 \n1 1 1 2 3 " }, { "input": "4 3\n5 6 7 8", "output": "YES\n1 1 1 1 1 \n1 1 1 1 1 1 \n1 1 1 1 1 1 2 \n1 1 1 1 1 1 2 3 " }, { "input": "5 6\n3 7 2 1 2", "output": "YES\n1 1 2 \n1 1 2 3 4 5 6 \n1 1 \n1 \n1 1 " }, { "input": "9 5\n5 8 7 3 10 1 4 6 3", "output": "NO" }, { "input": "2 1\n7 2", "output": "NO" }, { "input": "87 99\n90 28 93 18 80 94 68 58 72 45 93 72 11 54 54 48 74 63 73 7 4 54 42 67 8 13 89 32 2 26 13 94 28 46 77 95 94 63 60 7 16 55 90 91 97 80 7 97 8 12 1 32 43 20 79 38 48 22 97 11 92 97 100 41 72 2 93 68 26 2 79 36 19 96 31 47 52 21 12 86 90 83 57 1 4 81 87", "output": "YES\n1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 \n1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 \n1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 5..." }, { "input": "5 92\n95 10 4 28 56", "output": "YES\n1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 \n1 1 1 1 1 2 3 4 5 6 \n1 1 1 1 \n1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 \n1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43..." }, { "input": "96 99\n54 72 100 93 68 36 73 98 79 31 51 88 53 65 69 84 19 65 52 19 62 12 80 45 100 45 78 93 70 56 57 97 21 70 55 15 95 100 51 44 93 1 67 29 4 39 57 82 81 66 66 89 42 18 48 70 81 67 17 62 70 76 79 82 70 26 66 22 16 8 49 23 16 30 46 71 36 20 96 18 53 5 45 5 96 66 95 20 87 3 45 4 47 22 24 7", "output": "YES\n1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 \n1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 \n1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 5..." }, { "input": "56 97\n96 81 39 97 2 75 85 17 9 90 2 31 32 10 42 87 71 100 39 81 2 38 90 81 96 7 57 23 2 25 5 62 22 61 47 94 63 83 91 51 8 93 33 65 38 50 5 64 76 57 96 19 13 100 56 39", "output": "NO" }, { "input": "86 98\n27 94 18 86 16 11 74 59 62 64 37 84 100 4 48 6 37 11 50 73 11 30 87 14 89 55 35 8 99 63 54 16 99 20 40 91 75 18 28 36 31 76 98 40 90 41 83 32 81 61 81 43 5 36 33 35 63 15 86 38 63 27 21 2 68 67 12 55 36 79 93 93 29 5 22 52 100 17 81 50 6 42 59 57 83 20", "output": "YES\n1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 \n1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 \n1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 \n1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 4..." }, { "input": "21 85\n83 25 85 96 23 80 54 14 71 57 44 88 30 92 90 61 17 80 59 85 12", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 6..." }, { "input": "87 71\n44 88 67 57 57 80 69 69 40 32 92 54 64 51 69 54 31 53 29 42 32 85 100 90 46 56 40 46 68 81 60 42 99 89 61 96 48 42 78 95 71 67 30 42 57 82 41 76 29 79 32 62 100 89 81 55 88 90 86 54 54 31 28 67 69 49 45 54 68 77 64 32 60 60 66 66 83 57 56 89 57 82 73 86 60 61 62", "output": "NO" }, { "input": "63 87\n12 63 17 38 52 19 27 26 24 40 43 12 84 99 59 37 37 12 36 88 22 56 55 57 33 64 45 71 85 73 84 38 51 36 14 15 98 68 50 33 92 97 44 79 40 60 43 15 52 58 38 95 74 64 77 79 85 41 59 55 43 29 27", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 \n1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 \n1 ..." }, { "input": "39 39\n87 88 86 86 96 70 79 64 85 80 81 74 64 65 90 64 83 78 96 63 78 80 62 62 76 89 69 73 100 100 99 69 69 89 97 64 94 94 71", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "100 67\n82 34 100 55 38 32 97 34 100 49 49 41 48 100 74 51 53 50 46 38 35 69 93 61 96 86 43 59 90 45 52 100 48 45 63 60 52 66 83 46 66 47 74 37 56 48 42 88 39 68 38 66 77 40 60 60 92 38 45 57 63 91 85 85 89 53 64 66 99 89 49 54 48 58 94 65 78 34 78 62 95 47 64 50 84 52 98 79 57 69 39 61 92 46 63 45 90 51 79 39", "output": "NO" }, { "input": "100 35\n99 90 67 85 68 67 76 75 77 78 81 85 98 88 70 77 89 87 68 91 83 74 70 65 74 86 82 79 81 93 80 66 93 72 100 99 96 66 89 71 93 80 74 97 73 80 93 81 70 68 80 72 75 70 78 67 73 79 76 75 77 78 85 96 72 84 100 68 77 71 79 91 75 100 67 94 73 79 88 73 92 71 68 66 81 68 81 73 69 75 76 84 70 82 66 83 89 90 79 91", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "100 15\n92 87 87 99 91 87 94 94 97 90 98 90 91 95 99 97 95 100 93 95 92 100 87 87 94 89 90 99 89 99 95 90 89 88 92 97 88 86 86 95 96 92 89 89 86 92 89 89 100 100 95 86 86 97 97 98 89 88 97 89 93 100 99 99 93 92 87 97 91 90 96 86 99 86 87 95 99 100 88 86 86 93 100 88 88 89 94 88 88 95 89 86 99 98 91 97 87 88 100 94", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "17 1\n79 79 79 79 79 79 79 79 79 79 79 79 79 79 79 79 79", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "27 2\n53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "48 3\n85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85 85", "output": "YES\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "1 1\n1", "output": "YES\n1 " }, { "input": "1 100\n1", "output": "YES\n1 " } ]
1,604,160,579
2,147,483,647
Python 3
OK
TESTS
24
109
0
num_pilhas, c_cores = map(int, input().split()) pilhas = list(map(int, input().split())) # |bi, c - bj, c| ≤ 1 if max(pilhas) - min(pilhas) > c_cores: print('NO') else: print('YES') for i in range(num_pilhas): pilhas_colorida = [] for j in range(pilhas[i]): cor = j % c_cores + 1 pilhas_colorida.append(str(cor)) print(' '.join(pilhas_colorida))
Title: Painting Pebbles Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* piles of pebbles on the table, the *i*-th pile contains *a**i* pebbles. Your task is to paint each pebble using one of the *k* given colors so that for each color *c* and any two piles *i* and *j* the difference between the number of pebbles of color *c* in pile *i* and number of pebbles of color *c* in pile *j* is at most one. In other words, let's say that *b**i*,<=*c* is the number of pebbles of color *c* in the *i*-th pile. Then for any 1<=≤<=*c*<=≤<=*k*, 1<=≤<=*i*,<=*j*<=≤<=*n* the following condition must be satisfied |*b**i*,<=*c*<=-<=*b**j*,<=*c*|<=≤<=1. It isn't necessary to use all *k* colors: if color *c* hasn't been used in pile *i*, then *b**i*,<=*c* is considered to be zero. Input Specification: The first line of the input contains positive integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100), separated by a space — the number of piles and the number of colors respectively. The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) denoting number of pebbles in each of the piles. Output Specification: If there is no way to paint the pebbles satisfying the given condition, output "NO" (without quotes) . Otherwise in the first line output "YES" (without quotes). Then *n* lines should follow, the *i*-th of them should contain *a**i* space-separated integers. *j*-th (1<=≤<=*j*<=≤<=*a**i*) of these integers should be equal to the color of the *j*-th pebble in the *i*-th pile. If there are several possible answers, you may output any of them. Demo Input: ['4 4\n1 2 3 4\n', '5 2\n3 2 4 1 3\n', '5 4\n3 2 4 3 5\n'] Demo Output: ['YES\n1\n1 4\n1 2 4\n1 2 3 4\n', 'NO\n', 'YES\n1 2 3\n1 3\n1 2 3 4\n1 3 4\n1 1 2 3 4\n'] Note: none
```python num_pilhas, c_cores = map(int, input().split()) pilhas = list(map(int, input().split())) # |bi, c - bj, c| ≤ 1 if max(pilhas) - min(pilhas) > c_cores: print('NO') else: print('YES') for i in range(num_pilhas): pilhas_colorida = [] for j in range(pilhas[i]): cor = j % c_cores + 1 pilhas_colorida.append(str(cor)) print(' '.join(pilhas_colorida)) ```
3
664
A
Complicated GCD
PROGRAMMING
800
[ "math", "number theory" ]
null
null
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm. Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
[ "1 2\n", "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n" ]
[ "1\n", "61803398874989484820458683436563811772030917980576\n" ]
none
500
[ { "input": "1 2", "output": "1" }, { "input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576", "output": "61803398874989484820458683436563811772030917980576" }, { "input": "1 100", "output": "1" }, { "input": "100 100000", "output": "1" }, { "input": "12345 67890123456789123457", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "2 2", "output": "2" }, { "input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158", "output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158" }, { "input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751", "output": "1" }, { "input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794", "output": "1" }, { "input": "10000 1000000000", "output": "1" }, { "input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "11210171722243 65715435710585778347", "output": "1" }, { "input": "2921881079263974825226940825843 767693191032295360887755303860323261471", "output": "1" }, { "input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085", "output": "1" }, { "input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424", "output": "1" }, { "input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614", "output": "1" }, { "input": "15943150466658398903 15943150466658398903", "output": "15943150466658398903" }, { "input": "410470228200245407491525399055972 410470228200245407491525399055972", "output": "410470228200245407491525399055972" }, { "input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307", "output": "51894705655711504622197349350106792045098781545973899451307" }, { "input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410", "output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410" }, { "input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535", "output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535" }, { "input": "1 2000000000", "output": "1" }, { "input": "13 1928834874", "output": "1" }, { "input": "87 2938984237482934238", "output": "1" }, { "input": "213 413", "output": "1" }, { "input": "3 4", "output": "1" } ]
1,680,601,568
2,147,483,647
Python 3
OK
TESTS
28
46
0
import math def inp(): return(int(input())) def invr(): return(input()) def inlt(): return(list(map(int,input().split()))) def two(): return([int(a) for a in input().split()]) def insr(): s = input() return(list(s[:len(s) - 1])) a, b = two() if a == b: print(a) else: print(1)
Title: Complicated GCD Time Limit: None seconds Memory Limit: None megabytes Problem Description: Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm. Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type! Input Specification: The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100). Output Specification: Output one integer — greatest common divisor of all integers from *a* to *b* inclusive. Demo Input: ['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n'] Demo Output: ['1\n', '61803398874989484820458683436563811772030917980576\n'] Note: none
```python import math def inp(): return(int(input())) def invr(): return(input()) def inlt(): return(list(map(int,input().split()))) def two(): return([int(a) for a in input().split()]) def insr(): s = input() return(list(s[:len(s) - 1])) a, b = two() if a == b: print(a) else: print(1) ```
3
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,674,030,469
2,147,483,647
Python 3
OK
TESTS
30
31
0
a,b=map(int,input().split()) if(a>b): print(b,end=" ") a=a-b print(a//2,end=" ") else: print(a,end=" ") b=b-a print(b//2,end=" ")
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python a,b=map(int,input().split()) if(a>b): print(b,end=" ") a=a-b print(a//2,end=" ") else: print(a,end=" ") b=b-a print(b//2,end=" ") ```
3
608
A
Saitama Destroys Hotel
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Saitama accidentally destroyed a hotel again. To repay the hotel company, Genos has volunteered to operate an elevator in one of its other hotels. The elevator is special — it starts on the top floor, can only move down, and has infinite capacity. Floors are numbered from 0 to *s* and elevator initially starts on floor *s* at time 0. The elevator takes exactly 1 second to move down exactly 1 floor and negligible time to pick up passengers. Genos is given a list detailing when and on which floor passengers arrive. Please determine how long in seconds it will take Genos to bring all passengers to floor 0.
The first line of input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=100, 1<=≤<=*s*<=≤<=1000) — the number of passengers and the number of the top floor respectively. The next *n* lines each contain two space-separated integers *f**i* and *t**i* (1<=≤<=*f**i*<=≤<=*s*, 1<=≤<=*t**i*<=≤<=1000) — the floor and the time of arrival in seconds for the passenger number *i*.
Print a single integer — the minimum amount of time in seconds needed to bring all the passengers to floor 0.
[ "3 7\n2 1\n3 8\n5 2\n", "5 10\n2 77\n3 33\n8 21\n9 12\n10 64\n" ]
[ "11\n", "79\n" ]
In the first sample, it takes at least 11 seconds to bring all passengers to floor 0. Here is how this could be done: 1. Move to floor 5: takes 2 seconds. 2. Pick up passenger 3. 3. Move to floor 3: takes 2 seconds. 4. Wait for passenger 2 to arrive: takes 4 seconds. 5. Pick up passenger 2. 6. Go to floor 2: takes 1 second. 7. Pick up passenger 1. 8. Go to floor 0: takes 2 seconds. This gives a total of 2 + 2 + 4 + 1 + 2 = 11 seconds.
500
[ { "input": "3 7\n2 1\n3 8\n5 2", "output": "11" }, { "input": "5 10\n2 77\n3 33\n8 21\n9 12\n10 64", "output": "79" }, { "input": "1 1000\n1000 1000", "output": "2000" }, { "input": "1 1\n1 1", "output": "2" }, { "input": "1 1000\n1 1", "output": "1000" }, { "input": "1 1000\n1 1000", "output": "1001" }, { "input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "2" }, { "input": "2 7\n6 3\n1 5", "output": "9" }, { "input": "2 100\n99 2\n1 10", "output": "101" }, { "input": "5 5\n1 1\n2 1\n3 1\n4 1\n5 1", "output": "6" }, { "input": "3 7\n1 6\n5 5\n6 1", "output": "10" }, { "input": "2 100\n4 100\n7 99", "output": "106" }, { "input": "2 10\n9 3\n1 4", "output": "12" }, { "input": "2 5\n4 4\n5 4", "output": "9" }, { "input": "2 10\n9 10\n6 11", "output": "19" }, { "input": "2 100\n99 9\n1 10", "output": "108" }, { "input": "2 7\n3 5\n7 4", "output": "11" }, { "input": "4 4\n4 6\n4 8\n1 7\n2 9", "output": "12" }, { "input": "2 1000\n1 2\n1000 1", "output": "1001" }, { "input": "2 20\n1 1\n2 2", "output": "20" }, { "input": "2 20\n10 10\n19 9", "output": "28" } ]
1,578,411,766
2,147,483,647
Python 3
OK
TESTS
39
109
512,000
n,s=map(int,input().split()) t=0 floor=[] pt=[] for i in range(0,n): a,b=map(int,input().split()) floor.append(a) pt.append(b) t=s-floor[n-1] for i in range(n-1,-1,-1): if i!=n-1: t += floor[i + 1] - floor[i] if pt[i]<=t: continue elif pt[i]>t: t=pt[i] t+=floor[0] print(t)
Title: Saitama Destroys Hotel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Saitama accidentally destroyed a hotel again. To repay the hotel company, Genos has volunteered to operate an elevator in one of its other hotels. The elevator is special — it starts on the top floor, can only move down, and has infinite capacity. Floors are numbered from 0 to *s* and elevator initially starts on floor *s* at time 0. The elevator takes exactly 1 second to move down exactly 1 floor and negligible time to pick up passengers. Genos is given a list detailing when and on which floor passengers arrive. Please determine how long in seconds it will take Genos to bring all passengers to floor 0. Input Specification: The first line of input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=100, 1<=≤<=*s*<=≤<=1000) — the number of passengers and the number of the top floor respectively. The next *n* lines each contain two space-separated integers *f**i* and *t**i* (1<=≤<=*f**i*<=≤<=*s*, 1<=≤<=*t**i*<=≤<=1000) — the floor and the time of arrival in seconds for the passenger number *i*. Output Specification: Print a single integer — the minimum amount of time in seconds needed to bring all the passengers to floor 0. Demo Input: ['3 7\n2 1\n3 8\n5 2\n', '5 10\n2 77\n3 33\n8 21\n9 12\n10 64\n'] Demo Output: ['11\n', '79\n'] Note: In the first sample, it takes at least 11 seconds to bring all passengers to floor 0. Here is how this could be done: 1. Move to floor 5: takes 2 seconds. 2. Pick up passenger 3. 3. Move to floor 3: takes 2 seconds. 4. Wait for passenger 2 to arrive: takes 4 seconds. 5. Pick up passenger 2. 6. Go to floor 2: takes 1 second. 7. Pick up passenger 1. 8. Go to floor 0: takes 2 seconds. This gives a total of 2 + 2 + 4 + 1 + 2 = 11 seconds.
```python n,s=map(int,input().split()) t=0 floor=[] pt=[] for i in range(0,n): a,b=map(int,input().split()) floor.append(a) pt.append(b) t=s-floor[n-1] for i in range(n-1,-1,-1): if i!=n-1: t += floor[i + 1] - floor[i] if pt[i]<=t: continue elif pt[i]>t: t=pt[i] t+=floor[0] print(t) ```
3
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,594,557,629
2,147,483,647
Python 3
OK
TESTS
30
248
6,656,000
s=input() ans="" i=0 while(i<len(s)): if(s[i]=='.'): ans +=str(0) i +=1 elif(s[i:i+2]=='-.'): ans +=str(1) i +=2 elif(s[i:i+2]=='--'): ans +=str(2) i +=2 print(ans)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python s=input() ans="" i=0 while(i<len(s)): if(s[i]=='.'): ans +=str(0) i +=1 elif(s[i:i+2]=='-.'): ans +=str(1) i +=2 elif(s[i:i+2]=='--'): ans +=str(2) i +=2 print(ans) ```
3.925602
278
B
New Problem
PROGRAMMING
1,500
[ "brute force", "strings" ]
null
null
Coming up with a new problem isn't as easy as many people think. Sometimes it is hard enough to name it. We'll consider a title original if it doesn't occur as a substring in any titles of recent Codeforces problems. You've got the titles of *n* last problems — the strings, consisting of lowercase English letters. Your task is to find the shortest original title for the new problem. If there are multiple such titles, choose the lexicographically minimum one. Note, that title of the problem can't be an empty string. A substring *s*[*l*... *r*] (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *s**l**s**l*<=+<=1... *s**r*. String *x*<==<=*x*1*x*2... *x**p* is lexicographically smaller than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=&lt;<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there exists such number *r* (*r*<=&lt;<=*p*,<=*r*<=&lt;<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=&lt;<=*y**r*<=+<=1. The string characters are compared by their ASCII codes.
The first line contains integer *n* (1<=≤<=*n*<=≤<=30) — the number of titles you've got to consider. Then follow *n* problem titles, one per line. Each title only consists of lowercase English letters (specifically, it doesn't contain any spaces) and has the length from 1 to 20, inclusive.
Print a string, consisting of lowercase English letters — the lexicographically minimum shortest original title.
[ "5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear\n", "4\naa\nbdefghijklmn\nopqrstuvwxyz\nc\n" ]
[ "j\n", "ab\n" ]
In the first sample the first 9 letters of the English alphabet (a, b, c, d, e, f, g, h, i) occur in the problem titles, so the answer is letter j. In the second sample the titles contain 26 English letters, so the shortest original title cannot have length 1. Title aa occurs as a substring in the first title.
1,000
[ { "input": "5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear", "output": "j" }, { "input": "4\naa\nbdefghijklmn\nopqrstuvwxyz\nc", "output": "ab" }, { "input": "1\na", "output": "b" }, { "input": "1\nb", "output": "a" }, { "input": "1\nz", "output": "a" }, { "input": "5\nsplt\nohqykk\nxqpz\nknojbur\npmfm", "output": "a" }, { "input": "2\nrxscdzkkezud\nwjehahqgouqvjienq", "output": "b" }, { "input": "2\nxlaxwpjabtpwddc\ntxwdjmohrrszorrnomc", "output": "e" }, { "input": "1\nepkotfpkkrhhmuipmtdk", "output": "a" }, { "input": "2\nhk\nobsp", "output": "a" }, { "input": "3\nrjnflsbpxqivrcdjptj\nvpojopbwbwbswdu\nrydkiwnugwddcgcrng", "output": "a" }, { "input": "10\nkpmwcdoysw\ngtpr\nkuzoxmiixxbl\ncrgqtuo\njhbplhpklrgwnaugdf\nzuxdaat\naycv\nqwghrkqwkobrgevsjrk\ntdxgc\nlxyzgcmbzulcst", "output": "ab" }, { "input": "30\nwaiphwcqrrinr\no\nqiqehzmgsjdoqd\nkjexeesevrlowxhghq\njudikhzkj\nz\nxo\nlsdzypkfqro\nsshgcxsky\ngecntpcmoojfwp\nsvmytmcfhc\njrsrvsvbaiumlmkptn\ns\nwpcsovfjlyspviflk\nktvyzvddgllht\nszahigtmklglrcocbo\nznligfxkgxzkcfeu\nliryvzmqwhr\nxgrxkgiehxztv\netrjxdczppafly\njrdgajschhwsci\ndoxnxbjwptnimjmsuijx\nzciwkbvrhgsjhrr\nehh\nbzlnmd\nxpbtbpftimnn\nkhbknqbvdkdd\nmldj\nskrvnyz\navptgpjmenfzfxwckmt", "output": "aa" }, { "input": "30\ne\nx\nitaubd\nxcn\nv\nx\ni\nci\naqs\nzbi\nq\ncvdu\na\njos\nqy\nfjf\nnayke\nge\ns\nq\nqwad\ngvz\no\nubn\nnzoc\nh\nwnjwjrf\nt\nbq\nbw", "output": "l" }, { "input": "30\nb\nu\np\nn\nf\nm\nt\ni\nj\nk\np\nh\na\nc\nw\nz\nz\np\nt\nd\no\nw\nu\nq\nl\ny\ni\no\na\nu", "output": "e" }, { "input": "5\nojdfhi\nabcdefghijklmnopqrst\nuvwxyz\nddfhdfhlasjt\nqqq", "output": "aa" }, { "input": "5\ndfijdfhi\nabcdefghijklmnopqrst\nuvwxy\nkopsdfgiopjipw\njty", "output": "z" }, { "input": "5\nzzxpfk\nabcdefghijklmnopqrst\nuvwxz\nsrgkjaskldfkln\nvgnsdfdgfh", "output": "y" } ]
1,591,732,695
2,147,483,647
PyPy 3
OK
TESTS
33
466
2,048,000
import string s=' '.join(input()for i in range(int(input()))) alph= string.ascii_lowercase for i in alph: if i not in s:print(i);exit() for i in alph: for j in alph: if i+j not in s:print(i+j);exit()
Title: New Problem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Coming up with a new problem isn't as easy as many people think. Sometimes it is hard enough to name it. We'll consider a title original if it doesn't occur as a substring in any titles of recent Codeforces problems. You've got the titles of *n* last problems — the strings, consisting of lowercase English letters. Your task is to find the shortest original title for the new problem. If there are multiple such titles, choose the lexicographically minimum one. Note, that title of the problem can't be an empty string. A substring *s*[*l*... *r*] (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *s**l**s**l*<=+<=1... *s**r*. String *x*<==<=*x*1*x*2... *x**p* is lexicographically smaller than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=&lt;<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there exists such number *r* (*r*<=&lt;<=*p*,<=*r*<=&lt;<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=&lt;<=*y**r*<=+<=1. The string characters are compared by their ASCII codes. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=30) — the number of titles you've got to consider. Then follow *n* problem titles, one per line. Each title only consists of lowercase English letters (specifically, it doesn't contain any spaces) and has the length from 1 to 20, inclusive. Output Specification: Print a string, consisting of lowercase English letters — the lexicographically minimum shortest original title. Demo Input: ['5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear\n', '4\naa\nbdefghijklmn\nopqrstuvwxyz\nc\n'] Demo Output: ['j\n', 'ab\n'] Note: In the first sample the first 9 letters of the English alphabet (a, b, c, d, e, f, g, h, i) occur in the problem titles, so the answer is letter j. In the second sample the titles contain 26 English letters, so the shortest original title cannot have length 1. Title aa occurs as a substring in the first title.
```python import string s=' '.join(input()for i in range(int(input()))) alph= string.ascii_lowercase for i in alph: if i not in s:print(i);exit() for i in alph: for j in alph: if i+j not in s:print(i+j);exit() ```
3
27
A
Next Test
PROGRAMMING
1,200
[ "implementation", "sortings" ]
A. Next Test
2
256
«Polygon» is a system which allows to create programming tasks in a simple and professional way. When you add a test to the problem, the corresponding form asks you for the test index. As in most cases it is clear which index the next test will have, the system suggests the default value of the index. It is calculated as the smallest positive integer which is not used as an index for some previously added test. You are to implement this feature. Create a program which determines the default index of the next test, given the indexes of the previously added tests.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=3000) — the amount of previously added tests. The second line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3000) — indexes of these tests.
Output the required default value for the next test index.
[ "3\n1 7 2\n" ]
[ "3\n" ]
none
500
[ { "input": "1\n1", "output": "2" }, { "input": "2\n2 1", "output": "3" }, { "input": "3\n3 4 1", "output": "2" }, { "input": "4\n6 4 3 5", "output": "1" }, { "input": "5\n3 2 1 7 4", "output": "5" }, { "input": "6\n4 1 2 5 3 7", "output": "6" }, { "input": "7\n3 2 1 6 5 7 4", "output": "8" }, { "input": "8\n2 8 3 7 6 9 1 5", "output": "4" }, { "input": "9\n10 5 9 3 8 7 1 2 4", "output": "6" }, { "input": "10\n7 2 3 8 9 6 5 4 1 10", "output": "11" }, { "input": "1\n1", "output": "2" }, { "input": "2\n1 2", "output": "3" }, { "input": "3\n2 4 1", "output": "3" }, { "input": "4\n4 2 3 1", "output": "5" }, { "input": "5\n3 1 4 2 5", "output": "6" }, { "input": "6\n1 3 6 7 2 4", "output": "5" }, { "input": "7\n1 5 4 7 2 3 6", "output": "8" }, { "input": "8\n12 1 6 5 2 8 3 4", "output": "7" }, { "input": "9\n3 2 7 5 6 4 1 9 10", "output": "8" }, { "input": "10\n1 7 13 6 5 10 3 8 2 4", "output": "9" }, { "input": "1\n2", "output": "1" }, { "input": "1\n3", "output": "1" }, { "input": "1\n3000", "output": "1" }, { "input": "2\n2 3", "output": "1" }, { "input": "2\n3000 1", "output": "2" } ]
1,602,926,875
2,147,483,647
PyPy 3
OK
TESTS
30
280
1,331,200
n=int(input()) l=list(map(int,input().split())) l.sort() c=1 for i in range(1,max(l)): if(i not in l): print(i) c=0 break if(c==1): print(max(l)+1)
Title: Next Test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: «Polygon» is a system which allows to create programming tasks in a simple and professional way. When you add a test to the problem, the corresponding form asks you for the test index. As in most cases it is clear which index the next test will have, the system suggests the default value of the index. It is calculated as the smallest positive integer which is not used as an index for some previously added test. You are to implement this feature. Create a program which determines the default index of the next test, given the indexes of the previously added tests. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=3000) — the amount of previously added tests. The second line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3000) — indexes of these tests. Output Specification: Output the required default value for the next test index. Demo Input: ['3\n1 7 2\n'] Demo Output: ['3\n'] Note: none
```python n=int(input()) l=list(map(int,input().split())) l.sort() c=1 for i in range(1,max(l)): if(i not in l): print(i) c=0 break if(c==1): print(max(l)+1) ```
3.92752
357
B
Flag Day
PROGRAMMING
1,400
[ "constructive algorithms", "implementation" ]
null
null
In Berland, there is the national holiday coming — the Flag Day. In the honor of this event the president of the country decided to make a big dance party and asked your agency to organize it. He has several conditions: - overall, there must be *m* dances;- exactly three people must take part in each dance;- each dance must have one dancer in white clothes, one dancer in red clothes and one dancer in blue clothes (these are the colors of the national flag of Berland). The agency has *n* dancers, and their number can be less than 3*m*. That is, some dancers will probably have to dance in more than one dance. All of your dancers must dance on the party. However, if some dance has two or more dancers from a previous dance, then the current dance stops being spectacular. Your agency cannot allow that to happen, so each dance has at most one dancer who has danced in some previous dance. You considered all the criteria and made the plan for the *m* dances: each dance had three dancers participating in it. Your task is to determine the clothes color for each of the *n* dancers so that the President's third condition fulfilled: each dance must have a dancer in white, a dancer in red and a dancer in blue. The dancers cannot change clothes between the dances.
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=105) and *m* (1<=≤<=*m*<=≤<=105) — the number of dancers and the number of dances, correspondingly. Then *m* lines follow, describing the dances in the order of dancing them. The *i*-th line contains three distinct integers — the numbers of the dancers that take part in the *i*-th dance. The dancers are numbered from 1 to *n*. Each dancer takes part in at least one dance.
Print *n* space-separated integers: the *i*-th number must represent the color of the *i*-th dancer's clothes (1 for white, 2 for red, 3 for blue). If there are multiple valid solutions, print any of them. It is guaranteed that at least one solution exists.
[ "7 3\n1 2 3\n1 4 5\n4 6 7\n", "9 3\n3 6 9\n2 5 8\n1 4 7\n", "5 2\n4 1 5\n3 1 2\n" ]
[ "1 2 3 3 2 2 1 \n", "1 1 1 2 2 2 3 3 3 \n", "2 3 1 1 3 \n" ]
none
1,000
[ { "input": "7 3\n1 2 3\n1 4 5\n4 6 7", "output": "1 2 3 3 2 2 1 " }, { "input": "9 3\n3 6 9\n2 5 8\n1 4 7", "output": "1 1 1 2 2 2 3 3 3 " }, { "input": "5 2\n4 1 5\n3 1 2", "output": "2 3 1 1 3 " }, { "input": "14 5\n1 5 3\n13 10 11\n6 3 8\n14 9 2\n7 4 12", "output": "1 3 3 2 2 2 1 1 2 2 3 3 1 1 " }, { "input": "14 6\n14 3 13\n10 14 5\n6 2 10\n7 13 9\n12 11 8\n1 4 9", "output": "2 2 2 3 2 1 2 3 1 3 2 1 3 1 " }, { "input": "14 6\n11 13 10\n3 10 14\n2 7 12\n13 1 9\n5 11 4\n8 6 5", "output": "1 1 2 2 3 2 2 1 3 3 1 3 2 1 " }, { "input": "13 5\n13 6 2\n13 3 8\n11 4 7\n10 9 5\n1 12 6", "output": "3 3 3 2 3 2 3 2 2 1 1 1 1 " }, { "input": "14 6\n5 4 8\n5 7 12\n3 6 12\n7 11 14\n10 13 2\n10 1 9", "output": "3 3 3 2 1 1 3 3 2 1 2 2 2 1 " }, { "input": "14 5\n4 13 2\n7 2 11\n6 1 5\n14 12 8\n10 3 9", "output": "2 3 2 1 3 1 2 3 3 1 1 2 2 1 " }, { "input": "14 6\n2 14 5\n3 4 5\n6 13 14\n7 13 12\n8 10 11\n9 6 1", "output": "1 1 1 2 3 3 3 1 2 2 3 2 1 2 " }, { "input": "14 6\n7 14 12\n6 1 12\n13 5 2\n2 3 9\n7 4 11\n5 8 10", "output": "2 3 2 3 2 1 1 1 1 3 2 3 1 2 " }, { "input": "13 6\n8 7 6\n11 7 3\n13 9 3\n12 1 13\n8 10 4\n2 7 5", "output": "3 1 3 2 3 3 2 1 2 3 1 2 1 " }, { "input": "13 5\n8 4 3\n1 9 5\n6 2 11\n12 10 4\n7 10 13", "output": "1 2 3 2 3 1 3 1 2 1 3 3 2 " }, { "input": "20 8\n16 19 12\n13 3 5\n1 5 17\n10 19 7\n8 18 2\n3 11 14\n9 20 12\n4 15 6", "output": "2 3 2 1 3 3 3 1 1 1 1 3 1 3 2 1 1 2 2 2 " }, { "input": "19 7\n10 18 14\n5 9 11\n9 17 7\n3 15 4\n6 8 12\n1 2 18\n13 16 19", "output": "3 1 1 3 1 1 3 2 2 1 3 3 1 3 2 2 1 2 3 " }, { "input": "18 7\n17 4 13\n7 1 6\n16 9 13\n9 2 5\n11 12 17\n14 8 10\n3 15 18", "output": "2 1 1 2 3 3 1 2 2 3 2 3 3 1 2 1 1 3 " }, { "input": "20 7\n8 5 11\n3 19 20\n16 1 17\n9 6 2\n7 18 13\n14 12 18\n10 4 15", "output": "2 3 1 2 2 2 1 1 1 1 3 1 3 3 3 1 3 2 2 3 " }, { "input": "20 7\n6 11 20\n19 5 2\n15 10 12\n3 7 8\n9 1 6\n13 17 18\n14 16 4", "output": "3 3 1 3 2 1 2 3 2 2 2 3 1 1 1 2 2 3 1 3 " }, { "input": "18 7\n15 5 1\n6 11 4\n14 8 17\n11 12 13\n3 8 16\n9 4 7\n2 18 10", "output": "3 1 1 3 2 1 1 2 2 3 2 1 3 1 1 3 3 2 " }, { "input": "19 7\n3 10 8\n17 7 4\n1 19 18\n2 9 5\n12 11 15\n11 14 6\n13 9 16", "output": "1 1 1 3 3 3 2 3 2 2 2 1 1 1 3 3 1 3 2 " }, { "input": "19 7\n18 14 4\n3 11 6\n8 10 7\n10 19 16\n17 13 15\n5 1 14\n12 9 2", "output": "1 3 1 3 3 3 3 1 2 2 2 1 2 2 3 3 1 1 1 " }, { "input": "20 7\n18 7 15\n17 5 20\n9 19 12\n16 13 10\n3 6 1\n3 8 11\n4 2 14", "output": "3 2 1 1 2 2 2 3 1 3 2 3 2 3 3 1 1 1 2 3 " }, { "input": "18 7\n8 4 6\n13 17 3\n9 8 12\n12 16 5\n18 2 7\n11 1 10\n5 15 14", "output": "2 2 3 2 3 3 3 1 3 3 1 2 1 1 2 1 2 1 " }, { "input": "99 37\n40 10 7\n10 3 5\n10 31 37\n87 48 24\n33 47 38\n34 87 2\n2 35 28\n99 28 76\n66 51 97\n72 77 9\n18 17 67\n23 69 98\n58 89 99\n42 44 52\n65 41 80\n70 92 74\n62 88 45\n68 27 61\n6 83 95\n39 85 49\n57 75 77\n59 54 81\n56 20 82\n96 4 53\n90 7 11\n16 43 84\n19 25 59\n68 8 93\n73 94 78\n15 71 79\n26 12 50\n30 32 4\n14 22 29\n46 21 36\n60 55 86\n91 8 63\n13 1 64", "output": "2 2 1 2 3 1 3 3 3 2 1 2 1 1 1 1 2 1 2 2 2 2 1 3 3 1 2 3 3 3 1 1 1 3 1 3 3 3 1 1 2 1 2 2 3 1 2 2 3 3 2 3 3 2 2 1 3 3 1 1 3 1 1 3 1 1 3 1 2 1 2 1 1 3 1 1 2 3 3 3 3 3 2 3 2 3 1 2 1 2 2 2 2 2 3 1 3 3 2 " }, { "input": "99 41\n11 70 20\n57 11 76\n52 11 64\n49 70 15\n19 61 17\n71 77 21\n77 59 39\n37 64 68\n17 84 36\n46 11 90\n35 11 14\n36 25 80\n12 43 48\n18 78 42\n82 94 15\n22 10 84\n63 86 4\n98 86 50\n92 60 9\n73 42 65\n21 5 27\n30 24 23\n7 88 49\n40 97 45\n81 56 17\n79 61 33\n13 3 77\n54 6 28\n99 58 8\n29 95 24\n89 74 32\n51 89 66\n87 91 96\n22 34 38\n1 53 72\n55 97 26\n41 16 44\n2 31 47\n83 67 91\n75 85 69\n93 47 62", "output": "1 1 1 3 2 2 2 3 3 1 1 1 3 2 3 2 3 1 1 3 3 3 3 2 3 3 1 3 3 1 2 3 3 2 3 1 1 1 3 1 1 3 2 3 3 3 3 3 1 3 3 3 2 1 1 2 3 2 1 2 2 1 1 2 1 2 1 3 3 2 1 3 2 2 1 2 2 2 1 2 1 1 3 2 2 2 1 3 1 2 2 1 2 2 1 3 2 1 1 " }, { "input": "99 38\n70 56 92\n61 70 68\n18 92 91\n82 43 55\n37 5 43\n47 27 26\n64 63 40\n20 61 57\n69 80 59\n60 89 50\n33 25 86\n38 15 73\n96 85 90\n3 12 64\n95 23 48\n66 30 9\n38 99 45\n67 88 71\n74 11 81\n28 51 79\n72 92 34\n16 77 31\n65 18 94\n3 41 2\n36 42 81\n22 77 83\n44 24 52\n10 75 97\n54 21 53\n4 29 32\n58 39 98\n46 62 16\n76 5 84\n8 87 13\n6 41 14\n19 21 78\n7 49 93\n17 1 35", "output": "2 3 2 1 1 3 1 1 3 1 2 3 3 2 2 1 1 2 1 2 2 1 2 2 2 3 2 1 2 2 3 3 1 1 3 1 3 1 2 3 1 2 2 1 2 2 1 3 2 3 2 3 3 1 3 2 1 1 3 1 3 3 2 1 1 1 1 2 1 1 3 2 3 1 2 3 2 3 3 2 3 1 3 2 2 3 2 2 2 3 1 3 3 3 1 1 3 3 3 " }, { "input": "98 38\n70 23 73\n73 29 86\n93 82 30\n6 29 10\n7 22 78\n55 61 87\n98 2 12\n11 5 54\n44 56 60\n89 76 50\n37 72 43\n47 41 61\n85 40 38\n48 93 20\n90 64 29\n31 68 25\n83 57 41\n51 90 3\n91 97 66\n96 95 1\n50 84 71\n53 19 5\n45 42 28\n16 17 89\n63 58 15\n26 47 39\n21 24 19\n80 74 38\n14 46 75\n88 65 36\n77 92 33\n17 59 34\n35 69 79\n13 94 39\n8 52 4\n67 27 9\n65 62 18\n81 32 49", "output": "3 2 1 3 2 1 1 1 3 3 1 3 2 1 3 2 3 3 1 2 2 2 2 3 3 2 2 3 2 3 1 2 3 1 1 3 1 3 1 2 1 2 3 1 1 2 3 3 3 3 2 2 3 3 1 2 3 2 2 3 2 1 1 1 2 3 1 2 2 1 1 2 3 2 3 2 1 3 3 1 1 2 2 2 1 1 3 1 1 3 1 2 1 3 2 1 2 1 " }, { "input": "99 42\n61 66 47\n10 47 96\n68 86 67\n21 29 10\n55 44 47\n12 82 4\n45 71 55\n86 3 95\n16 99 93\n14 92 82\n12 59 20\n73 24 8\n79 72 48\n44 87 39\n87 84 97\n47 70 37\n49 77 95\n39 75 28\n75 25 5\n44 41 36\n76 86 78\n73 6 90\n8 22 58\n9 72 63\n81 42 14\n1 21 35\n91 54 15\n30 13 39\n56 89 79\n11 2 76\n19 65 52\n23 85 74\n7 38 24\n57 94 81\n43 34 60\n62 82 27\n69 64 53\n18 32 17\n24 31 88\n51 50 33\n40 80 98\n83 46 26", "output": "2 3 1 3 3 3 3 3 1 2 2 1 2 3 3 1 3 1 1 2 3 2 1 2 1 3 3 1 1 1 1 2 3 2 1 3 1 1 3 1 1 2 1 2 2 2 3 3 1 2 1 3 3 2 1 2 2 1 3 3 1 1 3 2 2 2 3 1 1 2 3 2 1 3 2 1 2 3 1 2 1 2 1 3 2 2 1 3 3 2 1 1 3 3 3 1 2 3 2 " } ]
1,616,218,751
2,147,483,647
PyPy 3
OK
TESTS
63
623
10,240,000
n , m = list(map (int, input().split())) cList = [0]*n for i in range(m) : x, y, z = list(map (int, input().split())) r, s, t = cList[x -1], cList[y -1], cList[z -1] if r > 0 : s = (r + 1) % 3 t = (r + 2) % 3 if s == 0: s = 3 elif t == 0: t = 3 elif s > 0 : r = (s + 1) % 3 t = (s + 2) % 3 if r == 0: r = 3 elif t == 0: t = 3 elif t > 0 : r = (t + 1) % 3 s = (t + 2) % 3 if s == 0: s = 3 elif r == 0: r = 3 elif r == 0 : r, s, t = 1, 2, 3 cList[x -1], cList[y -1], cList[z -1] = r, s, t for i in range(n - 1): print(cList[i], end= " ") print(cList[n - 1])
Title: Flag Day Time Limit: None seconds Memory Limit: None megabytes Problem Description: In Berland, there is the national holiday coming — the Flag Day. In the honor of this event the president of the country decided to make a big dance party and asked your agency to organize it. He has several conditions: - overall, there must be *m* dances;- exactly three people must take part in each dance;- each dance must have one dancer in white clothes, one dancer in red clothes and one dancer in blue clothes (these are the colors of the national flag of Berland). The agency has *n* dancers, and their number can be less than 3*m*. That is, some dancers will probably have to dance in more than one dance. All of your dancers must dance on the party. However, if some dance has two or more dancers from a previous dance, then the current dance stops being spectacular. Your agency cannot allow that to happen, so each dance has at most one dancer who has danced in some previous dance. You considered all the criteria and made the plan for the *m* dances: each dance had three dancers participating in it. Your task is to determine the clothes color for each of the *n* dancers so that the President's third condition fulfilled: each dance must have a dancer in white, a dancer in red and a dancer in blue. The dancers cannot change clothes between the dances. Input Specification: The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=105) and *m* (1<=≤<=*m*<=≤<=105) — the number of dancers and the number of dances, correspondingly. Then *m* lines follow, describing the dances in the order of dancing them. The *i*-th line contains three distinct integers — the numbers of the dancers that take part in the *i*-th dance. The dancers are numbered from 1 to *n*. Each dancer takes part in at least one dance. Output Specification: Print *n* space-separated integers: the *i*-th number must represent the color of the *i*-th dancer's clothes (1 for white, 2 for red, 3 for blue). If there are multiple valid solutions, print any of them. It is guaranteed that at least one solution exists. Demo Input: ['7 3\n1 2 3\n1 4 5\n4 6 7\n', '9 3\n3 6 9\n2 5 8\n1 4 7\n', '5 2\n4 1 5\n3 1 2\n'] Demo Output: ['1 2 3 3 2 2 1 \n', '1 1 1 2 2 2 3 3 3 \n', '2 3 1 1 3 \n'] Note: none
```python n , m = list(map (int, input().split())) cList = [0]*n for i in range(m) : x, y, z = list(map (int, input().split())) r, s, t = cList[x -1], cList[y -1], cList[z -1] if r > 0 : s = (r + 1) % 3 t = (r + 2) % 3 if s == 0: s = 3 elif t == 0: t = 3 elif s > 0 : r = (s + 1) % 3 t = (s + 2) % 3 if r == 0: r = 3 elif t == 0: t = 3 elif t > 0 : r = (t + 1) % 3 s = (t + 2) % 3 if s == 0: s = 3 elif r == 0: r = 3 elif r == 0 : r, s, t = 1, 2, 3 cList[x -1], cList[y -1], cList[z -1] = r, s, t for i in range(n - 1): print(cList[i], end= " ") print(cList[n - 1]) ```
3
378
A
Playing with Dice
PROGRAMMING
800
[ "brute force" ]
null
null
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
[ "2 5\n", "2 4\n" ]
[ "3 0 3\n", "2 1 3\n" ]
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
500
[ { "input": "2 5", "output": "3 0 3" }, { "input": "2 4", "output": "2 1 3" }, { "input": "5 3", "output": "2 1 3" }, { "input": "1 6", "output": "3 0 3" }, { "input": "5 1", "output": "3 1 2" }, { "input": "6 3", "output": "2 0 4" }, { "input": "2 3", "output": "2 0 4" }, { "input": "5 6", "output": "5 0 1" }, { "input": "4 4", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" }, { "input": "6 4", "output": "1 1 4" }, { "input": "1 4", "output": "2 0 4" }, { "input": "5 5", "output": "0 6 0" }, { "input": "4 5", "output": "4 0 2" }, { "input": "4 3", "output": "3 0 3" }, { "input": "1 5", "output": "2 1 3" }, { "input": "6 5", "output": "1 0 5" }, { "input": "2 2", "output": "0 6 0" }, { "input": "1 3", "output": "1 1 4" }, { "input": "3 6", "output": "4 0 2" }, { "input": "3 1", "output": "4 1 1" }, { "input": "3 2", "output": "4 0 2" }, { "input": "3 5", "output": "3 1 2" }, { "input": "3 3", "output": "0 6 0" }, { "input": "6 2", "output": "2 1 3" }, { "input": "4 1", "output": "4 0 2" }, { "input": "5 2", "output": "3 0 3" }, { "input": "4 2", "output": "3 1 2" }, { "input": "2 1", "output": "5 0 1" }, { "input": "6 1", "output": "3 0 3" }, { "input": "4 6", "output": "4 1 1" }, { "input": "2 6", "output": "3 1 2" }, { "input": "3 4", "output": "3 0 3" }, { "input": "1 2", "output": "1 0 5" }, { "input": "6 6", "output": "0 6 0" }, { "input": "5 4", "output": "2 0 4" }, { "input": "3 3", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" } ]
1,634,901,884
2,147,483,647
Python 3
OK
TESTS
38
46
4,505,600
throws = input().split() player_one = int(throws[0]) player_two = int(throws[1]) def counter(player_one, player_two): test = [] i = 1 while i <= 6: if abs(i - player_one) < abs(i - player_two): test.append(1) elif abs(i - player_one) > abs(i - player_two): test.append(2) elif abs(i - player_one) == abs(i - player_two): test.append(3) i += 1 print(' '.join([str(test.count(1)), str(test.count(3)), str(test.count(2))])) counter(player_one, player_two)
Title: Playing with Dice Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins? Input Specification: The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly. Output Specification: Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly. Demo Input: ['2 5\n', '2 4\n'] Demo Output: ['3 0 3\n', '2 1 3\n'] Note: The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
```python throws = input().split() player_one = int(throws[0]) player_two = int(throws[1]) def counter(player_one, player_two): test = [] i = 1 while i <= 6: if abs(i - player_one) < abs(i - player_two): test.append(1) elif abs(i - player_one) > abs(i - player_two): test.append(2) elif abs(i - player_one) == abs(i - player_two): test.append(3) i += 1 print(' '.join([str(test.count(1)), str(test.count(3)), str(test.count(2))])) counter(player_one, player_two) ```
3
703
A
Mishka and Game
PROGRAMMING
800
[ "implementation" ]
null
null
Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game. Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner. In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw. Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her!
The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds. The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively.
If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line. If Chris is the winner of the game, print "Chris" (without quotes) in the only line. If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line.
[ "3\n3 5\n2 1\n4 2\n", "2\n6 1\n1 6\n", "3\n1 5\n3 3\n2 2\n" ]
[ "Mishka", "Friendship is magic!^^", "Chris" ]
In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game. In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1. In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.
500
[ { "input": "3\n3 5\n2 1\n4 2", "output": "Mishka" }, { "input": "2\n6 1\n1 6", "output": "Friendship is magic!^^" }, { "input": "3\n1 5\n3 3\n2 2", "output": "Chris" }, { "input": "6\n4 1\n4 2\n5 3\n5 1\n5 3\n4 1", "output": "Mishka" }, { "input": "8\n2 4\n1 4\n1 5\n2 6\n2 5\n2 5\n2 4\n2 5", "output": "Chris" }, { "input": "8\n4 1\n2 6\n4 2\n2 5\n5 2\n3 5\n5 2\n1 5", "output": "Friendship is magic!^^" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3", "output": "Mishka" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "9\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4", "output": "Mishka" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "10\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n2 4\n6 6\n3 2\n1 5\n5 2\n1 5\n1 5\n3 1\n6 5\n4 3\n1 1\n5 1\n3 3\n2 4\n1 5\n3 4\n5 1\n5 5\n2 5\n2 1\n4 3\n6 5\n1 1\n2 1\n1 3\n1 1\n6 4\n4 6\n6 4\n2 1\n2 5\n6 2\n3 4\n5 5\n1 4\n4 6\n3 4\n1 6\n5 1\n4 3\n3 4\n2 2\n1 2\n2 3\n1 3\n4 4\n5 5\n4 5\n4 4\n3 1\n4 5\n2 3\n2 6\n6 5\n6 1\n6 6\n2 3\n6 4\n3 3\n2 5\n4 4\n3 1\n2 4\n6 1\n3 2\n1 3\n5 4\n6 6\n2 5\n5 1\n1 1\n2 5\n6 5\n3 6\n5 6\n4 3\n3 4\n3 4\n6 5\n5 2\n4 2\n1 1\n3 1\n2 6\n1 6\n1 2\n6 1\n3 4\n1 6\n3 1\n5 3\n1 3\n5 6\n2 1\n6 4\n3 1\n1 6\n6 3\n3 3\n4 3", "output": "Chris" }, { "input": "100\n4 1\n3 4\n4 6\n4 5\n6 5\n5 3\n6 2\n6 3\n5 2\n4 5\n1 5\n5 4\n1 4\n4 5\n4 6\n1 6\n4 4\n5 1\n6 4\n6 4\n4 6\n2 3\n6 2\n4 6\n1 4\n2 3\n4 3\n1 3\n6 2\n3 1\n3 4\n2 6\n4 5\n5 4\n2 2\n2 5\n4 1\n2 2\n3 3\n1 4\n5 6\n6 4\n4 2\n6 1\n5 5\n4 1\n2 1\n6 4\n4 4\n4 3\n5 3\n4 5\n5 3\n3 5\n6 3\n1 1\n3 4\n6 3\n6 1\n5 1\n2 4\n4 3\n2 2\n5 5\n1 5\n5 3\n4 6\n1 4\n6 3\n4 3\n2 4\n3 2\n2 4\n3 4\n6 2\n5 6\n1 2\n1 5\n5 5\n2 6\n5 1\n1 6\n5 3\n3 5\n2 6\n4 6\n6 2\n3 1\n5 5\n6 1\n3 6\n4 4\n1 1\n4 6\n5 3\n4 2\n5 1\n3 3\n2 1\n1 4", "output": "Mishka" }, { "input": "100\n6 3\n4 5\n4 3\n5 4\n5 1\n6 3\n4 2\n4 6\n3 1\n2 4\n2 2\n4 6\n5 3\n5 5\n4 2\n6 2\n2 3\n4 4\n6 4\n3 5\n2 4\n2 2\n5 2\n3 5\n2 4\n4 4\n3 5\n6 5\n1 3\n1 6\n2 2\n2 4\n3 2\n5 4\n1 6\n3 4\n4 1\n1 5\n1 4\n5 3\n2 2\n4 5\n6 3\n4 4\n1 1\n4 1\n2 4\n4 1\n4 5\n5 3\n1 1\n1 6\n5 6\n6 6\n4 2\n4 3\n3 4\n3 6\n3 4\n6 5\n3 4\n5 4\n5 1\n5 3\n5 1\n1 2\n2 6\n3 4\n6 5\n4 3\n1 1\n5 5\n5 1\n3 3\n5 2\n1 3\n6 6\n5 6\n1 4\n4 4\n1 4\n3 6\n6 5\n3 3\n3 6\n1 5\n1 2\n3 6\n3 6\n4 1\n5 2\n1 2\n5 2\n3 3\n4 4\n4 2\n6 2\n5 4\n6 1\n6 3", "output": "Mishka" }, { "input": "8\n4 1\n6 2\n4 1\n5 3\n4 1\n5 3\n6 2\n5 3", "output": "Mishka" }, { "input": "5\n3 6\n3 5\n3 5\n1 6\n3 5", "output": "Chris" }, { "input": "4\n4 1\n2 4\n5 3\n3 6", "output": "Friendship is magic!^^" }, { "input": "6\n6 3\n5 1\n6 3\n4 3\n4 3\n5 2", "output": "Mishka" }, { "input": "7\n3 4\n1 4\n2 5\n1 6\n1 6\n1 5\n3 4", "output": "Chris" }, { "input": "6\n6 2\n2 5\n5 2\n3 6\n4 3\n1 6", "output": "Friendship is magic!^^" }, { "input": "8\n6 1\n5 3\n4 3\n4 1\n5 1\n4 2\n4 2\n4 1", "output": "Mishka" }, { "input": "9\n2 5\n2 5\n1 4\n2 6\n2 4\n2 5\n2 6\n1 5\n2 5", "output": "Chris" }, { "input": "4\n6 2\n2 4\n4 2\n3 6", "output": "Friendship is magic!^^" }, { "input": "9\n5 2\n4 1\n4 1\n5 1\n6 2\n6 1\n5 3\n6 1\n6 2", "output": "Mishka" }, { "input": "8\n2 4\n3 6\n1 6\n1 6\n2 4\n3 4\n3 6\n3 4", "output": "Chris" }, { "input": "6\n5 3\n3 6\n6 2\n1 6\n5 1\n3 5", "output": "Friendship is magic!^^" }, { "input": "6\n5 2\n5 1\n6 1\n5 2\n4 2\n5 1", "output": "Mishka" }, { "input": "5\n1 4\n2 5\n3 4\n2 6\n3 4", "output": "Chris" }, { "input": "4\n6 2\n3 4\n5 1\n1 6", "output": "Friendship is magic!^^" }, { "input": "93\n4 3\n4 1\n4 2\n5 2\n5 3\n6 3\n4 3\n6 2\n6 3\n5 1\n4 2\n4 2\n5 1\n6 2\n6 3\n6 1\n4 1\n6 2\n5 3\n4 3\n4 1\n4 2\n5 2\n6 3\n5 2\n5 2\n6 3\n5 1\n6 2\n5 2\n4 1\n5 2\n5 1\n4 1\n6 1\n5 2\n4 3\n5 3\n5 3\n5 1\n4 3\n4 3\n4 2\n4 1\n6 2\n6 1\n4 1\n5 2\n5 2\n6 2\n5 3\n5 1\n6 2\n5 1\n6 3\n5 2\n6 2\n6 2\n4 2\n5 2\n6 1\n6 3\n6 3\n5 1\n5 1\n4 1\n5 1\n4 3\n5 3\n6 3\n4 1\n4 3\n6 1\n6 1\n4 2\n6 2\n4 2\n5 2\n4 1\n5 2\n4 1\n5 1\n5 2\n5 1\n4 1\n6 3\n6 2\n4 3\n4 1\n5 2\n4 3\n5 2\n5 1", "output": "Mishka" }, { "input": "11\n1 6\n1 6\n2 4\n2 5\n3 4\n1 5\n1 6\n1 5\n1 6\n2 6\n3 4", "output": "Chris" }, { "input": "70\n6 1\n3 6\n4 3\n2 5\n5 2\n1 4\n6 2\n1 6\n4 3\n1 4\n5 3\n2 4\n5 3\n1 6\n5 1\n3 5\n4 2\n2 4\n5 1\n3 5\n6 2\n1 5\n4 2\n2 5\n5 3\n1 5\n4 2\n1 4\n5 2\n2 6\n4 3\n1 5\n6 2\n3 4\n4 2\n3 5\n6 3\n3 4\n5 1\n1 4\n4 2\n1 4\n6 3\n2 6\n5 2\n1 6\n6 1\n2 6\n5 3\n1 5\n5 1\n1 6\n4 1\n1 5\n4 2\n2 4\n5 1\n2 5\n6 3\n1 4\n6 3\n3 6\n5 1\n1 4\n5 3\n3 5\n4 2\n3 4\n6 2\n1 4", "output": "Friendship is magic!^^" }, { "input": "59\n4 1\n5 3\n6 1\n4 2\n5 1\n4 3\n6 1\n5 1\n4 3\n4 3\n5 2\n5 3\n4 1\n6 2\n5 1\n6 3\n6 3\n5 2\n5 2\n6 1\n4 1\n6 1\n4 3\n5 3\n5 3\n4 3\n4 2\n4 2\n6 3\n6 3\n6 1\n4 3\n5 1\n6 2\n6 1\n4 1\n6 1\n5 3\n4 2\n5 1\n6 2\n6 2\n4 3\n5 3\n4 3\n6 3\n5 2\n5 2\n4 3\n5 1\n5 3\n6 1\n6 3\n6 3\n4 3\n5 2\n5 2\n5 2\n4 3", "output": "Mishka" }, { "input": "42\n1 5\n1 6\n1 6\n1 4\n2 5\n3 6\n1 6\n3 4\n2 5\n2 5\n2 4\n1 4\n3 4\n2 4\n2 6\n1 5\n3 6\n2 6\n2 6\n3 5\n1 4\n1 5\n2 6\n3 6\n1 4\n3 4\n2 4\n1 6\n3 4\n2 4\n2 6\n1 6\n1 4\n1 6\n1 6\n2 4\n1 5\n1 6\n2 5\n3 6\n3 5\n3 4", "output": "Chris" }, { "input": "78\n4 3\n3 5\n4 3\n1 5\n5 1\n1 5\n4 3\n1 4\n6 3\n1 5\n4 1\n2 4\n4 3\n2 4\n5 1\n3 6\n4 2\n3 6\n6 3\n3 4\n4 3\n3 6\n5 3\n1 5\n4 1\n2 6\n4 2\n2 4\n4 1\n3 5\n5 2\n3 6\n4 3\n2 4\n6 3\n1 6\n4 3\n3 5\n6 3\n2 6\n4 1\n2 4\n6 2\n1 6\n4 2\n1 4\n4 3\n1 4\n4 3\n2 4\n6 2\n3 5\n6 1\n3 6\n5 3\n1 6\n6 1\n2 6\n4 2\n1 5\n6 2\n2 6\n6 3\n2 4\n4 2\n3 5\n6 1\n2 5\n5 3\n2 6\n5 1\n3 6\n4 3\n3 6\n6 3\n2 5\n6 1\n2 6", "output": "Friendship is magic!^^" }, { "input": "76\n4 1\n5 2\n4 3\n5 2\n5 3\n5 2\n6 1\n4 2\n6 2\n5 3\n4 2\n6 2\n4 1\n4 2\n5 1\n5 1\n6 2\n5 2\n5 3\n6 3\n5 2\n4 3\n6 3\n6 1\n4 3\n6 2\n6 1\n4 1\n6 1\n5 3\n4 1\n5 3\n4 2\n5 2\n4 3\n6 1\n6 2\n5 2\n6 1\n5 3\n4 3\n5 1\n5 3\n4 3\n5 1\n5 1\n4 1\n4 1\n4 1\n4 3\n5 3\n6 3\n6 3\n5 2\n6 2\n6 3\n5 1\n6 3\n5 3\n6 1\n5 3\n4 1\n5 3\n6 1\n4 2\n6 2\n4 3\n4 1\n6 2\n4 3\n5 3\n5 2\n5 3\n5 1\n6 3\n5 2", "output": "Mishka" }, { "input": "84\n3 6\n3 4\n2 5\n2 4\n1 6\n3 4\n1 5\n1 6\n3 5\n1 6\n2 4\n2 6\n2 6\n2 4\n3 5\n1 5\n3 6\n3 6\n3 4\n3 4\n2 6\n1 6\n1 6\n3 5\n3 4\n1 6\n3 4\n3 5\n2 4\n2 5\n2 5\n3 5\n1 6\n3 4\n2 6\n2 6\n3 4\n3 4\n2 5\n2 5\n2 4\n3 4\n2 5\n3 4\n3 4\n2 6\n2 6\n1 6\n2 4\n1 5\n3 4\n2 5\n2 5\n3 4\n2 4\n2 6\n2 6\n1 4\n3 5\n3 5\n2 4\n2 5\n3 4\n1 5\n1 5\n2 6\n1 5\n3 5\n2 4\n2 5\n3 4\n2 6\n1 6\n2 5\n3 5\n3 5\n3 4\n2 5\n2 6\n3 4\n1 6\n2 5\n2 6\n1 4", "output": "Chris" }, { "input": "44\n6 1\n1 6\n5 2\n1 4\n6 2\n2 5\n5 3\n3 6\n5 2\n1 6\n4 1\n2 4\n6 1\n3 4\n6 3\n3 6\n4 3\n2 4\n6 1\n3 4\n6 1\n1 6\n4 1\n3 5\n6 1\n3 6\n4 1\n1 4\n4 2\n2 6\n6 1\n2 4\n6 2\n1 4\n6 2\n2 4\n5 2\n3 6\n6 3\n2 6\n5 3\n3 4\n5 3\n2 4", "output": "Friendship is magic!^^" }, { "input": "42\n5 3\n5 1\n5 2\n4 1\n6 3\n6 1\n6 2\n4 1\n4 3\n4 1\n5 1\n5 3\n5 1\n4 1\n4 2\n6 1\n6 3\n5 1\n4 1\n4 1\n6 3\n4 3\n6 3\n5 2\n6 1\n4 1\n5 3\n4 3\n5 2\n6 3\n6 1\n5 1\n4 2\n4 3\n5 2\n5 3\n6 3\n5 2\n5 1\n5 3\n6 2\n6 1", "output": "Mishka" }, { "input": "50\n3 6\n2 6\n1 4\n1 4\n1 4\n2 5\n3 4\n3 5\n2 6\n1 6\n3 5\n1 5\n2 6\n2 4\n2 4\n3 5\n1 6\n1 5\n1 5\n1 4\n3 5\n1 6\n3 5\n1 4\n1 5\n1 4\n3 6\n1 6\n1 4\n1 4\n1 4\n1 5\n3 6\n1 6\n1 6\n2 4\n1 5\n2 6\n2 5\n3 5\n3 6\n3 4\n2 4\n2 6\n3 4\n2 5\n3 6\n3 5\n2 4\n2 4", "output": "Chris" }, { "input": "86\n6 3\n2 4\n6 3\n3 5\n6 3\n1 5\n5 2\n2 4\n4 3\n2 6\n4 1\n2 6\n5 2\n1 4\n5 1\n2 4\n4 1\n1 4\n6 2\n3 5\n4 2\n2 4\n6 2\n1 5\n5 3\n2 5\n5 1\n1 6\n6 1\n1 4\n4 3\n3 4\n5 2\n2 4\n5 3\n2 5\n4 3\n3 4\n4 1\n1 5\n6 3\n3 4\n4 3\n3 4\n4 1\n3 4\n5 1\n1 6\n4 2\n1 6\n5 1\n2 4\n5 1\n3 6\n4 1\n1 5\n5 2\n1 4\n4 3\n2 5\n5 1\n1 5\n6 2\n2 6\n4 2\n2 4\n4 1\n2 5\n5 3\n3 4\n5 1\n3 4\n6 3\n3 4\n4 3\n2 6\n6 2\n2 5\n5 2\n3 5\n4 2\n3 6\n6 2\n3 4\n4 2\n2 4", "output": "Friendship is magic!^^" }, { "input": "84\n6 1\n6 3\n6 3\n4 1\n4 3\n4 2\n6 3\n5 3\n6 1\n6 3\n4 3\n5 2\n5 3\n5 1\n6 2\n6 2\n6 1\n4 1\n6 3\n5 2\n4 1\n5 3\n6 3\n4 2\n6 2\n6 3\n4 3\n4 1\n4 3\n5 1\n5 1\n5 1\n4 1\n6 1\n4 3\n6 2\n5 1\n5 1\n6 2\n5 2\n4 1\n6 1\n6 1\n6 3\n6 2\n4 3\n6 3\n6 2\n5 2\n5 1\n4 3\n6 2\n4 1\n6 2\n6 1\n5 2\n5 1\n6 2\n6 1\n5 3\n5 2\n6 1\n6 3\n5 2\n6 1\n6 3\n4 3\n5 1\n6 3\n6 1\n5 3\n4 3\n5 2\n5 1\n6 2\n5 3\n6 1\n5 1\n4 1\n5 1\n5 1\n5 2\n5 2\n5 1", "output": "Mishka" }, { "input": "92\n1 5\n2 4\n3 5\n1 6\n2 5\n1 6\n3 6\n1 6\n2 4\n3 4\n3 4\n3 6\n1 5\n2 5\n1 5\n1 5\n2 6\n2 4\n3 6\n1 4\n1 6\n2 6\n3 4\n2 6\n2 6\n1 4\n3 5\n2 5\n2 6\n1 5\n1 4\n1 5\n3 6\n3 5\n2 5\n1 5\n3 5\n3 6\n2 6\n2 6\n1 5\n3 4\n2 4\n3 6\n2 5\n1 5\n2 4\n1 4\n2 6\n2 6\n2 6\n1 5\n3 6\n3 6\n2 5\n1 4\n2 4\n3 4\n1 5\n2 5\n2 4\n2 5\n3 5\n3 4\n3 6\n2 6\n3 5\n1 4\n3 4\n1 6\n3 6\n2 6\n1 4\n3 6\n3 6\n2 5\n2 6\n1 6\n2 6\n3 5\n2 5\n3 6\n2 5\n2 6\n1 5\n2 4\n1 4\n2 4\n1 5\n2 5\n2 5\n2 6", "output": "Chris" }, { "input": "20\n5 1\n1 4\n4 3\n1 5\n4 2\n3 6\n6 2\n1 6\n4 1\n1 4\n5 2\n3 4\n5 1\n1 6\n5 1\n2 6\n6 3\n2 5\n6 2\n2 4", "output": "Friendship is magic!^^" }, { "input": "100\n4 3\n4 3\n4 2\n4 3\n4 1\n4 3\n5 2\n5 2\n6 2\n4 2\n5 1\n4 2\n5 2\n6 1\n4 1\n6 3\n5 3\n5 1\n5 1\n5 1\n5 3\n6 1\n6 1\n4 1\n5 2\n5 2\n6 1\n6 3\n4 2\n4 1\n5 3\n4 1\n5 3\n5 1\n6 3\n6 3\n6 1\n5 2\n5 3\n5 3\n6 1\n4 1\n6 2\n6 1\n6 2\n6 3\n4 3\n4 3\n6 3\n4 2\n4 2\n5 3\n5 2\n5 2\n4 3\n5 3\n5 2\n4 2\n5 1\n4 2\n5 1\n5 3\n6 3\n5 3\n5 3\n4 2\n4 1\n4 2\n4 3\n6 3\n4 3\n6 2\n6 1\n5 3\n5 2\n4 1\n6 1\n5 2\n6 2\n4 2\n6 3\n4 3\n5 1\n6 3\n5 2\n4 3\n5 3\n5 3\n4 3\n6 3\n4 3\n4 1\n5 1\n6 2\n6 3\n5 3\n6 1\n6 3\n5 3\n6 1", "output": "Mishka" }, { "input": "100\n1 5\n1 4\n1 5\n2 4\n2 6\n3 6\n3 5\n1 5\n2 5\n3 6\n3 5\n1 6\n1 4\n1 5\n1 6\n2 6\n1 5\n3 5\n3 4\n2 6\n2 6\n2 5\n3 4\n1 6\n1 4\n2 4\n1 5\n1 6\n3 5\n1 6\n2 6\n3 5\n1 6\n3 4\n3 5\n1 6\n3 6\n2 4\n2 4\n3 5\n2 6\n1 5\n3 5\n3 6\n2 4\n2 4\n2 6\n3 4\n3 4\n1 5\n1 4\n2 5\n3 4\n1 4\n2 6\n2 5\n2 4\n2 4\n2 5\n1 5\n1 6\n1 5\n1 5\n1 5\n1 6\n3 4\n2 4\n3 5\n3 5\n1 6\n3 5\n1 5\n1 6\n3 6\n3 4\n1 5\n3 5\n3 6\n1 4\n3 6\n1 5\n3 5\n3 6\n3 5\n1 4\n3 4\n2 4\n2 4\n2 5\n3 6\n3 5\n1 5\n2 4\n1 4\n3 4\n1 5\n3 4\n3 6\n3 5\n3 4", "output": "Chris" }, { "input": "100\n4 3\n3 4\n5 1\n2 5\n5 3\n1 5\n6 3\n2 4\n5 2\n2 6\n5 2\n1 5\n6 3\n1 5\n6 3\n3 4\n5 2\n1 5\n6 1\n1 5\n4 2\n3 5\n6 3\n2 6\n6 3\n1 4\n6 2\n3 4\n4 1\n3 6\n5 1\n2 4\n5 1\n3 4\n6 2\n3 5\n4 1\n2 6\n4 3\n2 6\n5 2\n3 6\n6 2\n3 5\n4 3\n1 5\n5 3\n3 6\n4 2\n3 4\n6 1\n3 4\n5 2\n2 6\n5 2\n2 4\n6 2\n3 6\n4 3\n2 4\n4 3\n2 6\n4 2\n3 4\n6 3\n2 4\n6 3\n3 5\n5 2\n1 5\n6 3\n3 6\n4 3\n1 4\n5 2\n1 6\n4 1\n2 5\n4 1\n2 4\n4 2\n2 5\n6 1\n2 4\n6 3\n1 5\n4 3\n2 6\n6 3\n2 6\n5 3\n1 5\n4 1\n1 5\n6 2\n2 5\n5 1\n3 6\n4 3\n3 4", "output": "Friendship is magic!^^" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3", "output": "Mishka" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "99\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4", "output": "Mishka" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "84\n6 2\n1 5\n6 2\n2 3\n5 5\n1 2\n3 4\n3 4\n6 5\n6 4\n2 5\n4 1\n1 2\n1 1\n1 4\n2 5\n5 6\n6 3\n2 4\n5 5\n2 6\n3 4\n5 1\n3 3\n5 5\n4 6\n4 6\n2 4\n4 1\n5 2\n2 2\n3 6\n3 3\n4 6\n1 1\n2 4\n6 5\n5 2\n6 5\n5 5\n2 5\n6 4\n1 1\n6 2\n3 6\n6 5\n4 4\n1 5\n5 6\n4 4\n3 5\n6 1\n3 4\n1 5\n4 6\n4 6\n4 1\n3 6\n6 2\n1 1\n4 5\n5 4\n5 3\n3 4\n6 4\n1 1\n5 2\n6 5\n6 1\n2 2\n2 4\n3 3\n4 6\n1 3\n6 6\n5 2\n1 6\n6 2\n6 6\n4 1\n3 6\n6 4\n2 3\n3 4", "output": "Chris" }, { "input": "70\n3 4\n2 3\n2 3\n6 5\n6 6\n4 3\n2 3\n3 1\n3 5\n5 6\n1 6\n2 5\n5 3\n2 5\n4 6\n5 1\n6 1\n3 1\n3 3\n5 3\n2 1\n3 3\n6 4\n6 3\n4 3\n4 5\n3 5\n5 5\n5 2\n1 6\n3 4\n5 2\n2 4\n1 6\n4 3\n4 3\n6 2\n1 3\n1 5\n6 1\n3 1\n1 1\n1 3\n2 2\n3 2\n6 4\n1 1\n4 4\n3 1\n4 5\n4 2\n6 3\n4 4\n3 2\n1 2\n2 6\n3 3\n1 5\n1 1\n6 5\n2 2\n3 1\n5 4\n5 2\n6 4\n6 3\n6 6\n6 3\n3 3\n5 4", "output": "Mishka" }, { "input": "56\n6 4\n3 4\n6 1\n3 3\n1 4\n2 3\n1 5\n2 5\n1 5\n5 5\n2 3\n1 1\n3 2\n3 5\n4 6\n4 4\n5 2\n4 3\n3 1\n3 6\n2 3\n3 4\n5 6\n5 2\n5 6\n1 5\n1 5\n4 1\n6 3\n2 2\n2 1\n5 5\n2 1\n4 1\n5 4\n2 5\n4 1\n6 2\n3 4\n4 2\n6 4\n5 4\n4 2\n4 3\n6 2\n6 2\n3 1\n1 4\n3 6\n5 1\n5 5\n3 6\n6 4\n2 3\n6 5\n3 3", "output": "Mishka" }, { "input": "94\n2 4\n6 4\n1 6\n1 4\n5 1\n3 3\n4 3\n6 1\n6 5\n3 2\n2 3\n5 1\n5 3\n1 2\n4 3\n3 2\n2 3\n4 6\n1 3\n6 3\n1 1\n3 2\n4 3\n1 5\n4 6\n3 2\n6 3\n1 6\n1 1\n1 2\n3 5\n1 3\n3 5\n4 4\n4 2\n1 4\n4 5\n1 3\n1 2\n1 1\n5 4\n5 5\n6 1\n2 1\n2 6\n6 6\n4 2\n3 6\n1 6\n6 6\n1 5\n3 2\n1 2\n4 4\n6 4\n4 1\n1 5\n3 3\n1 3\n3 4\n4 4\n1 1\n2 5\n4 5\n3 1\n3 1\n3 6\n3 2\n1 4\n1 6\n6 3\n2 4\n1 1\n2 2\n2 2\n2 1\n5 4\n1 2\n6 6\n2 2\n3 3\n6 3\n6 3\n1 6\n2 3\n2 4\n2 3\n6 6\n2 6\n6 3\n3 5\n1 4\n1 1\n3 5", "output": "Chris" }, { "input": "81\n4 2\n1 2\n2 3\n4 5\n6 2\n1 6\n3 6\n3 4\n4 6\n4 4\n3 5\n4 6\n3 6\n3 5\n3 1\n1 3\n5 3\n3 4\n1 1\n4 1\n1 2\n6 1\n1 3\n6 5\n4 5\n4 2\n4 5\n6 2\n1 2\n2 6\n5 2\n1 5\n2 4\n4 3\n5 4\n1 2\n5 3\n2 6\n6 4\n1 1\n1 3\n3 1\n3 1\n6 5\n5 5\n6 1\n6 6\n5 2\n1 3\n1 4\n2 3\n5 5\n3 1\n3 1\n4 4\n1 6\n6 4\n2 2\n4 6\n4 4\n2 6\n2 4\n2 4\n4 1\n1 6\n1 4\n1 3\n6 5\n5 1\n1 3\n5 1\n1 4\n3 5\n2 6\n1 3\n5 6\n3 5\n4 4\n5 5\n5 6\n4 3", "output": "Chris" }, { "input": "67\n6 5\n3 6\n1 6\n5 3\n5 4\n5 1\n1 6\n1 1\n3 2\n4 4\n3 1\n4 1\n1 5\n5 3\n3 3\n6 4\n2 4\n2 2\n4 3\n1 4\n1 4\n6 1\n1 2\n2 2\n5 1\n6 2\n3 5\n5 5\n2 2\n6 5\n6 2\n4 4\n3 1\n4 2\n6 6\n6 4\n5 1\n2 2\n4 5\n5 5\n4 6\n1 5\n6 3\n4 4\n1 5\n6 4\n3 6\n3 4\n1 6\n2 4\n2 1\n2 5\n6 5\n6 4\n4 1\n3 2\n1 2\n5 1\n5 6\n1 5\n3 5\n3 1\n5 3\n3 2\n5 1\n4 6\n6 6", "output": "Mishka" }, { "input": "55\n6 6\n6 5\n2 2\n2 2\n6 4\n5 5\n6 5\n5 3\n1 3\n2 2\n5 6\n3 3\n3 3\n6 5\n3 5\n5 5\n1 2\n1 1\n4 6\n1 2\n5 5\n6 2\n6 3\n1 2\n5 1\n1 3\n3 3\n4 4\n2 5\n1 1\n5 3\n4 3\n2 2\n4 5\n5 6\n4 5\n6 3\n1 6\n6 4\n3 6\n1 6\n5 2\n6 3\n2 3\n5 5\n4 3\n3 1\n4 2\n1 1\n2 5\n5 3\n2 2\n6 3\n4 5\n2 2", "output": "Mishka" }, { "input": "92\n2 3\n1 3\n2 6\n5 1\n5 5\n3 2\n5 6\n2 5\n3 1\n3 6\n4 5\n2 5\n1 2\n2 3\n6 5\n3 6\n4 4\n6 2\n4 5\n4 4\n5 1\n6 1\n3 4\n3 5\n6 6\n3 2\n6 4\n2 2\n3 5\n6 4\n6 3\n6 6\n3 4\n3 3\n6 1\n5 4\n6 2\n2 6\n5 6\n1 4\n4 6\n6 3\n3 1\n4 1\n6 6\n3 5\n6 3\n6 1\n1 6\n3 2\n6 6\n4 3\n3 4\n1 3\n3 5\n5 3\n6 5\n4 3\n5 5\n4 1\n1 5\n6 4\n2 3\n2 3\n1 5\n1 2\n5 2\n4 3\n3 6\n5 5\n5 4\n1 4\n3 3\n1 6\n5 6\n5 4\n5 3\n1 1\n6 2\n5 5\n2 5\n4 3\n6 6\n5 1\n1 1\n4 6\n4 6\n3 1\n6 4\n2 4\n2 2\n2 1", "output": "Chris" }, { "input": "79\n5 3\n4 6\n3 6\n2 1\n5 2\n2 3\n4 4\n6 2\n2 5\n1 6\n6 6\n2 6\n3 3\n4 5\n6 2\n2 1\n1 5\n5 1\n2 1\n2 6\n5 3\n6 2\n2 6\n2 3\n1 5\n4 4\n6 3\n5 2\n3 2\n1 3\n1 3\n6 3\n2 6\n3 6\n5 3\n4 5\n6 1\n3 5\n3 5\n6 5\n1 5\n4 2\n6 2\n2 3\n4 6\n3 6\n2 5\n4 4\n1 1\n4 6\n2 6\n6 4\n3 2\n4 1\n1 2\n6 4\n5 6\n1 4\n2 2\n5 4\n3 2\n1 2\n2 4\n2 5\n2 1\n3 6\n3 3\n1 1\n2 2\n4 4\n4 5\n3 3\n5 3\n6 2\n4 5\n6 5\n2 5\n5 6\n2 2", "output": "Chris" }, { "input": "65\n1 1\n5 1\n2 2\n5 4\n4 5\n2 5\n3 2\n5 6\n6 3\n1 1\n6 1\n1 5\n1 1\n5 2\n6 4\n1 6\n1 1\n4 3\n2 3\n5 6\n4 4\n6 2\n1 3\n4 3\n1 3\n6 3\n3 5\n4 2\n4 1\n6 1\n3 2\n2 6\n3 2\n3 5\n6 3\n4 3\n1 5\n2 6\n1 3\n4 1\n4 1\n2 5\n2 5\n6 2\n5 3\n3 1\n3 3\n5 1\n2 4\n5 3\n3 3\n1 1\n6 3\n3 3\n5 1\n1 6\n4 5\n6 6\n5 5\n2 5\n4 1\n2 2\n1 4\n1 6\n6 5", "output": "Mishka" }, { "input": "1\n1 1", "output": "Friendship is magic!^^" } ]
1,688,472,801
2,147,483,647
PyPy 3-64
OK
TESTS
69
62
0
q=0 w=0 for _ in range(int(input())): z,x=map(int,input().split()) if z>x: q+=1 elif x>z: w+=1 if q>w: print("Mishka") elif w>q: print("Chris") else: print("Friendship is magic!^^")
Title: Mishka and Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game. Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner. In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw. Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her! Input Specification: The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds. The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively. Output Specification: If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line. If Chris is the winner of the game, print "Chris" (without quotes) in the only line. If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line. Demo Input: ['3\n3 5\n2 1\n4 2\n', '2\n6 1\n1 6\n', '3\n1 5\n3 3\n2 2\n'] Demo Output: ['Mishka', 'Friendship is magic!^^', 'Chris'] Note: In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game. In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1. In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.
```python q=0 w=0 for _ in range(int(input())): z,x=map(int,input().split()) if z>x: q+=1 elif x>z: w+=1 if q>w: print("Mishka") elif w>q: print("Chris") else: print("Friendship is magic!^^") ```
3
285
C
Building Permutation
PROGRAMMING
1,200
[ "greedy", "implementation", "sortings" ]
null
null
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Print a single number — the minimum number of moves. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "2\n3 0\n", "3\n-1 -1 2\n" ]
[ "2\n", "6\n" ]
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1). In the second sample you need 6 moves to build permutation (1, 3, 2).
1,500
[ { "input": "2\n3 0", "output": "2" }, { "input": "3\n-1 -1 2", "output": "6" }, { "input": "5\n-3 5 -3 3 3", "output": "10" }, { "input": "10\n9 6 -2 4 1 1 1 9 6 2", "output": "18" }, { "input": "9\n2 0 0 6 5 4 1 9 3", "output": "15" }, { "input": "100\n-77 57 -95 -23 53 -28 82 -83 38 -73 85 28 25 6 -43 4 -10 -30 -9 -92 14 34 -93 61 36 -100 90 -68 28 16 100 -3 97 30 36 -55 62 -62 53 74 -50 -23 67 11 22 -30 -19 83 7 84 43 90 -65 -75 -15 97 90 15 66 2 13 -91 91 -44 46 51 51 -58 95 77 20 30 76 79 91 60 76 2 82 42 -93 94 -57 88 65 -95 -66 100 -9 33 -67 54 -99 97 53 13 54 66 60 -48", "output": "3459" } ]
1,497,428,147
2,147,483,647
Python 3
OK
TESTS
33
998
26,009,600
n_elem = int(input()) numbers = [int(n) for n in input().split()] numbers.sort() moves = 0 for x in range(0, n_elem) : moves += abs((x+1)-numbers[x]) print(moves)
Title: Building Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109). Output Specification: Print a single number — the minimum number of moves. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['2\n3 0\n', '3\n-1 -1 2\n'] Demo Output: ['2\n', '6\n'] Note: In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1). In the second sample you need 6 moves to build permutation (1, 3, 2).
```python n_elem = int(input()) numbers = [int(n) for n in input().split()] numbers.sort() moves = 0 for x in range(0, n_elem) : moves += abs((x+1)-numbers[x]) print(moves) ```
3
94
A
Restoring Password
PROGRAMMING
900
[ "implementation", "strings" ]
A. Restoring Password
2
256
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password". Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address. Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits. Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
[ "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n", "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n" ]
[ "12345678\n", "30234919\n" ]
none
500
[ { "input": "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110", "output": "12345678" }, { "input": "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000", "output": "30234919" }, { "input": "00010101101110110101100110101100010101100010101111000101011010011010110010000011\n0101010110\n0001001101\n1001101011\n0000100011\n0010101111\n1110110101\n0001010110\n0110111000\n0000111110\n0010000011", "output": "65264629" }, { "input": "10100100010010010011011001101000100100110110011010011001101011000100110110011010\n1111110011\n1001000111\n1001000100\n1100010011\n0110011010\n0010000001\n1110101110\n0010000110\n0010010011\n1010010001", "output": "98484434" }, { "input": "00101100011111010001001000000110110000000110010011001111111010110010001011000000\n0010000001\n0110010011\n0010000010\n1011001000\n0011111110\n0110001000\n1111010001\n1011000000\n0000100110\n0010110001", "output": "96071437" }, { "input": "10001110111110000001000010001010001110110000100010100010111101101101010000100010\n0000010110\n1101010111\n1000101111\n0001011110\n0011110101\n0101100100\n0110110101\n0000100010\n1000111011\n1110000001", "output": "89787267" }, { "input": "10010100011001010001010101001101010100110100111011001010111100011001000010100000\n0011100000\n1001100100\n0001100100\n0010100000\n0101010011\n0010101110\n0010101111\n0100111011\n1001010001\n1111111110", "output": "88447623" }, { "input": "01101100111000000101011011001110000001011111111000111111100001011010001001011001\n1000000101\n0101101000\n0101110101\n1101011110\n0000101100\n1111111000\n0001001101\n0110111011\n0110110011\n1001011001", "output": "80805519" }, { "input": "11100011000100010110010011101010101010011110001100011010111110011000011010110111\n1110001100\n0110101111\n0100111010\n0101000000\n1001100001\n1010101001\n0000100010\n1010110111\n1100011100\n0100010110", "output": "09250147" }, { "input": "10000110110000010100000010001000111101110110101011110111000100001101000000100010\n0000010100\n0000110001\n0110101011\n1101110001\n1000011011\n0000110100\n0011110111\n1000110010\n0000100010\n0000011011", "output": "40862358" }, { "input": "01000000010000000110100101000110110000100100000001101100001000011111111001010001\n1011000010\n1111101010\n0111110011\n0000000110\n0000001001\n0001111111\n0110010010\n0100000001\n1011001000\n1001010001", "output": "73907059" }, { "input": "01111000111110011001110101110011110000111110010001101100110110100111101011001101\n1110010001\n1001100000\n1100001000\n1010011110\n1011001101\n0111100011\n1101011100\n1110011001\n1111000011\n0010000101", "output": "57680434" }, { "input": "01001100101000100010001011110001000101001001100010010000001001001100101001011111\n1001011111\n1110010111\n0111101011\n1000100010\n0011100101\n0100000010\n0010111100\n0100010100\n1001100010\n0100110010", "output": "93678590" }, { "input": "01110111110000111011101010110110101011010100110111000011101101110101011101001000\n0110000101\n1010101101\n1101010111\n1101011100\n0100110111\n0111011111\n1100011001\n0111010101\n0000111011\n1101001000", "output": "58114879" }, { "input": "11101001111100110101110011010100110011011110100111010110110011000111000011001101\n1100011100\n1100110101\n1011101000\n0011011110\n0011001101\n0100010001\n1110100111\n1010101100\n1110110100\n0101101100", "output": "61146904" }, { "input": "10101010001011010001001001011000100101100001011011101010101110101010001010101000\n0010110101\n1010011010\n1010101000\n1011010001\n1010101011\n0010010110\n0110100010\n1010100101\n0001011011\n0110100001", "output": "23558422" }, { "input": "11110101001100010000110100001110101011011111010100110001000001001010001001101111\n0101101100\n1001101111\n1010101101\n0100101000\n1111110000\n0101010010\n1100010000\n1111010100\n1101000011\n1011111111", "output": "76827631" }, { "input": "10001100110000110111100011001101111110110011110101000011011100001101110000110111\n0011110101\n0101100011\n1000110011\n1011011001\n0111111011\n0101111011\n0000110111\n0100001110\n1000000111\n0110110111", "output": "26240666" }, { "input": "10000100010000111101100100111101111011101000001001100001000110000010010000111101\n1001001111\n0000111101\n1000010001\n0110011101\n0110101000\n1011111001\n0111101110\n1000001001\n1101011111\n0001010100", "output": "21067271" }, { "input": "01101111000110111100011011110001101111001010001100101000110001010101100100000010\n1010001100\n0011010011\n0101010110\n1111001100\n1100011000\n0100101100\n1001100101\n0110111100\n0011001101\n0100000010", "output": "77770029" }, { "input": "10100111011010001011111000000111100000010101000011000010111101010000111010011101\n1010011101\n1010111111\n0110100110\n1111000100\n1110000001\n0000101111\n0011111000\n1000110001\n0101000011\n1010001011", "output": "09448580" }, { "input": "10000111111000011111001010101010010011111001001111000010010100100011000010001100\n1101101110\n1001001111\n0000100101\n1100111010\n0010101010\n1110000110\n1100111101\n0010001100\n1110000001\n1000011111", "output": "99411277" }, { "input": "10110110111011001111101100111100111111011011011011001111110110010011100010000111\n0111010011\n0111101100\n1001101010\n0101000101\n0010000111\n0011111101\n1011001111\n1101111000\n1011011011\n1001001110", "output": "86658594" }, { "input": "01001001100101100011110110111100000110001111001000100000110111110010000000011000\n0100100110\n1000001011\n1000111110\n0000011000\n0101100011\n1101101111\n1111001000\n1011011001\n1000001101\n0010101000", "output": "04536863" }, { "input": "10010100011101000011100100001100101111000010111100000010010000001001001101011101\n1001000011\n1101000011\n1001010001\n1101011101\n1000010110\n0011111101\n0010111100\n0000100100\n1010001000\n0101000110", "output": "21066773" }, { "input": "01111111110101111111011111111111010010000001100000101000100100111001011010001001\n0111111111\n0101111111\n0100101101\n0001100000\n0011000101\n0011100101\n1101001000\n0010111110\n1010001001\n1111000111", "output": "01063858" }, { "input": "00100011111001001010001111000011101000001110100000000100101011101000001001001010\n0010001111\n1001001010\n1010011001\n0011100111\n1000111000\n0011110000\n0000100010\n0001001010\n1111110111\n1110100000", "output": "01599791" }, { "input": "11011101000100110100110011010101100011111010011010010011010010010010100110101111\n0100110100\n1001001010\n0001111101\n1101011010\n1101110100\n1100110101\n0110101111\n0110001111\n0001101000\n1010011010", "output": "40579016" }, { "input": "10000010111101110110011000111110000011100110001111100100000111000011011000001011\n0111010100\n1010110110\n1000001110\n1110000100\n0110001111\n1101110110\n1100001101\n1000001011\n0000000101\n1001000001", "output": "75424967" }, { "input": "11101100101110111110111011111010001111111111000001001001000010001111111110110010\n0101100001\n1111010011\n1110111110\n0100110100\n1110011111\n1000111111\n0010010000\n1110110010\n0011000010\n1111000001", "output": "72259657" }, { "input": "01011110100101111010011000001001100000101001110011010111101011010000110110010101\n0100111100\n0101110011\n0101111010\n0110000010\n0101001111\n1101000011\n0110010101\n0111011010\n0001101110\n1001110011", "output": "22339256" }, { "input": "01100000100101111000100001100010000110000010100100100001100000110011101001110000\n0101111000\n1001110000\n0001000101\n0110110111\n0010100100\n1000011000\n1101110110\n0110000010\n0001011010\n0011001110", "output": "70554591" }, { "input": "11110011011000001001111100110101001000010100100000110011001110011111100100100001\n1010011000\n1111001101\n0100100001\n1111010011\n0100100000\n1001111110\n1010100111\n1000100111\n1000001001\n1100110011", "output": "18124952" }, { "input": "10001001011000100101010110011101011001110010000001010110000101000100101111101010\n0101100001\n1100001100\n1111101010\n1000100101\n0010000001\n0100010010\n0010110110\n0101100111\n0000001110\n1101001110", "output": "33774052" }, { "input": "00110010000111001001001100100010010111101011011110001011111100000101000100000001\n0100000001\n1011011110\n0010111111\n0111100111\n0100111001\n0000010100\n1001011110\n0111001001\n0100010011\n0011001000", "output": "97961250" }, { "input": "01101100001000110101101100101111101110010011010111100011010100010001101000110101\n1001101001\n1000110101\n0110110000\n0111100100\n0011010111\n1110111001\n0001000110\n0000000100\n0001101001\n1011001011", "output": "21954161" }, { "input": "10101110000011010110101011100000101101000110100000101101101101110101000011110010\n0110100000\n1011011011\n0011110010\n0001110110\n0010110100\n1100010010\n0001101011\n1010111000\n0011010110\n0111010100", "output": "78740192" }, { "input": "11000101011100100111010000010001000001001100101100000011000000001100000101011010\n1100010101\n1111101011\n0101011010\n0100000100\n1000110111\n1100100111\n1100101100\n0111001000\n0000110000\n0110011111", "output": "05336882" }, { "input": "11110100010000101110010110001000001011100101100010110011011011111110001100110110\n0101100010\n0100010001\n0000101110\n1100110110\n0101000101\n0011001011\n1111010001\n1000110010\n1111111000\n1010011111", "output": "62020383" }, { "input": "00011001111110000011101011010001010111100110100101000110011111011001100000001100\n0111001101\n0101011110\n0001100111\n1101011111\n1110000011\n0000001100\n0111010001\n1101100110\n1010110100\n0110100101", "output": "24819275" }, { "input": "10111110010011111001001111100101010111010011111001001110101000111110011001111101\n0011111001\n0101011101\n0100001010\n0001110010\n1001111101\n0011101010\n1111001001\n1100100001\n1001101000\n1011111001", "output": "90010504" }, { "input": "01111101111100101010001001011110111001110111110111011111011110110111111011011111\n1111110111\n0010000101\n0110000100\n0111111011\n1011100111\n1100101010\n1011011111\n1100010001\n0111110111\n0010010111", "output": "85948866" }, { "input": "01111100000111110000110010111001111100001001101010110010111010001000101001101010\n0100010101\n1011110101\n1010100100\n1010000001\n1001101010\n0101100110\n1000100010\n0111110000\n1100101110\n0110010110", "output": "77874864" }, { "input": "11100011010000000010011110010111001011111001000111000000001000000000100111100101\n0000000010\n1110001101\n0011010101\n0111100101\n1001000111\n1101001111\n0111010110\n1100101111\n0110000000\n1101101011", "output": "10374003" }, { "input": "01111011100111101110011001000110001111101000111110100100100001011111001011100010\n0110010100\n1100010001\n0111101110\n1001001000\n1010011011\n1000111110\n0010110101\n1011100010\n0101111100\n0110010001", "output": "22955387" }, { "input": "11011010001100000011000100110011010101000110011110110000001100111100001000011111\n0000100010\n1000011111\n1101101000\n0110011110\n0011110000\n1100000011\n0010001100\n0101101000\n0001001100\n1101010100", "output": "25893541" }, { "input": "01011001011111010010101111011001000011001100011101101111011011010011101011110110\n0100001100\n0101100101\n1111111011\n1111010010\n1111101100\n1100011101\n1011000011\n1101001110\n1011110110\n0110001010", "output": "13805878" }, { "input": "11110011011000111111001100111110001111111100000010111100110100110011111111001101\n1111001101\n1001101010\n1100110010\n0011001111\n0001011110\n1000110011\n1000111111\n0110001010\n1001011101\n1100000010", "output": "06369030" }, { "input": "01110011110010000011011001011000001000010110010110011001100001100110001100101000\n0000100001\n0110011000\n1010000010\n1110011101\n0111001111\n1100101000\n0010000011\n0110010000\n1100100101\n0110010110", "output": "46909115" }, { "input": "00001011001111110111111111011111111101110101110100010111010010100101100001010110\n1111110111\n0001010110\n0111011011\n0111000001\n1010010110\n0101110100\n0001000101\n0000111000\n0110100001\n0000101100", "output": "90005541" } ]
1,483,183,075
2,147,483,647
Python 3
OK
TESTS
50
186
4,608,000
password = input() num = [] pas = [] for i in range(10): num.append(input()) while password != '': item = password[:10] password = password[10:] pas.append(num.index(item)) for i in range(8): print(pas[i], end='')
Title: Restoring Password Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password". Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address. Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits. Help Igor K. restore his ISQ account by the encrypted password and encryption specification. Input Specification: The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9. Output Specification: Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists. Demo Input: ['01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n', '10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n'] Demo Output: ['12345678\n', '30234919\n'] Note: none
```python password = input() num = [] pas = [] for i in range(10): num.append(input()) while password != '': item = password[:10] password = password[10:] pas.append(num.index(item)) for i in range(8): print(pas[i], end='') ```
3.944917
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,685,148,724
2,147,483,647
Python 3
OK
TESTS
30
46
0
x,y=map(int,input().split()) print(min(x,y),end=" ") print((max(x,y)-min(x,y))//2)
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python x,y=map(int,input().split()) print(min(x,y),end=" ") print((max(x,y)-min(x,y))//2) ```
3
931
B
World Cup
PROGRAMMING
1,200
[ "constructive algorithms", "implementation" ]
null
null
The last stage of Football World Cup is played using the play-off system. There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over. Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet.
The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in. It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal.
In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final. Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1.
[ "4 1 2\n", "8 2 6\n", "8 7 5\n" ]
[ "1\n", "Final!\n", "2\n" ]
In the first example teams 1 and 2 meet in the first round. In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds. In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round.
1,000
[ { "input": "4 1 2", "output": "1" }, { "input": "8 2 6", "output": "Final!" }, { "input": "8 7 5", "output": "2" }, { "input": "128 30 98", "output": "Final!" }, { "input": "256 128 256", "output": "Final!" }, { "input": "256 2 127", "output": "7" }, { "input": "2 1 2", "output": "Final!" }, { "input": "2 2 1", "output": "Final!" }, { "input": "4 1 3", "output": "Final!" }, { "input": "4 1 4", "output": "Final!" }, { "input": "4 2 1", "output": "1" }, { "input": "4 2 3", "output": "Final!" }, { "input": "4 2 4", "output": "Final!" }, { "input": "4 3 1", "output": "Final!" }, { "input": "4 3 2", "output": "Final!" }, { "input": "4 3 4", "output": "1" }, { "input": "4 4 1", "output": "Final!" }, { "input": "4 4 2", "output": "Final!" }, { "input": "4 4 3", "output": "1" }, { "input": "8 8 7", "output": "1" }, { "input": "8 8 5", "output": "2" }, { "input": "8 8 1", "output": "Final!" }, { "input": "16 4 3", "output": "1" }, { "input": "16 2 4", "output": "2" }, { "input": "16 14 11", "output": "3" }, { "input": "16 3 11", "output": "Final!" }, { "input": "32 10 9", "output": "1" }, { "input": "32 25 28", "output": "2" }, { "input": "32 22 18", "output": "3" }, { "input": "32 17 25", "output": "4" }, { "input": "32 18 3", "output": "Final!" }, { "input": "64 40 39", "output": "1" }, { "input": "64 60 58", "output": "2" }, { "input": "64 34 37", "output": "3" }, { "input": "64 26 24", "output": "4" }, { "input": "64 50 43", "output": "5" }, { "input": "64 17 42", "output": "Final!" }, { "input": "128 116 115", "output": "1" }, { "input": "128 35 33", "output": "2" }, { "input": "128 61 59", "output": "3" }, { "input": "128 116 123", "output": "4" }, { "input": "128 17 15", "output": "5" }, { "input": "128 124 77", "output": "6" }, { "input": "128 4 80", "output": "Final!" }, { "input": "256 224 223", "output": "1" }, { "input": "256 24 22", "output": "2" }, { "input": "256 199 196", "output": "3" }, { "input": "256 148 159", "output": "4" }, { "input": "256 178 166", "output": "5" }, { "input": "256 75 97", "output": "6" }, { "input": "256 185 200", "output": "7" }, { "input": "256 3 238", "output": "Final!" }, { "input": "256 128 129", "output": "Final!" }, { "input": "256 255 129", "output": "7" }, { "input": "256 255 128", "output": "Final!" }, { "input": "256 129 256", "output": "7" }, { "input": "128 98 69", "output": "6" }, { "input": "128 47 83", "output": "Final!" }, { "input": "16 2 3", "output": "2" }, { "input": "64 32 30", "output": "2" }, { "input": "8 4 5", "output": "Final!" }, { "input": "8 7 8", "output": "1" }, { "input": "8 2 3", "output": "2" }, { "input": "8 2 5", "output": "Final!" } ]
1,520,958,394
2,147,483,647
Python 3
OK
TESTS
64
77
5,632,000
x=input().split() x=[int(i) for i in x] x.sort() turn = 1 while(not(x[0]%2==1 and x[1]%2==0 and (x[1]-x[0])==1)): #print(x[0],x[1]) x[0]=(x[0])//2 + x[0]%2 x[1]=(x[1])//2 + x[1]%2 turn+=1 count = 1 prod=2 while(prod != x[2]): prod=prod*2 count+=1 if(count==turn): print("Final!") else: print(turn)
Title: World Cup Time Limit: None seconds Memory Limit: None megabytes Problem Description: The last stage of Football World Cup is played using the play-off system. There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over. Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet. Input Specification: The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in. It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal. Output Specification: In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final. Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1. Demo Input: ['4 1 2\n', '8 2 6\n', '8 7 5\n'] Demo Output: ['1\n', 'Final!\n', '2\n'] Note: In the first example teams 1 and 2 meet in the first round. In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds. In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round.
```python x=input().split() x=[int(i) for i in x] x.sort() turn = 1 while(not(x[0]%2==1 and x[1]%2==0 and (x[1]-x[0])==1)): #print(x[0],x[1]) x[0]=(x[0])//2 + x[0]%2 x[1]=(x[1])//2 + x[1]%2 turn+=1 count = 1 prod=2 while(prod != x[2]): prod=prod*2 count+=1 if(count==turn): print("Final!") else: print(turn) ```
3
810
A
Straight <<A>>
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one. In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8. For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8. To graduate with «A» certificate, Noora has to have mark *k*. Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack.
Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*.
[ "2 10\n8 9\n", "3 5\n4 4 4\n" ]
[ "4", "3" ]
Consider the first example testcase. Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation. In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
500
[ { "input": "2 10\n8 9", "output": "4" }, { "input": "3 5\n4 4 4", "output": "3" }, { "input": "3 10\n10 8 9", "output": "3" }, { "input": "2 23\n21 23", "output": "2" }, { "input": "5 10\n5 10 10 9 10", "output": "7" }, { "input": "12 50\n18 10 26 22 22 23 14 21 27 18 25 12", "output": "712" }, { "input": "38 12\n2 7 10 8 5 3 5 6 3 6 5 1 9 7 7 8 3 4 4 4 5 2 3 6 6 1 6 7 4 4 8 7 4 5 3 6 6 6", "output": "482" }, { "input": "63 86\n32 31 36 29 36 26 28 38 39 32 29 26 33 38 36 38 36 28 43 48 28 33 25 39 39 27 34 25 37 28 40 26 30 31 42 32 36 44 29 36 30 35 48 40 26 34 30 33 33 46 42 24 36 38 33 51 33 41 38 29 29 32 28", "output": "6469" }, { "input": "100 38\n30 24 38 31 31 33 32 32 29 34 29 22 27 23 34 25 32 30 30 26 16 27 38 33 38 38 37 34 32 27 33 23 33 32 24 24 30 36 29 30 33 30 29 30 36 33 33 35 28 24 30 32 38 29 30 36 31 30 27 38 31 36 15 37 32 27 29 24 38 33 28 29 34 21 37 35 32 31 27 25 27 28 31 31 36 38 35 35 36 29 35 22 38 31 38 28 31 27 34 31", "output": "1340" }, { "input": "33 69\n60 69 68 69 69 60 64 60 62 59 54 47 60 62 69 69 69 58 67 69 62 69 68 53 69 69 66 66 57 58 65 69 61", "output": "329" }, { "input": "39 92\n19 17 16 19 15 30 21 25 14 17 19 19 23 16 14 15 17 19 29 15 11 25 19 14 18 20 10 16 11 15 18 20 20 17 18 16 12 17 16", "output": "5753" }, { "input": "68 29\n29 29 29 29 29 28 29 29 29 27 29 29 29 29 29 29 29 23 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 22 29 29 29 29 29 29 29 29 29 29 29 29 29 28 29 29 29 29", "output": "0" }, { "input": "75 30\n22 18 21 26 23 18 28 30 24 24 19 25 28 30 23 29 18 23 23 30 26 30 17 30 18 19 25 26 26 15 27 23 30 21 19 26 25 30 25 28 20 22 22 21 26 17 23 23 24 15 25 19 18 22 30 30 29 21 30 28 28 30 27 25 24 15 22 19 30 21 20 30 18 20 25", "output": "851" }, { "input": "78 43\n2 7 6 5 5 6 4 5 3 4 6 8 4 5 5 4 3 1 2 4 4 6 5 6 4 4 6 4 8 4 6 5 6 1 4 5 6 3 2 5 2 5 3 4 8 8 3 3 4 4 6 6 5 4 5 5 7 9 3 9 6 4 7 3 6 9 6 5 1 7 2 5 6 3 6 2 5 4", "output": "5884" }, { "input": "82 88\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1", "output": "14170" }, { "input": "84 77\n28 26 36 38 37 44 48 34 40 22 42 35 40 37 30 31 33 35 36 55 47 36 33 47 40 38 27 38 36 33 35 31 47 33 30 38 38 47 49 24 38 37 28 43 39 36 34 33 29 38 36 43 48 38 36 34 33 34 35 31 26 33 39 37 37 37 35 52 47 30 24 46 38 26 43 46 41 50 33 40 36 41 37 30", "output": "6650" }, { "input": "94 80\n21 19 15 16 27 16 20 18 19 19 15 15 20 19 19 21 20 19 13 17 15 9 17 15 23 15 12 18 12 13 15 12 14 13 14 17 20 20 14 21 15 6 10 23 24 8 18 18 13 23 17 22 17 19 19 18 17 24 8 16 18 20 24 19 10 19 15 10 13 14 19 15 16 19 20 15 14 21 16 16 14 14 22 19 12 11 14 13 19 32 16 16 13 20", "output": "11786" }, { "input": "96 41\n13 32 27 34 28 34 30 26 21 24 29 20 25 34 25 16 27 15 22 22 34 22 25 19 23 17 17 22 26 24 23 20 21 27 19 33 13 24 22 18 30 30 27 14 26 24 20 20 22 11 19 31 19 29 18 28 30 22 17 15 28 32 17 24 17 24 24 19 26 23 22 29 18 22 23 29 19 32 26 23 22 22 24 23 27 30 24 25 21 21 33 19 35 27 34 28", "output": "3182" }, { "input": "1 26\n26", "output": "0" }, { "input": "99 39\n25 28 30 28 32 34 31 28 29 28 29 30 33 19 33 31 27 33 29 24 27 30 25 38 28 34 35 31 34 37 30 22 21 24 34 27 34 33 34 33 26 26 36 19 30 22 35 30 21 28 23 35 33 29 21 22 36 31 34 32 34 32 30 32 27 33 38 25 35 26 39 27 29 29 19 33 28 29 34 38 26 30 36 26 29 30 26 34 22 32 29 38 25 27 24 17 25 28 26", "output": "1807" }, { "input": "100 12\n7 6 6 3 5 5 9 8 7 7 4 7 12 6 9 5 6 3 4 7 9 10 7 7 5 3 9 6 9 9 6 7 4 10 4 8 8 6 9 8 6 5 7 4 10 7 5 6 8 9 3 4 8 5 4 8 6 10 5 8 7 5 9 8 5 8 5 6 9 11 4 9 5 5 11 4 6 6 7 3 8 9 6 7 10 4 7 6 9 4 8 11 5 4 10 8 5 10 11 4", "output": "946" }, { "input": "100 18\n1 2 2 2 2 2 1 1 1 2 3 1 3 1 1 4 2 4 1 2 1 2 1 3 2 1 2 1 1 1 2 1 2 2 1 1 4 3 1 1 2 1 3 3 2 1 2 2 1 1 1 1 3 1 1 2 2 1 1 1 5 1 2 1 3 2 2 1 4 2 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 1 1 3 1 1 2 1 1 2", "output": "3164" }, { "input": "100 27\n16 20 21 10 16 17 18 25 19 18 20 12 11 21 21 23 20 26 20 21 27 16 25 18 25 21 27 12 20 27 18 17 27 13 21 26 12 22 15 21 25 21 18 27 24 15 16 18 23 21 24 27 19 17 24 14 21 16 24 26 13 14 25 18 27 26 22 16 27 27 17 25 17 12 22 10 19 27 19 20 23 22 25 23 17 25 14 20 22 10 22 27 21 20 15 26 24 27 12 16", "output": "1262" }, { "input": "100 29\n20 18 23 24 14 14 16 23 22 17 18 22 21 21 19 19 14 11 18 19 16 22 25 20 14 13 21 24 18 16 18 29 17 25 12 10 18 28 11 16 17 14 15 20 17 20 18 22 10 16 16 20 18 19 29 18 25 27 17 19 24 15 24 25 16 23 19 16 16 20 19 15 12 21 20 13 21 15 15 23 16 23 17 13 17 21 13 18 17 18 18 20 16 12 19 15 27 14 11 18", "output": "2024" }, { "input": "100 30\n16 10 20 11 14 27 15 17 22 26 24 17 15 18 19 22 22 15 21 22 14 21 22 22 21 22 15 17 17 22 18 19 26 18 22 20 22 25 18 18 17 23 18 18 20 13 19 30 17 24 22 19 29 20 20 21 17 18 26 25 22 19 15 18 18 20 19 19 18 18 24 16 19 17 12 21 20 16 23 21 16 17 26 23 25 28 22 20 9 21 17 24 15 19 17 21 29 13 18 15", "output": "1984" }, { "input": "100 59\n56 58 53 59 59 48 59 54 46 59 59 58 48 59 55 59 59 50 59 56 59 59 59 59 59 59 59 57 59 53 45 53 50 59 50 55 58 54 59 56 54 59 59 59 59 48 56 59 59 57 59 59 48 43 55 57 39 59 46 55 55 52 58 57 51 59 59 59 59 53 59 43 51 54 46 59 57 43 50 59 47 58 59 59 59 55 46 56 55 59 56 47 56 56 46 51 47 48 59 55", "output": "740" }, { "input": "100 81\n6 7 6 6 7 6 6 6 3 9 4 5 4 3 4 6 6 6 1 3 9 5 2 3 8 5 6 9 6 6 6 5 4 4 7 7 3 6 11 7 6 4 8 7 12 6 4 10 2 4 9 11 7 4 7 7 8 8 6 7 9 8 4 5 8 13 6 6 6 8 6 2 5 6 7 5 4 4 4 4 2 6 4 8 3 4 7 7 6 7 7 10 5 10 6 7 4 11 8 4", "output": "14888" }, { "input": "100 100\n30 35 23 43 28 49 31 32 30 44 32 37 33 34 38 28 43 32 33 32 50 32 41 38 33 20 40 36 29 21 42 25 23 34 43 32 37 31 30 27 36 32 45 37 33 29 38 34 35 33 28 19 37 33 28 41 31 29 41 27 32 39 30 34 37 40 33 38 35 32 32 34 35 34 28 39 28 34 40 45 31 25 42 28 29 31 33 21 36 33 34 37 40 42 39 30 36 34 34 40", "output": "13118" }, { "input": "100 100\n71 87 100 85 89 98 90 90 71 65 76 75 85 100 81 100 91 80 73 89 86 78 82 89 77 92 78 90 100 81 85 89 73 100 66 60 72 88 91 73 93 76 88 81 86 78 83 77 74 93 97 94 85 78 82 78 91 91 100 78 89 76 78 82 81 78 83 88 87 83 78 98 85 97 98 89 88 75 76 86 74 81 70 76 86 84 99 100 89 94 72 84 82 88 83 89 78 99 87 76", "output": "3030" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19700" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100 100\n1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19696" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99", "output": "0" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 98 100 100 100 100 98 100 100 100 100 100 100 99 98 100 100 93 100 100 98 100 100 100 100 93 100 96 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 95 88 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100 100\n95 100 100 100 100 100 100 100 100 100 100 100 100 100 87 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 90 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 96 100 98 100 100 100 100 100 96 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 100", "output": "2" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "100 2\n2 1 1 2 1 1 1 1 2 2 2 2 1 1 1 2 1 1 1 2 2 2 2 1 1 1 1 2 2 2 1 2 2 2 2 1 2 2 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 2 1 1 1 2 2 1 2 1 1 1 2 1 2 2 1 1 1 2 2 1 1 2 1 1 2 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 2 1 1", "output": "16" }, { "input": "3 5\n5 5 5", "output": "0" }, { "input": "7 7\n1 1 1 1 1 1 1", "output": "77" }, { "input": "1 1\n1", "output": "0" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19700" }, { "input": "4 10\n10 10 10 10", "output": "0" }, { "input": "1 10\n10", "output": "0" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3 10\n10 10 10", "output": "0" }, { "input": "2 4\n3 4", "output": "0" }, { "input": "1 2\n2", "output": "0" }, { "input": "3 4\n4 4 4", "output": "0" }, { "input": "3 2\n2 2 1", "output": "0" }, { "input": "5 5\n5 5 5 5 5", "output": "0" }, { "input": "3 3\n3 3 3", "output": "0" }, { "input": "2 9\n8 9", "output": "0" }, { "input": "3 10\n9 10 10", "output": "0" }, { "input": "1 3\n3", "output": "0" }, { "input": "2 2\n1 2", "output": "0" }, { "input": "2 10\n10 10", "output": "0" }, { "input": "23 14\n7 11 13 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14", "output": "0" }, { "input": "2 10\n9 10", "output": "0" }, { "input": "2 2\n2 2", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 5 5 4", "output": "0" }, { "input": "3 5\n4 5 5", "output": "0" }, { "input": "5 4\n4 4 4 4 4", "output": "0" }, { "input": "2 10\n10 9", "output": "0" }, { "input": "4 5\n3 5 5 5", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "3 10\n10 10 9", "output": "0" }, { "input": "5 1\n1 1 1 1 1", "output": "0" }, { "input": "2 1\n1 1", "output": "0" }, { "input": "4 10\n9 10 10 10", "output": "0" }, { "input": "5 2\n2 2 2 2 2", "output": "0" }, { "input": "2 5\n4 5", "output": "0" }, { "input": "5 10\n10 10 10 10 10", "output": "0" }, { "input": "2 6\n6 6", "output": "0" }, { "input": "2 9\n9 9", "output": "0" }, { "input": "3 10\n10 9 10", "output": "0" }, { "input": "4 40\n39 40 40 40", "output": "0" }, { "input": "3 4\n3 4 4", "output": "0" }, { "input": "9 9\n9 9 9 9 9 9 9 9 9", "output": "0" }, { "input": "1 4\n4", "output": "0" }, { "input": "4 7\n1 1 1 1", "output": "44" }, { "input": "1 5\n5", "output": "0" }, { "input": "3 1\n1 1 1", "output": "0" }, { "input": "1 100\n100", "output": "0" }, { "input": "2 7\n3 5", "output": "10" }, { "input": "3 6\n6 6 6", "output": "0" }, { "input": "4 2\n1 2 2 2", "output": "0" }, { "input": "4 5\n4 5 5 5", "output": "0" }, { "input": "5 5\n1 1 1 1 1", "output": "35" }, { "input": "66 2\n1 2 2 2 2 1 1 2 1 2 2 2 2 2 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 2 1 2 2 1 1 2 1 2 2 1 1 1 2 1 2 1 2 1 2 1 2 2 2 2 1 2 2 1 2 1 1 1 2 2 1", "output": "0" }, { "input": "2 2\n2 1", "output": "0" }, { "input": "5 5\n5 5 5 4 5", "output": "0" }, { "input": "3 7\n1 1 1", "output": "33" }, { "input": "2 5\n5 5", "output": "0" }, { "input": "1 7\n1", "output": "11" }, { "input": "6 7\n1 1 1 1 1 1", "output": "66" }, { "input": "99 97\n15 80 78 69 12 84 36 51 89 77 88 10 1 19 67 85 6 36 8 70 14 45 88 97 22 13 75 57 83 27 13 97 9 90 68 51 76 37 5 2 16 92 11 48 13 77 35 19 15 74 22 29 21 12 28 42 56 5 32 41 62 75 71 71 68 72 24 77 11 28 78 27 53 88 74 66 1 42 18 16 18 39 75 38 81 5 13 39 40 75 13 36 53 83 9 54 57 63 64", "output": "10077" }, { "input": "8 7\n1 1 1 1 1 1 1 1", "output": "88" }, { "input": "3 2\n2 2 2", "output": "0" }, { "input": "6 5\n5 5 5 5 5 5", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 4 1 1", "output": "8" }, { "input": "1 5\n1", "output": "7" }, { "input": "10 10\n10 10 10 10 10 10 10 10 10 10", "output": "0" }, { "input": "2 3\n2 3", "output": "0" }, { "input": "1 9\n9", "output": "0" }, { "input": "74 2\n2 2 2 2 1 2 2 1 1 1 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 2 1 2 1 1 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 1 1 2 1 1 1 1 1 1 2 2 2 1 1 1 1 1 2 2 2 2 2 2 1 2", "output": "0" }, { "input": "5 5\n5 5 5 5 4", "output": "0" } ]
1,505,452,315
2,147,483,647
Python 3
OK
TESTS
106
62
0
def average(ns): return sum(ns)/len(ns) def main(): t = [int(x) for x in input().split()] n = t[0] k = t[1] ns = [int(y) for y in input().split()] if round(average(ns)) == k: print(0) else: print(int(-2 * (sum(ns) - k*n + 0.5*n))) if __name__ == '__main__': main()
Title: Straight <<A>> Time Limit: None seconds Memory Limit: None megabytes Problem Description: Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one. In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8. For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8. To graduate with «A» certificate, Noora has to have mark *k*. Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack. Output Specification: Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*. Demo Input: ['2 10\n8 9\n', '3 5\n4 4 4\n'] Demo Output: ['4', '3'] Note: Consider the first example testcase. Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation. In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
```python def average(ns): return sum(ns)/len(ns) def main(): t = [int(x) for x in input().split()] n = t[0] k = t[1] ns = [int(y) for y in input().split()] if round(average(ns)) == k: print(0) else: print(int(-2 * (sum(ns) - k*n + 0.5*n))) if __name__ == '__main__': main() ```
3
494
A
Treasure
PROGRAMMING
1,500
[ "greedy" ]
null
null
Malek has recently found a treasure map. While he was looking for a treasure he found a locked door. There was a string *s* written on the door consisting of characters '(', ')' and '#'. Below there was a manual on how to open the door. After spending a long time Malek managed to decode the manual and found out that the goal is to replace each '#' with one or more ')' characters so that the final string becomes beautiful. Below there was also written that a string is called beautiful if for each *i* (1<=≤<=*i*<=≤<=|*s*|) there are no more ')' characters than '(' characters among the first *i* characters of *s* and also the total number of '(' characters is equal to the total number of ')' characters. Help Malek open the door by telling him for each '#' character how many ')' characters he must replace it with.
The first line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=105). Each character of this string is one of the characters '(', ')' or '#'. It is guaranteed that *s* contains at least one '#' character.
If there is no way of replacing '#' characters which leads to a beautiful string print <=-<=1. Otherwise for each character '#' print a separate line containing a positive integer, the number of ')' characters this character must be replaced with. If there are several possible answers, you may output any of them.
[ "(((#)((#)\n", "()((#((#(#()\n", "#\n", "(#)\n" ]
[ "1\n2\n", "2\n2\n1", "-1\n", "-1\n" ]
|*s*| denotes the length of the string *s*.
500
[ { "input": "(((#)((#)", "output": "1\n2" }, { "input": "()((#((#(#()", "output": "1\n1\n3" }, { "input": "#", "output": "-1" }, { "input": "(#)", "output": "-1" }, { "input": "(((((#(#(#(#()", "output": "1\n1\n1\n5" }, { "input": "#))))", "output": "-1" }, { "input": "((#(()#(##", "output": "1\n1\n1\n1" }, { "input": "##((((((()", "output": "-1" }, { "input": "(((((((((((((((((((###################", "output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": "((#)(", "output": "-1" }, { "input": "((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((##", "output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": ")((##((###", "output": "-1" }, { "input": "(#))(#(#)((((#(##((#(#((((#(##((((((#((()(()(())((()#((((#((()((((#(((((#(##)(##()((((()())(((((#(((", "output": "-1" }, { "input": "#(#(#((##((()))(((#)(#()#(((()()(()#(##(((()(((()))#(((((()(((((((()#((#((()(#(((()(()##(()(((()((#(", "output": "-1" }, { "input": "((#(", "output": "-1" }, { "input": "()#(#())()()#)(#)()##)#((()#)((#)()#())((#((((((((#)()()(()()(((((#)#(#((((#((##()(##(((#(()(#((#))#", "output": "-1" }, { "input": "(())((((#)", "output": "3" }, { "input": "(#(", "output": "-1" }, { "input": "((#)(", "output": "-1" }, { "input": "(((()#(#)(", "output": "-1" }, { "input": "#((#", "output": "-1" }, { "input": "(#((((()", "output": "-1" }, { "input": "(#((", "output": "-1" }, { "input": ")(((())#", "output": "-1" } ]
1,607,856,016
2,147,483,647
PyPy 3
OK
TESTS
56
171
3,584,000
s = input() n = len(s) p, curr = n - 1, 0 while s[p] != '#': if s[p] == ')': curr += 1 else: curr -= 1 p -= 1 if curr < 0: print(-1) exit() cnt_hash, curr = s.count('#'), 0 for i in range(p): if s[i] == '(': curr += 1 else: curr -= 1 if curr < 0: print(-1) exit() res = s.count('(') - s.count(')') - (cnt_hash - 1) if res <= 0: print(-1) exit() cnt_hash -= 1 print('\n'.join('1'*cnt_hash)) print(s.count('(') - s.count(')') - cnt_hash)
Title: Treasure Time Limit: None seconds Memory Limit: None megabytes Problem Description: Malek has recently found a treasure map. While he was looking for a treasure he found a locked door. There was a string *s* written on the door consisting of characters '(', ')' and '#'. Below there was a manual on how to open the door. After spending a long time Malek managed to decode the manual and found out that the goal is to replace each '#' with one or more ')' characters so that the final string becomes beautiful. Below there was also written that a string is called beautiful if for each *i* (1<=≤<=*i*<=≤<=|*s*|) there are no more ')' characters than '(' characters among the first *i* characters of *s* and also the total number of '(' characters is equal to the total number of ')' characters. Help Malek open the door by telling him for each '#' character how many ')' characters he must replace it with. Input Specification: The first line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=105). Each character of this string is one of the characters '(', ')' or '#'. It is guaranteed that *s* contains at least one '#' character. Output Specification: If there is no way of replacing '#' characters which leads to a beautiful string print <=-<=1. Otherwise for each character '#' print a separate line containing a positive integer, the number of ')' characters this character must be replaced with. If there are several possible answers, you may output any of them. Demo Input: ['(((#)((#)\n', '()((#((#(#()\n', '#\n', '(#)\n'] Demo Output: ['1\n2\n', '2\n2\n1', '-1\n', '-1\n'] Note: |*s*| denotes the length of the string *s*.
```python s = input() n = len(s) p, curr = n - 1, 0 while s[p] != '#': if s[p] == ')': curr += 1 else: curr -= 1 p -= 1 if curr < 0: print(-1) exit() cnt_hash, curr = s.count('#'), 0 for i in range(p): if s[i] == '(': curr += 1 else: curr -= 1 if curr < 0: print(-1) exit() res = s.count('(') - s.count(')') - (cnt_hash - 1) if res <= 0: print(-1) exit() cnt_hash -= 1 print('\n'.join('1'*cnt_hash)) print(s.count('(') - s.count(')') - cnt_hash) ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,685,206,592
2,147,483,647
Python 3
OK
TESTS
31
92
0
h=int(input()) v=0 list1=[] list2=[] for s in range(h): f,g=map(lambda z:int(z),input().split()) list1.append(f) list2.append(g) for c in list1: p=0 while p<len(list2): if c == list2[p]: v+=1 p+=1 print(v)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python h=int(input()) v=0 list1=[] list2=[] for s in range(h): f,g=map(lambda z:int(z),input().split()) list1.append(f) list2.append(g) for c in list1: p=0 while p<len(list2): if c == list2[p]: v+=1 p+=1 print(v) ```
3
877
A
Alex and broken contest
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems. But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name. It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita". Names are case sensitive.
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
Print "YES", if problem is from this contest, and "NO" otherwise.
[ "Alex_and_broken_contest\n", "NikitaAndString\n", "Danil_and_Olya\n" ]
[ "NO", "YES", "NO" ]
none
500
[ { "input": "Alex_and_broken_contest", "output": "NO" }, { "input": "NikitaAndString", "output": "YES" }, { "input": "Danil_and_Olya", "output": "NO" }, { "input": "Slava____and_the_game", "output": "YES" }, { "input": "Olya_and_energy_drinks", "output": "YES" }, { "input": "Danil_and_part_time_job", "output": "YES" }, { "input": "Ann_and_books", "output": "YES" }, { "input": "Olya", "output": "YES" }, { "input": "Nikita", "output": "YES" }, { "input": "Slava", "output": "YES" }, { "input": "Vanya", "output": "NO" }, { "input": "I_dont_know_what_to_write_here", "output": "NO" }, { "input": "danil_and_work", "output": "NO" }, { "input": "Ann", "output": "YES" }, { "input": "Batman_Nananananananan_Batman", "output": "NO" }, { "input": "Olya_Nikita_Ann_Slava_Danil", "output": "NO" }, { "input": "its_me_Mario", "output": "NO" }, { "input": "A", "output": "NO" }, { "input": "Wake_up_Neo", "output": "NO" }, { "input": "Hardest_problem_ever", "output": "NO" }, { "input": "Nikita_Nikita", "output": "NO" }, { "input": "____________________________________________________________________________________________________", "output": "NO" }, { "input": "Nikitb", "output": "NO" }, { "input": "Unn", "output": "NO" }, { "input": "oLya_adn_smth", "output": "NO" }, { "input": "FloorISLava", "output": "NO" }, { "input": "ann", "output": "NO" }, { "input": "aa", "output": "NO" }, { "input": "AAnnnnn", "output": "YES" }, { "input": "AnnAnn", "output": "NO" }, { "input": "Annn", "output": "YES" }, { "input": "Dilzhan", "output": "NO" }, { "input": "Danilaaa", "output": "YES" }, { "input": "AndAnn", "output": "YES" }, { "input": "OlyaAnnAnn", "output": "NO" }, { "input": "DanilDanilOlya", "output": "NO" }, { "input": "DDanil", "output": "YES" }, { "input": "AnnAnnDanil", "output": "NO" }, { "input": "And_Danil", "output": "YES" }, { "input": "abcddddDanil", "output": "YES" }, { "input": "DanilOlyaOlya", "output": "NO" }, { "input": "Nikitaaa", "output": "YES" }, { "input": "aaabbba", "output": "NO" }, { "input": "Ann_Ann_Danil", "output": "NO" }, { "input": "Danil_Danil_Nikita", "output": "NO" }, { "input": "AlexaaaaaaBBBBBOlyaDDDDD", "output": "YES" }, { "input": "IloveDaniland", "output": "YES" }, { "input": "AnAnn", "output": "YES" }, { "input": "Danil_Danil_Olya", "output": "NO" }, { "input": "DanilDanilSlava", "output": "NO" }, { "input": "DanilDanil", "output": "NO" }, { "input": "OlyOlya", "output": "YES" }, { "input": "NikitaNikitb", "output": "YES" }, { "input": "ababaca", "output": "NO" }, { "input": "AnnNikitaNikitaNikitaNikita__good_luck", "output": "NO" } ]
1,645,785,530
2,147,483,647
Python 3
OK
TESTS
55
46
0
s=input().rstrip() l=["Danil", "Olya", "Slava", "Ann","Nikita"] a=[] f=0 for x in l: if x in s: a.append(x) if len(a)==1: if s.count(a[0])==1:print("YES") else:print("NO") else:print("NO")
Title: Alex and broken contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems. But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name. It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita". Names are case sensitive. Input Specification: The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem. Output Specification: Print "YES", if problem is from this contest, and "NO" otherwise. Demo Input: ['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n'] Demo Output: ['NO', 'YES', 'NO'] Note: none
```python s=input().rstrip() l=["Danil", "Olya", "Slava", "Ann","Nikita"] a=[] f=0 for x in l: if x in s: a.append(x) if len(a)==1: if s.count(a[0])==1:print("YES") else:print("NO") else:print("NO") ```
3
732
A
Buy a Shovel
PROGRAMMING
800
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
[ "117 3\n", "237 7\n", "15 2\n" ]
[ "9\n", "1\n", "2\n" ]
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
500
[ { "input": "117 3", "output": "9" }, { "input": "237 7", "output": "1" }, { "input": "15 2", "output": "2" }, { "input": "1 1", "output": "1" }, { "input": "1 9", "output": "9" }, { "input": "1000 3", "output": "1" }, { "input": "1000 1", "output": "1" }, { "input": "1000 9", "output": "1" }, { "input": "1 2", "output": "2" }, { "input": "999 9", "output": "1" }, { "input": "999 8", "output": "2" }, { "input": "105 6", "output": "2" }, { "input": "403 9", "output": "3" }, { "input": "546 4", "output": "4" }, { "input": "228 9", "output": "5" }, { "input": "57 2", "output": "6" }, { "input": "437 9", "output": "7" }, { "input": "997 6", "output": "8" }, { "input": "109 1", "output": "9" }, { "input": "998 9", "output": "5" }, { "input": "4 2", "output": "3" }, { "input": "9 3", "output": "7" }, { "input": "8 2", "output": "4" }, { "input": "1 3", "output": "3" }, { "input": "1 4", "output": "4" }, { "input": "1 5", "output": "5" }, { "input": "1 6", "output": "6" }, { "input": "1 7", "output": "7" }, { "input": "1 8", "output": "8" }, { "input": "100 3", "output": "1" }, { "input": "1000 2", "output": "1" }, { "input": "1000 4", "output": "1" }, { "input": "1000 5", "output": "1" }, { "input": "1000 6", "output": "1" }, { "input": "1000 7", "output": "1" }, { "input": "1000 8", "output": "1" }, { "input": "23 4", "output": "8" }, { "input": "33 1", "output": "7" }, { "input": "33 2", "output": "4" }, { "input": "666 5", "output": "5" }, { "input": "2 3", "output": "5" }, { "input": "5 5", "output": "1" }, { "input": "3 6", "output": "2" }, { "input": "12 4", "output": "2" }, { "input": "15 5", "output": "1" }, { "input": "2 5", "output": "5" }, { "input": "25 5", "output": "1" }, { "input": "2 9", "output": "5" }, { "input": "6 7", "output": "5" }, { "input": "8 9", "output": "5" }, { "input": "2 7", "output": "5" }, { "input": "4 7", "output": "5" }, { "input": "2 1", "output": "5" }, { "input": "261 1", "output": "1" } ]
1,697,391,983
2,147,483,647
Python 3
OK
TESTS
54
46
0
k,m =map(int,input().split()) n=1 while (k*n-m)%10!=0: if (k*n)%10==0: break n+=1 print(n)
Title: Buy a Shovel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel. Input Specification: The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels. Output Specification: Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change. Demo Input: ['117 3\n', '237 7\n', '15 2\n'] Demo Output: ['9\n', '1\n', '2\n'] Note: In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
```python k,m =map(int,input().split()) n=1 while (k*n-m)%10!=0: if (k*n)%10==0: break n+=1 print(n) ```
3
628
A
Tennis Tournament
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
A tennis tournament with *n* participants is running. The participants are playing by an olympic system, so the winners move on and the losers drop out. The tournament takes place in the following way (below, *m* is the number of the participants of the current round): - let *k* be the maximal power of the number 2 such that *k*<=≤<=*m*, - *k* participants compete in the current round and a half of them passes to the next round, the other *m*<=-<=*k* participants pass to the next round directly, - when only one participant remains, the tournament finishes. Each match requires *b* bottles of water for each participant and one bottle for the judge. Besides *p* towels are given to each participant for the whole tournament. Find the number of bottles and towels needed for the tournament. Note that it's a tennis tournament so in each match two participants compete (one of them will win and the other will lose).
The only line contains three integers *n*,<=*b*,<=*p* (1<=≤<=*n*,<=*b*,<=*p*<=≤<=500) — the number of participants and the parameters described in the problem statement.
Print two integers *x* and *y* — the number of bottles and towels need for the tournament.
[ "5 2 3\n", "8 2 4\n" ]
[ "20 15\n", "35 32\n" ]
In the first example will be three rounds: 1. in the first round will be two matches and for each match 5 bottles of water are needed (two for each of the participants and one for the judge), 1. in the second round will be only one match, so we need another 5 bottles of water, 1. in the third round will also be only one match, so we need another 5 bottles of water. So in total we need 20 bottles of water. In the second example no participant will move on to some round directly.
0
[ { "input": "5 2 3", "output": "20 15" }, { "input": "8 2 4", "output": "35 32" }, { "input": "10 1 500", "output": "27 5000" }, { "input": "20 500 1", "output": "19019 20" }, { "input": "100 123 99", "output": "24453 9900" }, { "input": "500 1 1", "output": "1497 500" }, { "input": "500 500 500", "output": "499499 250000" }, { "input": "500 237 474", "output": "237025 237000" }, { "input": "1 2 3", "output": "0 3" }, { "input": "1 2 133", "output": "0 133" }, { "input": "1 2 100", "output": "0 100" }, { "input": "1 3 4", "output": "0 4" }, { "input": "1 10 15", "output": "0 15" }, { "input": "1 1 1", "output": "0 1" }, { "input": "1 2 5", "output": "0 5" }, { "input": "1 500 500", "output": "0 500" }, { "input": "1 3 8", "output": "0 8" }, { "input": "10 10 10", "output": "189 100" }, { "input": "1 3 5", "output": "0 5" }, { "input": "1 2 1", "output": "0 1" }, { "input": "1 2 4", "output": "0 4" }, { "input": "1 10 10", "output": "0 10" }, { "input": "1 345 345", "output": "0 345" }, { "input": "7 12 13", "output": "150 91" }, { "input": "1 500 1", "output": "0 1" }, { "input": "1 12 13", "output": "0 13" }, { "input": "1 500 499", "output": "0 499" }, { "input": "1 100 90", "output": "0 90" }, { "input": "2 100 90", "output": "201 180" }, { "input": "53 1 1", "output": "156 53" }, { "input": "73 73 73", "output": "10584 5329" }, { "input": "67 1 1", "output": "198 67" }, { "input": "63 1 1", "output": "186 63" }, { "input": "59 1 1", "output": "174 59" }, { "input": "57 1 1", "output": "168 57" }, { "input": "13 1 1", "output": "36 13" }, { "input": "349 2 5", "output": "1740 1745" }, { "input": "456 456 456", "output": "415415 207936" } ]
1,484,849,539
2,147,483,647
Python 3
OK
TESTS
38
124
5,324,800
#Justin Hershberger #Py3.5 import fileinput def test(): pass if __name__ == '__main__': num_args = 1 for arg in range(num_args): n,b,p = map(int, input().split()) #m is the number of participants of the current round m = n #initially we have n / 2 matches since there are n participants num_matches = m // 2 #the remainder is the number of extras extras = abs(-m // 2) - num_matches #initially our running total will be num matches * 3 sum_b = (num_matches * 2 * b) + (num_matches) #we have n participants so we initially need n * p towels sum_p = n * p # print("nm: ", num_matches, " ex: ", extras, " sum_b: ", sum_b, " sum_p: ", sum_p); # print(m) #each match needs b bottles * 3, each player needs p towels while num_matches > 0: #update the number of participants and num_bottles m = num_matches + extras # print("m: ", m) #update the number of matches num_matches = m // 2 # print("nm: ", num_matches) extras = abs(-m // 2) - num_matches # print("ex: ", extras) #each match has two participants and one judge who gets one bottle sum_b += (num_matches * 2 * b) + (num_matches) print(sum_b, sum_p)
Title: Tennis Tournament Time Limit: None seconds Memory Limit: None megabytes Problem Description: A tennis tournament with *n* participants is running. The participants are playing by an olympic system, so the winners move on and the losers drop out. The tournament takes place in the following way (below, *m* is the number of the participants of the current round): - let *k* be the maximal power of the number 2 such that *k*<=≤<=*m*, - *k* participants compete in the current round and a half of them passes to the next round, the other *m*<=-<=*k* participants pass to the next round directly, - when only one participant remains, the tournament finishes. Each match requires *b* bottles of water for each participant and one bottle for the judge. Besides *p* towels are given to each participant for the whole tournament. Find the number of bottles and towels needed for the tournament. Note that it's a tennis tournament so in each match two participants compete (one of them will win and the other will lose). Input Specification: The only line contains three integers *n*,<=*b*,<=*p* (1<=≤<=*n*,<=*b*,<=*p*<=≤<=500) — the number of participants and the parameters described in the problem statement. Output Specification: Print two integers *x* and *y* — the number of bottles and towels need for the tournament. Demo Input: ['5 2 3\n', '8 2 4\n'] Demo Output: ['20 15\n', '35 32\n'] Note: In the first example will be three rounds: 1. in the first round will be two matches and for each match 5 bottles of water are needed (two for each of the participants and one for the judge), 1. in the second round will be only one match, so we need another 5 bottles of water, 1. in the third round will also be only one match, so we need another 5 bottles of water. So in total we need 20 bottles of water. In the second example no participant will move on to some round directly.
```python #Justin Hershberger #Py3.5 import fileinput def test(): pass if __name__ == '__main__': num_args = 1 for arg in range(num_args): n,b,p = map(int, input().split()) #m is the number of participants of the current round m = n #initially we have n / 2 matches since there are n participants num_matches = m // 2 #the remainder is the number of extras extras = abs(-m // 2) - num_matches #initially our running total will be num matches * 3 sum_b = (num_matches * 2 * b) + (num_matches) #we have n participants so we initially need n * p towels sum_p = n * p # print("nm: ", num_matches, " ex: ", extras, " sum_b: ", sum_b, " sum_p: ", sum_p); # print(m) #each match needs b bottles * 3, each player needs p towels while num_matches > 0: #update the number of participants and num_bottles m = num_matches + extras # print("m: ", m) #update the number of matches num_matches = m // 2 # print("nm: ", num_matches) extras = abs(-m // 2) - num_matches # print("ex: ", extras) #each match has two participants and one judge who gets one bottle sum_b += (num_matches * 2 * b) + (num_matches) print(sum_b, sum_p) ```
3
313
A
Ilya and Bank Account
PROGRAMMING
900
[ "implementation", "number theory" ]
null
null
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
In a single line print an integer — the maximum state of the bank account that Ilya can get.
[ "2230\n", "-10\n", "-100003\n" ]
[ "2230\n", "0\n", "-10000\n" ]
In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
500
[ { "input": "2230", "output": "2230" }, { "input": "-10", "output": "0" }, { "input": "-100003", "output": "-10000" }, { "input": "544883178", "output": "544883178" }, { "input": "-847251738", "output": "-84725173" }, { "input": "423654797", "output": "423654797" }, { "input": "-623563697", "output": "-62356367" }, { "input": "645894116", "output": "645894116" }, { "input": "-384381709", "output": "-38438170" }, { "input": "437587210", "output": "437587210" }, { "input": "-297534606", "output": "-29753460" }, { "input": "891773002", "output": "891773002" }, { "input": "-56712976", "output": "-5671296" }, { "input": "963662765", "output": "963662765" }, { "input": "-272656295", "output": "-27265625" }, { "input": "383441522", "output": "383441522" }, { "input": "-477665112", "output": "-47766511" }, { "input": "791725034", "output": "791725034" }, { "input": "-812168727", "output": "-81216872" }, { "input": "528894922", "output": "528894922" }, { "input": "-479977172", "output": "-47997712" }, { "input": "568044564", "output": "568044564" }, { "input": "-392784794", "output": "-39278474" }, { "input": "925596634", "output": "925596634" }, { "input": "-836078769", "output": "-83607876" }, { "input": "71036059", "output": "71036059" }, { "input": "-337396162", "output": "-33739612" }, { "input": "87129297", "output": "87129297" }, { "input": "-648171877", "output": "-64817187" }, { "input": "20218400", "output": "20218400" }, { "input": "10", "output": "10" }, { "input": "1000000000", "output": "1000000000" }, { "input": "-1000000000", "output": "-100000000" }, { "input": "-102", "output": "-10" }, { "input": "-120", "output": "-10" }, { "input": "-20", "output": "0" }, { "input": "-15", "output": "-1" }, { "input": "-5575533", "output": "-557553" }, { "input": "-50", "output": "0" }, { "input": "-31", "output": "-1" }, { "input": "-55", "output": "-5" }, { "input": "-81", "output": "-1" }, { "input": "-99", "output": "-9" }, { "input": "-23", "output": "-2" }, { "input": "-41", "output": "-1" }, { "input": "-24", "output": "-2" }, { "input": "46", "output": "46" } ]
1,690,710,562
2,147,483,647
Python 3
OK
TESTS
47
92
0
n=int(input()) x=str(n) if n<0: if (len(x)-1)<2: print(0) else: n1=(-1*n)%10 n2=((-1*n)%100)//10 if n1>n2: y=(-1*n)//10 y=(-1*y) print(y) else: y=(-1*n)//100 y=(y*10)+n1 y=(-1*y) print(y) else: print(n)
Title: Ilya and Bank Account Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift. Input Specification: The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account. Output Specification: In a single line print an integer — the maximum state of the bank account that Ilya can get. Demo Input: ['2230\n', '-10\n', '-100003\n'] Demo Output: ['2230\n', '0\n', '-10000\n'] Note: In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
```python n=int(input()) x=str(n) if n<0: if (len(x)-1)<2: print(0) else: n1=(-1*n)%10 n2=((-1*n)%100)//10 if n1>n2: y=(-1*n)//10 y=(-1*y) print(y) else: y=(-1*n)//100 y=(y*10)+n1 y=(-1*y) print(y) else: print(n) ```
3
485
A
Factory
PROGRAMMING
1,400
[ "implementation", "math", "matrices" ]
null
null
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory. The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*). Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
[ "1 5\n", "3 6\n" ]
[ "No\n", "Yes\n" ]
none
1,000
[ { "input": "1 5", "output": "No" }, { "input": "3 6", "output": "Yes" }, { "input": "1 8", "output": "Yes" }, { "input": "2 3", "output": "No" }, { "input": "3 24", "output": "Yes" }, { "input": "1 1", "output": "Yes" }, { "input": "100000 100000", "output": "Yes" }, { "input": "1 99989", "output": "No" }, { "input": "512 2", "output": "Yes" }, { "input": "100 24", "output": "No" }, { "input": "1 100000", "output": "No" }, { "input": "100000 1", "output": "Yes" }, { "input": "3 99929", "output": "No" }, { "input": "99961 99971", "output": "No" }, { "input": "1 65536", "output": "Yes" }, { "input": "4 65536", "output": "Yes" }, { "input": "3 65536", "output": "Yes" }, { "input": "32768 65536", "output": "Yes" }, { "input": "65535 65536", "output": "Yes" }, { "input": "1 65535", "output": "No" }, { "input": "98812 100000", "output": "No" }, { "input": "10 5", "output": "Yes" }, { "input": "6 8", "output": "Yes" } ]
1,629,292,299
2,147,483,647
Python 3
OK
TESTS
23
62
6,758,400
# _ ##################################################################################################################### from math import log2 def main(): nDetails, m = map(int, input().split()) return willProductionStop(nDetails, m) def willProductionStop(nDetails, m): power1, power2 = log2(m), log2(nDetails) difference = power1 - power2 if round(power1) == power1 or round(difference) == difference or not nDetails%m: return 'Yes' return 'No' if __name__ == '__main__': print(main()) # main()
Title: Factory Time Limit: None seconds Memory Limit: None megabytes Problem Description: One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory. The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*). Given the number of details *a* on the first day and number *m* check if the production stops at some moment. Input Specification: The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105). Output Specification: Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No". Demo Input: ['1 5\n', '3 6\n'] Demo Output: ['No\n', 'Yes\n'] Note: none
```python # _ ##################################################################################################################### from math import log2 def main(): nDetails, m = map(int, input().split()) return willProductionStop(nDetails, m) def willProductionStop(nDetails, m): power1, power2 = log2(m), log2(nDetails) difference = power1 - power2 if round(power1) == power1 or round(difference) == difference or not nDetails%m: return 'Yes' return 'No' if __name__ == '__main__': print(main()) # main() ```
3
707
A
Brain's Photos
PROGRAMMING
800
[ "implementation" ]
null
null
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
[ "2 2\nC M\nY Y\n", "3 2\nW W\nW W\nB B\n", "1 1\nW\n" ]
[ "#Color", "#Black&amp;White", "#Black&amp;White" ]
none
500
[ { "input": "2 2\nC M\nY Y", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G Y", "output": "#Color" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B", "output": "#Color" }, { "input": "1 6\nC M Y W G B", "output": "#Color" }, { "input": "1 3\nW G B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G C", "output": "#Color" }, { "input": "2 3\nW W W\nB G M", "output": "#Color" }, { "input": "3 3\nC B W\nB Y M\nB B W", "output": "#Color" }, { "input": "1 3\nW C W", "output": "#Color" }, { "input": "3 3\nB W B\nB C W\nB W W", "output": "#Color" }, { "input": "1 2\nW Y", "output": "#Color" }, { "input": "1 1\nG", "output": "#Black&White" }, { "input": "1 3\nB G W", "output": "#Black&White" }, { "input": "2 2\nW W\nB C", "output": "#Color" }, { "input": "1 1\nM", "output": "#Color" }, { "input": "1 2\nW C", "output": "#Color" }, { "input": "2 3\nW W M\nW W M", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB C", "output": "#Color" }, { "input": "2 3\nW W C\nW W W", "output": "#Color" }, { "input": "1 3\nG G G", "output": "#Black&White" }, { "input": "1 1\nC", "output": "#Color" }, { "input": "1 2\nC W", "output": "#Color" }, { "input": "1 3\nW W C", "output": "#Color" }, { "input": "2 2\nW B\nB G", "output": "#Black&White" }, { "input": "2 2\nB B\nY Y", "output": "#Color" }, { "input": "2 2\nG G\nC C", "output": "#Color" }, { "input": "1 2\nB C", "output": "#Color" }, { "input": "1 4\nG G G C", "output": "#Color" }, { "input": "1 1\nB", "output": "#Black&White" }, { "input": "2 1\nY\nB", "output": "#Color" } ]
1,682,080,782
2,147,483,647
PyPy 3-64
OK
TESTS
50
78
1,536,000
a, b = map(int, input().split()) w = 0 c = 0 g = 0 for i in range(a): l = list(map(str, input().split())) w = l.count('W') + w c = l.count('B') + c g = l.count('G') + g if (w+c+g) == a * b: print("#Black&White") else: print("#Color")
Title: Brain's Photos Time Limit: None seconds Memory Limit: None megabytes Problem Description: Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. Output Specification: Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. Demo Input: ['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n'] Demo Output: ['#Color', '#Black&amp;White', '#Black&amp;White'] Note: none
```python a, b = map(int, input().split()) w = 0 c = 0 g = 0 for i in range(a): l = list(map(str, input().split())) w = l.count('W') + w c = l.count('B') + c g = l.count('G') + g if (w+c+g) == a * b: print("#Black&White") else: print("#Color") ```
3
548
A
Mike and Fax
PROGRAMMING
1,100
[ "brute force", "implementation", "strings" ]
null
null
While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*. He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length. He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length.
The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000). The second line contains integer *k* (1<=≤<=*k*<=≤<=1000).
Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise.
[ "saba\n2\n", "saddastavvat\n2\n" ]
[ "NO\n", "YES\n" ]
Palindrome is a string reading the same forward and backward. In the second sample, the faxes in his back-bag can be "saddas" and "tavvat".
500
[ { "input": "saba\n2", "output": "NO" }, { "input": "saddastavvat\n2", "output": "YES" }, { "input": "aaaaaaaaaa\n3", "output": "NO" }, { "input": "aaaaaa\n3", "output": "YES" }, { "input": "abaacca\n2", "output": "NO" }, { "input": "a\n1", "output": "YES" }, { "input": "princeofpersia\n1", "output": "NO" }, { "input": "xhwbdoryfiaxglripavycmxmcejbcpzidrqsqvikfzjyfnmedxrvlnusavyhillaxrblkynwdrlhthtqzjktzkullgrqsolqssocpfwcaizhovajlhmeibhiuwtxpljkyyiwykzpmazkkzampzkywiyykjlpxtwuihbiemhljavohziacwfpcossqlosqrgllukztkjzqththlrdwnyklbrxallihyvasunlvrxdemnfyjzfkivqsqrdizpcbjecmxmcyvapirlgxaifyrodbwhx\n1", "output": "YES" }, { "input": "yfhqnbzaqeqmcvtsbcdn\n456", "output": "NO" }, { "input": "lgsdfiforlqrohhjyzrigewkigiiffvbyrapzmjvtkklndeyuqpuukajgtguhlarjdqlxksyekbjgrmhuyiqdlzjqqzlxufffpelyptodwhvkfbalxbufrlcsjgxmfxeqsszqghcustqrqjljattgvzynyvfbjgbuynbcguqtyfowgtcbbaywvcrgzrulqpghwoflutswu\n584", "output": "NO" }, { "input": "awlrhmxxivqbntvtapwkdkunamcqoerfncfmookhdnuxtttlxmejojpwbdyxirdsjippzjhdrpjepremruczbedxrjpodlyyldopjrxdebzcurmerpejprdhjzppijsdrixydbwpjojemxltttxundhkoomfcnfreoqcmanukdkwpatvtnbqvixxmhrlwa\n1", "output": "YES" }, { "input": "kafzpsglcpzludxojtdhzynpbekzssvhzizfrboxbhqvojiqtjitrackqccxgenwwnegxccqkcartijtqijovqhbxobrfzizhvsszkebpnyzhdtjoxdulzpclgspzfakvcbbjejeubvrrzlvjjgrcprntbyuakoxowoybbxgdugjffgbtfwrfiobifrshyaqqayhsrfiboifrwftbgffjgudgxbbyowoxokauybtnrpcrgjjvlzrrvbuejejbbcv\n2", "output": "YES" }, { "input": "zieqwmmbrtoxysvavwdemmdeatfrolsqvvlgphhhmojjfxfurtuiqdiilhlcwwqedlhblrzmvuoaczcwrqzyymiggpvbpkycibsvkhytrzhguksxyykkkvfljbbnjblylftmqxkojithwsegzsaexlpuicexbdzpwesrkzbqltxhifwqcehzsjgsqbwkujvjbjpqxdpmlimsusumizizpyigmkxwuberthdghnepyrxzvvidxeafwylegschhtywvqsxuqmsddhkzgkdiekodqpnftdyhnpicsnbhfxemxllvaurkmjvtrmqkulerxtaolmokiqqvqgechkqxmendpmgxwiaffcajmqjmvrwryzxujmiasuqtosuisiclnv\n8", "output": "NO" }, { "input": "syghzncbi\n829", "output": "NO" }, { "input": "ljpdpstntznciejqqtpysskztdfawuncqzwwfefrfsihyrdopwawowshquqnjhesxszuywezpebpzhtopgngrnqgwnoqhyrykojguybvdbjpfpmvkxscocywzsxcivysfrrzsonayztzzuybrkiombhqcfkszyscykzistiobrpavezedgobowjszfadcccmxyqehmkgywiwxffibzetb\n137", "output": "NO" }, { "input": "eytuqriplfczwsqlsnjetfpzehzvzayickkbnfqddaisfpasvigwtnvbybwultsgrtjbaebktvubwofysgidpufzteuhuaaqkhmhguockoczlrmlrrzouvqtwbcchxxiydbohnvrmtqjzhkfmvdulojhdvgwudvidpausvfujkjprxsobliuauxleqvsmz\n253", "output": "NO" }, { "input": "xkaqgwabuilhuqwhnrdtyattmqcjfbiqodjlwzgcyvghqncklbhnlmagvjvwysrfryrlmclninogumjfmyenkmydlmifxpkvlaapgnfarejaowftxxztshsesjtsgommaeslrhronruqdurvjesydrzmxirmxumrcqezznqltngsgdcthivdnjnshjfujtiqsltpttgbljfcbqsfwbzokciqlavrthgaqbzikpwwsebzwddlvdwrmztwmhcxdinwlbklwmteeybbdbzevfbsrtldapulwgusuvnreiflkytonzmervyrlbqhzapgxepwauaiwygpxarfeyqhimzlxntjuaaigeisgrvwgbhqemqetzyallzaoqprhzpjibkutgwrodruqu\n857", "output": "NO" }, { "input": "rbehjxpblnzfgeebpkvzznwtzszghjuuxovreapmwehqyjymrkmksffbdpbdyegulabsmjiykeeqtuvqqyxlitpxjdpwmqtlmudqsksgwqekvwfjdsggzajcpsyserkctpbajgzdbiqaekfaepnecezdzamqszpwfvhlannszgaiewvcdnnvzhblmuzjtqeyjcqjqoxatavavokyxokuxwuqueskktxnxraihnqovrfykpzsyjmrhqsvbobzsnfqwvdwatvjxaubtiwhgvrqwjhgfnauqegqmcwnaruinplmtmxhvohhqgvcatsdqiwkvslhqzqevdgdhpijjevuyuitnixdjhwlmjsstmugownjdhvxueg\n677", "output": "NO" }, { "input": "a\n3", "output": "NO" }, { "input": "aa\n2", "output": "YES" }, { "input": "abcaabca\n2", "output": "NO" }, { "input": "aaaaaaaaab\n5", "output": "NO" }, { "input": "aabbb\n3", "output": "NO" }, { "input": "abcde\n5", "output": "YES" }, { "input": "aabc\n2", "output": "NO" }, { "input": "aabcaa\n3", "output": "NO" } ]
1,432,658,482
382
Python 3
OK
TESTS
56
62
0
def sol(): s = input() k = int(input()) if len(s) % k: return "NO" else: l = len(s) // k for i in range(k): st = s[i*l:(i+1)*l] if st != st[::-1]: break else: return "YES" return "NO" print(sol())
Title: Mike and Fax Time Limit: None seconds Memory Limit: None megabytes Problem Description: While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*. He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length. He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length. Input Specification: The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000). The second line contains integer *k* (1<=≤<=*k*<=≤<=1000). Output Specification: Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise. Demo Input: ['saba\n2\n', 'saddastavvat\n2\n'] Demo Output: ['NO\n', 'YES\n'] Note: Palindrome is a string reading the same forward and backward. In the second sample, the faxes in his back-bag can be "saddas" and "tavvat".
```python def sol(): s = input() k = int(input()) if len(s) % k: return "NO" else: l = len(s) // k for i in range(k): st = s[i*l:(i+1)*l] if st != st[::-1]: break else: return "YES" return "NO" print(sol()) ```
3
711
A
Bus to Udayland
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied. ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit?
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus. Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row. Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details.
If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output). If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line. If there are multiple solutions, you may print any of them.
[ "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n", "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n", "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n" ]
[ "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n", "NO\n", "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n" ]
Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair. O+|+X XO|XX OX|OO XX|OX OO|OO OO|XX
500
[ { "input": "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX", "output": "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX" }, { "input": "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX", "output": "NO" }, { "input": "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO", "output": "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO" }, { "input": "1\nXO|OX", "output": "NO" }, { "input": "1\nOO|OO", "output": "YES\n++|OO" }, { "input": "4\nXO|XX\nXX|XO\nOX|XX\nXO|XO", "output": "NO" }, { "input": "9\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|OO\nOX|OX\nOX|XO\nOX|OX", "output": "YES\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|++\nOX|OX\nOX|XO\nOX|OX" }, { "input": "61\nOX|XX\nOX|XX\nOX|XX\nXO|XO\nXX|XO\nXX|XX\nXX|XX\nOX|XX\nXO|XO\nOX|XO\nXO|OX\nXX|XX\nXX|XX\nOX|OX\nXX|OX\nOX|XO\nOX|XO\nXO|OX\nXO|XX\nOX|XX\nOX|XX\nXO|OX\nXO|XX\nXO|XX\nOX|XX\nXX|XX\nXX|XO\nXO|XX\nXX|XX\nXO|OX\nXX|XO\nXO|XX\nXO|XO\nXO|OX\nXX|OX\nXO|OX\nOX|XX\nXX|OX\nXX|XX\nOX|XO\nOX|XX\nXO|OX\nOX|XX\nOX|XX\nXO|XO\nXO|XX\nOX|XX\nXO|XO\nOX|XX\nXX|XX\nOX|XO\nXO|XO\nXO|XO\nOX|OX\nXX|OX\nXX|OX\nOX|XO\nOX|XX\nOX|OX\nXO|XX\nOX|XX", "output": "NO" }, { "input": "1\nOO|XX", "output": "YES\n++|XX" }, { "input": "10\nOO|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX", "output": "YES\n++|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX" }, { "input": "10\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|OO", "output": "YES\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|++" }, { "input": "5\nXX|XX\nXX|XX\nXO|OX\nOO|OX\nOX|XO", "output": "YES\nXX|XX\nXX|XX\nXO|OX\n++|OX\nOX|XO" }, { "input": "6\nOO|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX", "output": "YES\n++|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX" } ]
1,624,175,334
2,147,483,647
Python 3
OK
TESTS
71
77
0
n=int(input()) M=[input()for _ in range(n)] for i in range(n): if'OO'in M[i]: M[i]=M[i].replace('OO','++',1) print('YES',*M,sep='\n') break else: print('NO')
Title: Bus to Udayland Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied. ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit? Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus. Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row. Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details. Output Specification: If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output). If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line. If there are multiple solutions, you may print any of them. Demo Input: ['6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', '4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n', '5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n'] Demo Output: ['YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', 'NO\n', 'YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n'] Note: Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair. O+|+X XO|XX OX|OO XX|OX OO|OO OO|XX
```python n=int(input()) M=[input()for _ in range(n)] for i in range(n): if'OO'in M[i]: M[i]=M[i].replace('OO','++',1) print('YES',*M,sep='\n') break else: print('NO') ```
3
893
B
Beautiful Divisors
PROGRAMMING
1,000
[ "brute force", "implementation" ]
null
null
Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes. Some examples of beautiful numbers: - 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610). More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1). Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it!
The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got.
Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists.
[ "3\n", "992\n" ]
[ "1\n", "496\n" ]
none
0
[ { "input": "3", "output": "1" }, { "input": "992", "output": "496" }, { "input": "81142", "output": "1" }, { "input": "76920", "output": "120" }, { "input": "2016", "output": "2016" }, { "input": "1", "output": "1" }, { "input": "6", "output": "6" }, { "input": "32640", "output": "32640" }, { "input": "12096", "output": "2016" }, { "input": "55948", "output": "1" }, { "input": "47262", "output": "6" }, { "input": "22876", "output": "28" }, { "input": "96120", "output": "120" }, { "input": "42160", "output": "496" }, { "input": "38304", "output": "2016" }, { "input": "89408", "output": "8128" }, { "input": "97920", "output": "32640" }, { "input": "55493", "output": "1" }, { "input": "38021", "output": "1" }, { "input": "21445", "output": "1" }, { "input": "100000", "output": "1" }, { "input": "497", "output": "1" }, { "input": "240", "output": "120" }, { "input": "21204", "output": "6" }, { "input": "65536", "output": "1" }, { "input": "364", "output": "28" }, { "input": "1024", "output": "1" }, { "input": "36", "output": "6" }, { "input": "28", "output": "28" }, { "input": "14400", "output": "120" }, { "input": "10080", "output": "2016" }, { "input": "9", "output": "1" }, { "input": "2", "output": "1" }, { "input": "42", "output": "6" }, { "input": "83160", "output": "120" }, { "input": "65534", "output": "1" }, { "input": "1026", "output": "6" }, { "input": "1025", "output": "1" }, { "input": "1027", "output": "1" }, { "input": "2018", "output": "1" }, { "input": "2020", "output": "1" }, { "input": "123", "output": "1" }, { "input": "150", "output": "6" }, { "input": "5", "output": "1" }, { "input": "66", "output": "6" }, { "input": "12768", "output": "28" }, { "input": "156", "output": "6" }, { "input": "99990", "output": "6" }, { "input": "248", "output": "1" } ]
1,630,950,109
709
PyPy 3
OK
TESTS
49
124
20,172,800
import sys input = sys.stdin.readline def divisor(i): s = [] for j in range(1, int(i ** (1 / 2)) + 1): if i % j == 0: s.append(i // j) s.append(j) return sorted(set(s)) pow2 = [1] for _ in range(20): pow2.append(2 * pow2[-1]) s = set() for k in range(20): s.add((pow2[k + 1] - 1) * pow2[k]) n = int(input()) d = divisor(n) ans = 1 for i in d: if i in s: ans = max(ans, i) print(ans)
Title: Beautiful Divisors Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes. Some examples of beautiful numbers: - 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610). More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1). Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it! Input Specification: The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got. Output Specification: Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists. Demo Input: ['3\n', '992\n'] Demo Output: ['1\n', '496\n'] Note: none
```python import sys input = sys.stdin.readline def divisor(i): s = [] for j in range(1, int(i ** (1 / 2)) + 1): if i % j == 0: s.append(i // j) s.append(j) return sorted(set(s)) pow2 = [1] for _ in range(20): pow2.append(2 * pow2[-1]) s = set() for k in range(20): s.add((pow2[k + 1] - 1) * pow2[k]) n = int(input()) d = divisor(n) ans = 1 for i in d: if i in s: ans = max(ans, i) print(ans) ```
3
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,689,931,049
2,147,483,647
Python 3
OK
TESTS
26
92
0
""" 165A | Supercentral Point: implementation """ def supercentral_point(): n = int(input()) ss = [] for _ in range(n): s = list(map(int, input().split(' '))) ss.append(s) a = 0 for x, y in ss: l = 0 r = 0 u = 0 d = 0 for xp, yp in ss: if y == yp: if x > xp: l += 1 if x < xp: r += 1 if x == xp: if y < yp: u += 1 if y > yp: d += 1 if l and r and u and d: a += 1 print(a) if __name__ == '__main__': supercentral_point()
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python """ 165A | Supercentral Point: implementation """ def supercentral_point(): n = int(input()) ss = [] for _ in range(n): s = list(map(int, input().split(' '))) ss.append(s) a = 0 for x, y in ss: l = 0 r = 0 u = 0 d = 0 for xp, yp in ss: if y == yp: if x > xp: l += 1 if x < xp: r += 1 if x == xp: if y < yp: u += 1 if y > yp: d += 1 if l and r and u and d: a += 1 print(a) if __name__ == '__main__': supercentral_point() ```
3
667
A
Pouring Rain
PROGRAMMING
1,100
[ "geometry", "math" ]
null
null
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do. Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation. Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom. You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously. Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds. Note one milliliter equals to one cubic centimeter.
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where: - *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
If it is impossible to make the cup empty, print "NO" (without quotes). Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
[ "1 2 3 100\n", "1 1 1 1\n" ]
[ "NO\n", "YES\n3.659792366325\n" ]
In the first example the water fills the cup faster than you can drink from it. In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
500
[ { "input": "1 2 3 100", "output": "NO" }, { "input": "1 1 1 1", "output": "YES\n3.659792366325" }, { "input": "48 7946 7992 72", "output": "NO" }, { "input": "72 6791 8546 46", "output": "NO" }, { "input": "100 5635 9099 23", "output": "NO" }, { "input": "20 287 3845 5", "output": "YES\n39.646277165210" }, { "input": "48 6428 9807 83", "output": "NO" }, { "input": "72 5272 4552 64", "output": "NO" }, { "input": "100 4117 5106 34", "output": "NO" }, { "input": "20 2961 9852 15", "output": "YES\n180.991437129723" }, { "input": "48 1805 3109 93", "output": "NO" }, { "input": "72 8534 7042 65", "output": "NO" }, { "input": "1 47 80 68", "output": "YES\n1.388102806810" }, { "input": "4 495 8813 1", "output": "YES\n0.706823517575" }, { "input": "5 2797 5925 9", "output": "YES\n9.553973511669" }, { "input": "1 8324 4362 23", "output": "YES\n1.505007106354" }, { "input": "6 1976 8455 3", "output": "YES\n6.674898722265" }, { "input": "7 2644 8080 5", "output": "YES\n12.900417790197" }, { "input": "3 4183 5491 98", "output": "YES\n6.162185601824" }, { "input": "2 8591 320 101", "output": "YES\n9999.259991757254" }, { "input": "10000 10000 10000 10000", "output": "NO" }, { "input": "2 5000 12 3", "output": "YES\n6099.653943875812" }, { "input": "10 1000 100 1", "output": "YES\n3659.792366325487" } ]
1,653,865,904
2,147,483,647
PyPy 3-64
OK
TESTS
23
62
0
from math import pi d,h,v,e = map(float, input().split()) flux_in = d * d * pi / 4 * e if (flux_in > v): print("NO") else: print("YES") print(h * d * d * pi / (4 * (v - flux_in)))
Title: Pouring Rain Time Limit: None seconds Memory Limit: None megabytes Problem Description: A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do. Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation. Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom. You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously. Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds. Note one milliliter equals to one cubic centimeter. Input Specification: The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where: - *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup. Output Specification: If it is impossible to make the cup empty, print "NO" (without quotes). Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104. Demo Input: ['1 2 3 100\n', '1 1 1 1\n'] Demo Output: ['NO\n', 'YES\n3.659792366325\n'] Note: In the first example the water fills the cup faster than you can drink from it. In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
```python from math import pi d,h,v,e = map(float, input().split()) flux_in = d * d * pi / 4 * e if (flux_in > v): print("NO") else: print("YES") print(h * d * d * pi / (4 * (v - flux_in))) ```
3
478
B
Random Teams
PROGRAMMING
1,300
[ "combinatorics", "constructive algorithms", "greedy", "math" ]
null
null
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
[ "5 1\n", "3 2\n", "6 3\n" ]
[ "10 10\n", "1 1\n", "3 6\n" ]
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
1,000
[ { "input": "5 1", "output": "10 10" }, { "input": "3 2", "output": "1 1" }, { "input": "6 3", "output": "3 6" }, { "input": "5 3", "output": "2 3" }, { "input": "10 2", "output": "20 36" }, { "input": "10 6", "output": "4 10" }, { "input": "1000000000 1", "output": "499999999500000000 499999999500000000" }, { "input": "5000000 12", "output": "1041664166668 12499942500066" }, { "input": "1833 195", "output": "7722 1342341" }, { "input": "1000000000 1000000000", "output": "0 0" }, { "input": "1000000000 1000000", "output": "499500000000 499000500499500000" }, { "input": "1000000000 32170", "output": "15541930838100 499967831017438365" }, { "input": "1000000 1000", "output": "499500000 499000999500" }, { "input": "1234 1123", "output": "111 6216" }, { "input": "599222887 298488", "output": "601178656545 179355218158217800" }, { "input": "999999999 500000000", "output": "499999999 124999999750000000" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 2", "output": "249999999500000000 499999998500000001" }, { "input": "1000000000 999999999", "output": "1 1" }, { "input": "38447 383", "output": "1910550 724453080" }, { "input": "100000000 99999799", "output": "201 20301" }, { "input": "1 1", "output": "0 0" }, { "input": "2 1", "output": "1 1" }, { "input": "2 2", "output": "0 0" }, { "input": "10 10", "output": "0 0" } ]
1,645,490,676
2,147,483,647
Python 3
OK
TESTS
26
31
0
n, m = map(int, input().split()) a = n // m b = n % m print((m * a * (a - 1) // 2) + b * a, (n - m + 1) * (n - m) // 2)
Title: Random Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition. Input Specification: The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively. Output Specification: The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively. Demo Input: ['5 1\n', '3 2\n', '6 3\n'] Demo Output: ['10 10\n', '1 1\n', '3 6\n'] Note: In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
```python n, m = map(int, input().split()) a = n // m b = n % m print((m * a * (a - 1) // 2) + b * a, (n - m + 1) * (n - m) // 2) ```
3
489
B
BerSU Ball
PROGRAMMING
1,200
[ "dfs and similar", "dp", "graph matchings", "greedy", "sortings", "two pointers" ]
null
null
The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves. We know that several boy&amp;girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one. For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill. Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill.
Print a single number — the required maximum possible number of pairs.
[ "4\n1 4 6 2\n5\n5 1 5 7 9\n", "4\n1 2 3 4\n4\n10 11 12 13\n", "5\n1 1 1 1 1\n3\n1 2 3\n" ]
[ "3\n", "0\n", "2\n" ]
none
1,000
[ { "input": "4\n1 4 6 2\n5\n5 1 5 7 9", "output": "3" }, { "input": "4\n1 2 3 4\n4\n10 11 12 13", "output": "0" }, { "input": "5\n1 1 1 1 1\n3\n1 2 3", "output": "2" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "2\n1 10\n1\n9", "output": "1" }, { "input": "4\n4 5 4 4\n5\n5 3 4 2 4", "output": "4" }, { "input": "1\n2\n1\n1", "output": "1" }, { "input": "1\n3\n2\n3 2", "output": "1" }, { "input": "1\n4\n3\n4 4 4", "output": "1" }, { "input": "1\n2\n4\n3 1 4 2", "output": "1" }, { "input": "1\n4\n5\n2 5 5 3 1", "output": "1" }, { "input": "2\n2 2\n1\n2", "output": "1" }, { "input": "2\n4 2\n2\n4 4", "output": "1" }, { "input": "2\n4 1\n3\n2 3 2", "output": "2" }, { "input": "2\n4 3\n4\n5 5 5 6", "output": "1" }, { "input": "2\n5 7\n5\n4 6 7 2 5", "output": "2" }, { "input": "3\n1 2 3\n1\n1", "output": "1" }, { "input": "3\n5 4 5\n2\n2 1", "output": "0" }, { "input": "3\n6 3 4\n3\n4 5 2", "output": "3" }, { "input": "3\n7 7 7\n4\n2 7 2 4", "output": "1" }, { "input": "3\n1 3 3\n5\n1 3 4 1 2", "output": "3" }, { "input": "4\n1 2 1 3\n1\n4", "output": "1" }, { "input": "4\n4 4 6 6\n2\n2 1", "output": "0" }, { "input": "4\n3 1 1 1\n3\n1 6 7", "output": "1" }, { "input": "4\n2 5 1 2\n4\n2 3 3 1", "output": "3" }, { "input": "4\n9 1 7 1\n5\n9 9 9 8 4", "output": "2" }, { "input": "5\n1 6 5 5 6\n1\n2", "output": "1" }, { "input": "5\n5 2 4 5 6\n2\n7 4", "output": "2" }, { "input": "5\n4 1 3 1 4\n3\n6 3 6", "output": "1" }, { "input": "5\n5 2 3 1 4\n4\n1 3 1 7", "output": "3" }, { "input": "5\n9 8 10 9 10\n5\n2 1 5 4 6", "output": "0" }, { "input": "1\n48\n100\n76 90 78 44 29 30 35 85 98 38 27 71 51 100 15 98 78 45 85 26 48 66 98 71 45 85 83 77 92 17 23 95 98 43 11 15 39 53 71 25 74 53 77 41 39 35 66 4 92 44 44 55 35 87 91 6 44 46 57 24 46 82 15 44 81 40 65 17 64 24 42 52 13 12 64 82 26 7 66 85 93 89 58 92 92 77 37 91 47 73 35 69 31 22 60 60 97 21 52 6", "output": "1" }, { "input": "100\n9 90 66 62 60 9 10 97 47 73 26 81 97 60 80 84 19 4 25 77 19 17 91 12 1 27 15 54 18 45 71 79 96 90 51 62 9 13 92 34 7 52 55 8 16 61 96 12 52 38 50 9 60 3 30 3 48 46 77 64 90 35 16 16 21 42 67 70 23 19 90 14 50 96 98 92 82 62 7 51 93 38 84 82 37 78 99 3 20 69 44 96 94 71 3 55 27 86 92 82\n1\n58", "output": "0" }, { "input": "10\n20 87 3 39 20 20 8 40 70 51\n100\n69 84 81 84 35 97 69 68 63 97 85 80 95 58 70 91 100 65 72 80 41 87 87 87 22 49 96 96 78 96 97 56 90 31 62 98 89 74 100 86 95 88 66 54 93 62 41 60 95 79 29 69 63 70 52 63 87 58 54 52 48 57 26 75 39 61 98 78 52 73 99 49 74 50 59 90 31 97 16 85 63 72 81 68 75 59 70 67 73 92 10 88 57 95 3 71 80 95 84 96", "output": "6" }, { "input": "100\n10 10 9 18 56 64 92 66 54 42 66 65 58 5 74 68 80 57 58 30 58 69 70 13 38 19 34 63 38 17 26 24 66 83 48 77 44 37 78 97 13 90 51 56 60 23 49 32 14 86 90 100 13 14 52 69 85 95 81 53 5 3 91 66 2 64 45 59 7 30 80 42 61 82 70 10 62 82 5 34 50 28 24 47 85 68 27 50 24 61 76 17 63 24 3 67 83 76 42 60\n10\n66 74 40 67 28 82 99 57 93 64", "output": "9" }, { "input": "100\n4 1 1 1 3 3 2 5 1 2 1 2 1 1 1 6 1 3 1 1 1 1 2 4 1 1 4 2 2 8 2 2 1 8 2 4 3 3 8 1 3 2 3 2 1 3 8 2 2 3 1 1 2 2 5 1 4 3 1 1 3 1 3 1 7 1 1 1 3 2 1 2 2 3 7 2 1 4 3 2 1 1 3 4 1 1 3 5 1 8 4 1 1 1 3 10 2 2 1 2\n100\n1 1 5 2 13 2 2 3 6 12 1 13 8 1 1 16 1 1 5 6 2 4 6 4 2 7 4 1 7 3 3 9 5 3 1 7 4 1 6 6 8 2 2 5 2 3 16 3 6 3 8 6 1 8 1 2 6 5 3 4 11 3 4 8 2 13 2 5 2 7 3 3 1 8 1 4 4 2 4 7 7 1 5 7 6 3 6 9 1 1 1 3 1 11 5 2 5 11 13 1", "output": "76" }, { "input": "4\n1 6 9 15\n2\n5 8", "output": "2" }, { "input": "2\n2 4\n2\n3 1", "output": "2" }, { "input": "3\n2 3 5\n3\n3 4 6", "output": "3" }, { "input": "3\n1 3 4\n3\n2 1 5", "output": "3" }, { "input": "2\n5 5\n4\n1 1 1 5", "output": "1" }, { "input": "2\n3 2\n2\n3 4", "output": "2" }, { "input": "2\n3 1\n2\n2 4", "output": "2" }, { "input": "2\n2 3\n2\n2 1", "output": "2" }, { "input": "2\n10 12\n2\n11 9", "output": "2" }, { "input": "3\n1 2 3\n3\n3 2 1", "output": "3" }, { "input": "2\n1 3\n2\n2 1", "output": "2" }, { "input": "2\n4 5\n2\n5 3", "output": "2" }, { "input": "2\n7 5\n2\n6 8", "output": "2" }, { "input": "4\n4 3 2 1\n4\n1 2 3 4", "output": "4" }, { "input": "2\n2 3\n2\n3 1", "output": "2" }, { "input": "2\n2 4\n3\n3 1 8", "output": "2" }, { "input": "3\n3 1 1\n3\n2 4 4", "output": "2" }, { "input": "2\n5 3\n2\n4 6", "output": "2" }, { "input": "4\n1 1 3 3\n4\n2 2 1 1", "output": "4" }, { "input": "3\n3 2 1\n3\n2 4 3", "output": "3" }, { "input": "5\n1 2 3 4 5\n5\n2 3 4 5 1", "output": "5" }, { "input": "3\n3 2 1\n3\n1 2 3", "output": "3" }, { "input": "2\n5 4\n2\n4 6", "output": "2" }, { "input": "4\n3 3 5 5\n4\n4 4 2 2", "output": "4" }, { "input": "3\n2 7 5\n3\n2 4 8", "output": "3" }, { "input": "100\n2 3 3 4 2 1 4 4 5 5 2 1 5 2 3 3 5 4 3 2 4 2 3 3 2 2 3 4 2 2 2 3 1 2 3 2 2 3 5 3 3 3 3 4 5 2 2 1 1 1 3 1 2 2 3 5 5 2 5 1 3 4 5 3 5 4 1 1 2 3 4 4 5 3 2 4 5 5 5 2 1 4 2 4 5 4 4 5 5 3 2 5 1 4 4 2 2 2 5 3\n100\n4 5 3 3 2 2 4 3 1 5 4 3 3 2 2 4 5 2 5 2 1 4 3 4 2 3 5 3 4 4 1 2 3 5 2 2 1 5 4 2 4 3 4 3 4 2 3 1 3 3 4 1 1 1 4 4 5 3 1 4 2 3 2 1 3 3 2 3 2 1 1 2 3 2 1 3 3 4 3 3 1 1 3 3 3 1 1 3 5 3 3 3 3 4 4 5 2 5 4 5", "output": "100" }, { "input": "1\n3\n2\n2 3", "output": "1" }, { "input": "2\n5 6\n3\n1 5 100", "output": "1" }, { "input": "2\n2 7\n2\n6 8", "output": "1" }, { "input": "4\n4 10 15 17\n4\n3 12 16 16", "output": "3" }, { "input": "2\n2 3\n2\n1 2", "output": "2" } ]
1,680,144,026
2,147,483,647
PyPy 3-64
OK
TESTS
81
62
0
n = int(input()) b = list(map(int, input().split())) m = int(input()) g = list(map(int, input().split())) b.sort() g.sort() i = 0 j = 0 cnt = 0 while i < n and j < m: if abs(b[i] - g[j]) <= 1: cnt+=1 i += 1 j += 1 elif b[i] > g[j]: j += 1 else: # b[i] < g[j] : i += 1 print(cnt)
Title: BerSU Ball Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves. We know that several boy&amp;girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one. For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill. Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill. Output Specification: Print a single number — the required maximum possible number of pairs. Demo Input: ['4\n1 4 6 2\n5\n5 1 5 7 9\n', '4\n1 2 3 4\n4\n10 11 12 13\n', '5\n1 1 1 1 1\n3\n1 2 3\n'] Demo Output: ['3\n', '0\n', '2\n'] Note: none
```python n = int(input()) b = list(map(int, input().split())) m = int(input()) g = list(map(int, input().split())) b.sort() g.sort() i = 0 j = 0 cnt = 0 while i < n and j < m: if abs(b[i] - g[j]) <= 1: cnt+=1 i += 1 j += 1 elif b[i] > g[j]: j += 1 else: # b[i] < g[j] : i += 1 print(cnt) ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,695,171,907
2,147,483,647
Python 3
OK
TESTS
30
92
0
enter=input() upper=0 for x in enter: if x==x.upper(): upper=upper+1 two=len(enter)/2 if upper>two: enter=enter.upper() print(enter) else: enter=enter.lower() print(enter)
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python enter=input() upper=0 for x in enter: if x==x.upper(): upper=upper+1 two=len(enter)/2 if upper>two: enter=enter.upper() print(enter) else: enter=enter.lower() print(enter) ```
3.977
43
A
Football
PROGRAMMING
1,000
[ "strings" ]
A. Football
2
256
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]
[ "ABC\n", "A\n" ]
none
500
[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]
1,665,232,633
2,147,483,647
Python 3
OK
TESTS
34
92
0
n=int(input()) a=[] for i in range(n): a.append(input()) count=0 for s in range(n): if a[s]==a[0]: count+=1 else: b=a[s] if count>len(a)/2: print(a[0]) else: print(b)
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none
```python n=int(input()) a=[] for i in range(n): a.append(input()) count=0 for s in range(n): if a[s]==a[0]: count+=1 else: b=a[s] if count>len(a)/2: print(a[0]) else: print(b) ```
3.977
753
A
Santa Claus and Candies
PROGRAMMING
1,000
[ "dp", "greedy", "math" ]
null
null
Santa Claus has *n* candies, he dreams to give them as gifts to children. What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has.
The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has.
Print to the first line integer number *k* — maximal number of kids which can get candies. Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*. If there are many solutions, print any of them.
[ "5\n", "9\n", "2\n" ]
[ "2\n2 3\n", "3\n3 5 1\n", "1\n2 \n" ]
none
500
[ { "input": "5", "output": "2\n1 4 " }, { "input": "9", "output": "3\n1 2 6 " }, { "input": "2", "output": "1\n2 " }, { "input": "1", "output": "1\n1 " }, { "input": "3", "output": "2\n1 2 " }, { "input": "1000", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 54 " }, { "input": "4", "output": "2\n1 3 " }, { "input": "6", "output": "3\n1 2 3 " }, { "input": "7", "output": "3\n1 2 4 " }, { "input": "8", "output": "3\n1 2 5 " }, { "input": "10", "output": "4\n1 2 3 4 " }, { "input": "11", "output": "4\n1 2 3 5 " }, { "input": "12", "output": "4\n1 2 3 6 " }, { "input": "13", "output": "4\n1 2 3 7 " }, { "input": "14", "output": "4\n1 2 3 8 " }, { "input": "15", "output": "5\n1 2 3 4 5 " }, { "input": "16", "output": "5\n1 2 3 4 6 " }, { "input": "20", "output": "5\n1 2 3 4 10 " }, { "input": "21", "output": "6\n1 2 3 4 5 6 " }, { "input": "22", "output": "6\n1 2 3 4 5 7 " }, { "input": "27", "output": "6\n1 2 3 4 5 12 " }, { "input": "28", "output": "7\n1 2 3 4 5 6 7 " }, { "input": "29", "output": "7\n1 2 3 4 5 6 8 " }, { "input": "35", "output": "7\n1 2 3 4 5 6 14 " }, { "input": "36", "output": "8\n1 2 3 4 5 6 7 8 " }, { "input": "37", "output": "8\n1 2 3 4 5 6 7 9 " }, { "input": "44", "output": "8\n1 2 3 4 5 6 7 16 " }, { "input": "45", "output": "9\n1 2 3 4 5 6 7 8 9 " }, { "input": "46", "output": "9\n1 2 3 4 5 6 7 8 10 " }, { "input": "230", "output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 40 " }, { "input": "231", "output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 " }, { "input": "232", "output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 22 " }, { "input": "239", "output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 29 " }, { "input": "629", "output": "34\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 68 " }, { "input": "630", "output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 " }, { "input": "631", "output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 36 " }, { "input": "945", "output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 84 " }, { "input": "946", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 " }, { "input": "947", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 44 " }, { "input": "989", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 86 " }, { "input": "990", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 " }, { "input": "991", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 " }, { "input": "956", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 53 " }, { "input": "981", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 78 " }, { "input": "867", "output": "41\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 47 " }, { "input": "906", "output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 45 " }, { "input": "999", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 53 " }, { "input": "100", "output": "13\n1 2 3 4 5 6 7 8 9 10 11 12 22 " }, { "input": "126", "output": "15\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 21 " } ]
1,579,030,535
2,147,483,647
PyPy 3
OK
TESTS
49
155
0
a=int(input()) c=[] d=0 for i in range(1,a+1): c.append(i) sum=0 for j in range(a): if sum+c[j]>a: sum+=c[j] d+=1 break else: sum+=c[j] d+=1 sum=0 e=[] for i in range(d-2): e.append(c[i]) sum+=c[i] e.append(a-sum) print(len(e)) print(*e)
Title: Santa Claus and Candies Time Limit: None seconds Memory Limit: None megabytes Problem Description: Santa Claus has *n* candies, he dreams to give them as gifts to children. What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has. Input Specification: The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has. Output Specification: Print to the first line integer number *k* — maximal number of kids which can get candies. Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*. If there are many solutions, print any of them. Demo Input: ['5\n', '9\n', '2\n'] Demo Output: ['2\n2 3\n', '3\n3 5 1\n', '1\n2 \n'] Note: none
```python a=int(input()) c=[] d=0 for i in range(1,a+1): c.append(i) sum=0 for j in range(a): if sum+c[j]>a: sum+=c[j] d+=1 break else: sum+=c[j] d+=1 sum=0 e=[] for i in range(d-2): e.append(c[i]) sum+=c[i] e.append(a-sum) print(len(e)) print(*e) ```
3
337
A
Puzzles
PROGRAMMING
900
[ "greedy" ]
null
null
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Print a single integer — the least possible difference the teacher can obtain.
[ "4 6\n10 12 10 7 5 22\n" ]
[ "5\n" ]
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
500
[ { "input": "4 6\n10 12 10 7 5 22", "output": "5" }, { "input": "2 2\n4 4", "output": "0" }, { "input": "2 10\n4 5 6 7 8 9 10 11 12 12", "output": "0" }, { "input": "4 5\n818 136 713 59 946", "output": "759" }, { "input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903", "output": "13" }, { "input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94", "output": "3" }, { "input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190", "output": "31" }, { "input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997", "output": "0" }, { "input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176", "output": "412" }, { "input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886", "output": "938" }, { "input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993", "output": "937" }, { "input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7", "output": "0" }, { "input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19", "output": "12" }, { "input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "0" }, { "input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17", "output": "31" }, { "input": "2 2\n1000 4", "output": "996" }, { "input": "2 3\n4 502 1000", "output": "498" }, { "input": "3 3\n4 1000 4", "output": "996" } ]
1,685,960,402
2,147,483,647
Python 3
OK
TESTS
18
62
0
n,m = map(int,input().split()) f = list(map(int,input().split())) f.sort() best = 1000 for i in range(m-n+1): best = min(best , f[n+i-1] - f[i]) print(best)
Title: Puzzles Time Limit: None seconds Memory Limit: None megabytes Problem Description: The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. Input Specification: The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop. Output Specification: Print a single integer — the least possible difference the teacher can obtain. Demo Input: ['4 6\n10 12 10 7 5 22\n'] Demo Output: ['5\n'] Note: Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
```python n,m = map(int,input().split()) f = list(map(int,input().split())) f.sort() best = 1000 for i in range(m-n+1): best = min(best , f[n+i-1] - f[i]) print(best) ```
3
894
A
QAQ
PROGRAMMING
800
[ "brute force", "dp" ]
null
null
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Print a single integer — the number of subsequences "QAQ" in the string.
[ "QAQAQYSYIOIWIN\n", "QAQQQZZYNOIWIN\n" ]
[ "4\n", "3\n" ]
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
500
[ { "input": "QAQAQYSYIOIWIN", "output": "4" }, { "input": "QAQQQZZYNOIWIN", "output": "3" }, { "input": "QA", "output": "0" }, { "input": "IAQVAQZLQBQVQFTQQQADAQJA", "output": "24" }, { "input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ", "output": "378" }, { "input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ", "output": "1077" }, { "input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA", "output": "568" }, { "input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA", "output": "70" }, { "input": "W", "output": "0" }, { "input": "DBA", "output": "0" }, { "input": "RQAWNACASAAKAGAAAAQ", "output": "10" }, { "input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA", "output": "111" }, { "input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA", "output": "411" }, { "input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ", "output": "625" }, { "input": "QORZOYAQ", "output": "1" }, { "input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA", "output": "13174" }, { "input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT", "output": "10420" }, { "input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ", "output": "12488" }, { "input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA", "output": "9114" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "35937" }, { "input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE", "output": "254" }, { "input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE", "output": "2174" }, { "input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ", "output": "2962" }, { "input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA", "output": "2482" }, { "input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ", "output": "7768" }, { "input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA", "output": "5422" }, { "input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ", "output": "3024" }, { "input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ", "output": "4527" }, { "input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH", "output": "6416" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ", "output": "13136" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA", "output": "14231" }, { "input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "15296" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA", "output": "20825" }, { "input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ", "output": "20825" }, { "input": "Q", "output": "0" }, { "input": "A", "output": "0" }, { "input": "FFF", "output": "0" }, { "input": "AAAAAA", "output": "0" } ]
1,668,839,139
2,147,483,647
Python 3
OK
TESTS
43
46
0
k=input() s=0 for i in range(len(k)): if k[i]=='A': s=s+k[:i].count("Q")*k[i:].count("Q") print(s)
Title: QAQ Time Limit: None seconds Memory Limit: None megabytes Problem Description: "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. Input Specification: The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. Output Specification: Print a single integer — the number of subsequences "QAQ" in the string. Demo Input: ['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n'] Demo Output: ['4\n', '3\n'] Note: In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
```python k=input() s=0 for i in range(len(k)): if k[i]=='A': s=s+k[:i].count("Q")*k[i:].count("Q") print(s) ```
3
330
A
Cakeminator
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows: The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times. Please output the maximum number of cake cells that the cakeminator can eat.
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these: - '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output the maximum number of cake cells that the cakeminator can eat.
[ "3 4\nS...\n....\n..S.\n" ]
[ "8\n" ]
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
500
[ { "input": "3 4\nS...\n....\n..S.", "output": "8" }, { "input": "2 2\n..\n..", "output": "4" }, { "input": "2 2\nSS\nSS", "output": "0" }, { "input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..", "output": "14" }, { "input": "3 5\n..S..\nSSSSS\n..S..", "output": "0" }, { "input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS", "output": "0" }, { "input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS", "output": "30" }, { "input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..", "output": "80" }, { "input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS", "output": "0" }, { "input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..", "output": "17" }, { "input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS", "output": "0" }, { "input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S", "output": "64" }, { "input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S", "output": "28" }, { "input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S", "output": "10" }, { "input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.", "output": "0" }, { "input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS", "output": "0" }, { "input": "2 2\n..\n..", "output": "4" }, { "input": "3 2\nS.\n.S\nS.", "output": "0" }, { "input": "3 2\nS.\n.S\nS.", "output": "0" }, { "input": "4 3\n.S.\nS.S\n.S.\nS.S", "output": "0" }, { "input": "2 3\n...\nSSS", "output": "3" }, { "input": "2 4\nS.SS\nS.SS", "output": "2" }, { "input": "2 2\n..\n.S", "output": "3" }, { "input": "3 2\n.S\n.S\nSS", "output": "0" }, { "input": "2 4\nSS.S\n..S.", "output": "0" }, { "input": "2 3\n...\nS..", "output": "5" } ]
1,623,176,882
2,147,483,647
Python 3
OK
TESTS
42
218
0
rows,columns = map(int,input().split()) grid = [list(input()) for i in range(rows)] count = 0 ## column slicing for i in range(columns): for j in range(rows): if grid[j][i] == ".": continue else:break else: count += rows for j in range(rows): grid[j][i] =0 ## row slicing for i in grid: if "S" not in i: for j in i: if j==".":count += 1 print(count)
Title: Cakeminator Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows: The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times. Please output the maximum number of cake cells that the cakeminator can eat. Input Specification: The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these: - '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. Output Specification: Output the maximum number of cake cells that the cakeminator can eat. Demo Input: ['3 4\nS...\n....\n..S.\n'] Demo Output: ['8\n'] Note: For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
```python rows,columns = map(int,input().split()) grid = [list(input()) for i in range(rows)] count = 0 ## column slicing for i in range(columns): for j in range(rows): if grid[j][i] == ".": continue else:break else: count += rows for j in range(rows): grid[j][i] =0 ## row slicing for i in grid: if "S" not in i: for j in i: if j==".":count += 1 print(count) ```
3
47
B
Coins
PROGRAMMING
1,200
[ "implementation" ]
B. Coins
2
256
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B.
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
[ "A&gt;B\nC&lt;B\nA&gt;C\n", "A&lt;B\nB&gt;C\nC&gt;A\n" ]
[ "CBA", "ACB" ]
none
1,000
[ { "input": "A>B\nC<B\nA>C", "output": "CBA" }, { "input": "A<B\nB>C\nC>A", "output": "ACB" }, { "input": "A<C\nB<A\nB>C", "output": "Impossible" }, { "input": "A<B\nA<C\nB>C", "output": "ACB" }, { "input": "B>A\nC<B\nC>A", "output": "ACB" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "A>C\nA>B\nB<C", "output": "BCA" }, { "input": "C<B\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nA>B\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nA<C", "output": "ABC" }, { "input": "C<B\nB<A\nC>A", "output": "Impossible" }, { "input": "B<C\nC<A\nA>B", "output": "BCA" }, { "input": "A>B\nC<B\nC<A", "output": "CBA" }, { "input": "B>A\nC>B\nA>C", "output": "Impossible" }, { "input": "B<A\nC>B\nC>A", "output": "BAC" }, { "input": "A<B\nC>B\nA<C", "output": "ABC" }, { "input": "A<B\nC<A\nB<C", "output": "Impossible" }, { "input": "A>C\nC<B\nB>A", "output": "CAB" }, { "input": "C>A\nA<B\nB>C", "output": "ACB" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "B>C\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA<B\nB>C", "output": "ACB" }, { "input": "B>A\nA>C\nB>C", "output": "CAB" }, { "input": "B<A\nA<C\nC<B", "output": "Impossible" }, { "input": "A<C\nB>C\nA>B", "output": "Impossible" }, { "input": "B>A\nC<A\nC>B", "output": "Impossible" }, { "input": "A>C\nC>B\nB<A", "output": "BCA" }, { "input": "B<C\nB<A\nA>C", "output": "BCA" }, { "input": "A>B\nC>B\nA<C", "output": "BAC" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA>B\nB>C", "output": "Impossible" }, { "input": "B>A\nB>C\nA<C", "output": "ACB" }, { "input": "B>C\nC<A\nB<A", "output": "CBA" }, { "input": "C>A\nB>A\nB>C", "output": "ACB" }, { "input": "B<A\nB>C\nA<C", "output": "Impossible" }, { "input": "B<C\nA<B\nC>A", "output": "ABC" }, { "input": "C<B\nB>A\nA>C", "output": "CAB" }, { "input": "A>B\nC>A\nB<C", "output": "BAC" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "B>C\nC>A\nA>B", "output": "Impossible" }, { "input": "B<A\nB>C\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nC>A", "output": "ABC" }, { "input": "A>C\nA>B\nB>C", "output": "CBA" }, { "input": "B<C\nA>B\nA<C", "output": "BAC" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "C>B\nA<B\nC<A", "output": "Impossible" }, { "input": "A<C\nC<B\nA>B", "output": "Impossible" }, { "input": "B>C\nA<B\nA<C", "output": "ACB" }, { "input": "C>A\nA<B\nC>B", "output": "ABC" } ]
1,658,442,770
2,147,483,647
Python 3
OK
TESTS
50
92
0
s=[] arr=[] let=["A",'B','C'] for i in range(3): arr.append(input()) if "<" in arr[0]: s+=[arr[0][0]]+[arr[0][2]] let.remove(arr[0][2]) let.remove(arr[0][0]) else: s+=[arr[0][2]]+[arr[0][0]] let.remove(arr[0][2]) let.remove(arr[0][0]) x="".join(let) if (x+">"+s[1] in arr or s[1]+"<"+x in arr) and (x+"<"+s[0] in arr or s[0]+">"+x in arr): print("Impossible") elif x+">"+s[1] in arr or s[1]+"<"+x in arr: z="".join(s) print(z+x) elif x+"<"+s[0] in arr or s[0]+">"+x in arr: z="".join(s) print(x+z) else: s.insert(1,x) print("".join(s))
Title: Coins Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal. Input Specification: The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B. Output Specification: It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights. Demo Input: ['A&gt;B\nC&lt;B\nA&gt;C\n', 'A&lt;B\nB&gt;C\nC&gt;A\n'] Demo Output: ['CBA', 'ACB'] Note: none
```python s=[] arr=[] let=["A",'B','C'] for i in range(3): arr.append(input()) if "<" in arr[0]: s+=[arr[0][0]]+[arr[0][2]] let.remove(arr[0][2]) let.remove(arr[0][0]) else: s+=[arr[0][2]]+[arr[0][0]] let.remove(arr[0][2]) let.remove(arr[0][0]) x="".join(let) if (x+">"+s[1] in arr or s[1]+"<"+x in arr) and (x+"<"+s[0] in arr or s[0]+">"+x in arr): print("Impossible") elif x+">"+s[1] in arr or s[1]+"<"+x in arr: z="".join(s) print(z+x) elif x+"<"+s[0] in arr or s[0]+">"+x in arr: z="".join(s) print(x+z) else: s.insert(1,x) print("".join(s)) ```
3.977
214
A
System of Equations
PROGRAMMING
800
[ "brute force" ]
null
null
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you? You are given a system of equations: You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
On a single line print the answer to the problem.
[ "9 3\n", "14 28\n", "4 20\n" ]
[ "1\n", "1\n", "0\n" ]
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
500
[ { "input": "9 3", "output": "1" }, { "input": "14 28", "output": "1" }, { "input": "4 20", "output": "0" }, { "input": "18 198", "output": "1" }, { "input": "22 326", "output": "1" }, { "input": "26 104", "output": "1" }, { "input": "14 10", "output": "0" }, { "input": "8 20", "output": "0" }, { "input": "2 8", "output": "0" }, { "input": "20 11", "output": "0" }, { "input": "57 447", "output": "1" }, { "input": "1 1", "output": "2" }, { "input": "66 296", "output": "1" }, { "input": "75 683", "output": "1" }, { "input": "227 975", "output": "1" }, { "input": "247 499", "output": "1" }, { "input": "266 116", "output": "1" }, { "input": "286 916", "output": "1" }, { "input": "307 341", "output": "1" }, { "input": "451 121", "output": "1" }, { "input": "471 921", "output": "1" }, { "input": "502 346", "output": "1" }, { "input": "535 59", "output": "1" }, { "input": "555 699", "output": "1" }, { "input": "747 351", "output": "1" }, { "input": "790 64", "output": "1" }, { "input": "810 704", "output": "1" }, { "input": "855 225", "output": "1" }, { "input": "902 34", "output": "1" }, { "input": "922 514", "output": "1" }, { "input": "971 131", "output": "1" }, { "input": "991 931", "output": "1" }, { "input": "840 780", "output": "0" }, { "input": "102 595", "output": "0" }, { "input": "139 433", "output": "0" }, { "input": "968 288", "output": "0" }, { "input": "563 354", "output": "0" }, { "input": "994 975", "output": "0" }, { "input": "456 221", "output": "0" }, { "input": "205 210", "output": "0" }, { "input": "1 11", "output": "0" }, { "input": "1000 1000", "output": "0" }, { "input": "3 3", "output": "0" }, { "input": "11 99", "output": "0" }, { "input": "2 2", "output": "1" }, { "input": "11 1", "output": "0" }, { "input": "6 6", "output": "1" }, { "input": "100 452", "output": "0" }, { "input": "420 380", "output": "0" }, { "input": "31 31", "output": "0" }, { "input": "2 6", "output": "0" }, { "input": "112 134", "output": "0" }, { "input": "13 13", "output": "0" }, { "input": "1 571", "output": "0" } ]
1,689,741,364
2,147,483,647
Python 3
OK
TESTS
54
92
0
m= input() n= m.split(" ") k = list(map(int,n)) dem=0 for a in range(100): for b in range(100): if a**2 + b == k[0] and b**2 + a ==k[1]: dem+=1 print(dem)
Title: System of Equations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you? You are given a system of equations: You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system. Input Specification: A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space. Output Specification: On a single line print the answer to the problem. Demo Input: ['9 3\n', '14 28\n', '4 20\n'] Demo Output: ['1\n', '1\n', '0\n'] Note: In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
```python m= input() n= m.split(" ") k = list(map(int,n)) dem=0 for a in range(100): for b in range(100): if a**2 + b == k[0] and b**2 + a ==k[1]: dem+=1 print(dem) ```
3
488
A
Giga Tower
PROGRAMMING
1,100
[ "brute force" ]
null
null
Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view. In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?). Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number.
The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109).
Print the minimum *b* in a line.
[ "179\n", "-1\n", "18\n" ]
[ "1\n", "9\n", "10\n" ]
For the first sample, he has to arrive at the floor numbered 180. For the second sample, he will arrive at 8. Note that *b* should be positive, so the answer for the third sample is 10, not 0.
500
[ { "input": "179", "output": "1" }, { "input": "-1", "output": "9" }, { "input": "18", "output": "10" }, { "input": "-410058385", "output": "1" }, { "input": "-586825624", "output": "1" }, { "input": "852318890", "output": "1" }, { "input": "919067153", "output": "5" }, { "input": "690422411", "output": "7" }, { "input": "-408490162", "output": "1" }, { "input": "-8", "output": "16" }, { "input": "-6", "output": "14" }, { "input": "-4", "output": "12" }, { "input": "-2", "output": "10" }, { "input": "0", "output": "8" }, { "input": "2", "output": "6" }, { "input": "4", "output": "4" }, { "input": "6", "output": "2" }, { "input": "8", "output": "10" }, { "input": "1000000000", "output": "8" }, { "input": "-1000000000", "output": "2" }, { "input": "88888", "output": "1" }, { "input": "89", "output": "9" }, { "input": "-80000000", "output": "2" }, { "input": "-8888", "output": "1" }, { "input": "-17", "output": "9" }, { "input": "78", "output": "2" }, { "input": "-19", "output": "1" }, { "input": "-999999998", "output": "9" }, { "input": "-999999997", "output": "8" }, { "input": "999999997", "output": "1" }, { "input": "811111111", "output": "1" }, { "input": "-8", "output": "16" }, { "input": "-5", "output": "13" }, { "input": "-7", "output": "15" }, { "input": "1000000000", "output": "8" } ]
1,697,036,771
2,147,483,647
PyPy 3-64
OK
TESTS
35
62
0
n=int(input())+1 s=1 while '8' not in str(n): n+=1 s+=1 print(s)
Title: Giga Tower Time Limit: None seconds Memory Limit: None megabytes Problem Description: Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view. In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?). Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number. Input Specification: The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109). Output Specification: Print the minimum *b* in a line. Demo Input: ['179\n', '-1\n', '18\n'] Demo Output: ['1\n', '9\n', '10\n'] Note: For the first sample, he has to arrive at the floor numbered 180. For the second sample, he will arrive at 8. Note that *b* should be positive, so the answer for the third sample is 10, not 0.
```python n=int(input())+1 s=1 while '8' not in str(n): n+=1 s+=1 print(s) ```
3
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,614,157,837
2,147,483,647
Python 3
OK
TESTS
102
77
0
n1 = input() n2 = input() def split(num): return [int for int in num] lst1 = [] lst2 = [] s = '' lst1 = split(n1) lst2 = split(n2) for i in range(0, len(lst1)): k = int(lst1[i])^int(lst2[i]) s = s+str(k) print(s)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python n1 = input() n2 = input() def split(num): return [int for int in num] lst1 = [] lst2 = [] s = '' lst1 = split(n1) lst2 = split(n2) for i in range(0, len(lst1)): k = int(lst1[i])^int(lst2[i]) s = s+str(k) print(s) ```
3.98075
892
B
Wrath
PROGRAMMING
1,200
[ "greedy", "implementation", "two pointers" ]
null
null
Hands that shed innocent blood! There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=&lt;<=*i* and *j*<=≥<=*i*<=-<=*L**i*. You are given lengths of the claws. You need to find the total number of alive people after the bell rings.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people. Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw.
Print one integer — the total number of alive people after the bell rings.
[ "4\n0 1 0 10\n", "2\n0 0\n", "10\n1 1 3 0 0 0 2 1 0 3\n" ]
[ "1\n", "2\n", "3\n" ]
In first sample the last person kills everyone in front of him.
1,000
[ { "input": "4\n0 1 0 10", "output": "1" }, { "input": "2\n0 0", "output": "2" }, { "input": "10\n1 1 3 0 0 0 2 1 0 3", "output": "3" }, { "input": "10\n0 0 2 0 0 3 3 2 2 0", "output": "2" }, { "input": "1\n0", "output": "1" }, { "input": "5\n0 0 0 1 0", "output": "4" }, { "input": "6\n3 1 1 0 3 3", "output": "1" }, { "input": "8\n0 0 0 1 0 0 1 2", "output": "5" }, { "input": "1\n1000000000", "output": "1" }, { "input": "2\n1 3", "output": "1" }, { "input": "2\n1000000000 1000000000", "output": "1" }, { "input": "11\n1 0 0 1 1 3 2 0 0 2 3", "output": "4" }, { "input": "1\n1", "output": "1" } ]
1,655,519,080
2,147,483,647
PyPy 3
OK
TESTS
43
935
74,854,400
import sys input = sys.stdin.readline n = int(input()) w = list(map(int, input().split())) d = n-1-w[-1] c = 1 for i in range(n-2, -1, -1): if i < d: c += 1 d1 = i-w[i] d = min(d, d1) print(c)
Title: Wrath Time Limit: None seconds Memory Limit: None megabytes Problem Description: Hands that shed innocent blood! There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=&lt;<=*i* and *j*<=≥<=*i*<=-<=*L**i*. You are given lengths of the claws. You need to find the total number of alive people after the bell rings. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people. Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw. Output Specification: Print one integer — the total number of alive people after the bell rings. Demo Input: ['4\n0 1 0 10\n', '2\n0 0\n', '10\n1 1 3 0 0 0 2 1 0 3\n'] Demo Output: ['1\n', '2\n', '3\n'] Note: In first sample the last person kills everyone in front of him.
```python import sys input = sys.stdin.readline n = int(input()) w = list(map(int, input().split())) d = n-1-w[-1] c = 1 for i in range(n-2, -1, -1): if i < d: c += 1 d1 = i-w[i] d = min(d, d1) print(c) ```
3
330
A
Cakeminator
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows: The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times. Please output the maximum number of cake cells that the cakeminator can eat.
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these: - '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output the maximum number of cake cells that the cakeminator can eat.
[ "3 4\nS...\n....\n..S.\n" ]
[ "8\n" ]
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
500
[ { "input": "3 4\nS...\n....\n..S.", "output": "8" }, { "input": "2 2\n..\n..", "output": "4" }, { "input": "2 2\nSS\nSS", "output": "0" }, { "input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..", "output": "14" }, { "input": "3 5\n..S..\nSSSSS\n..S..", "output": "0" }, { "input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS", "output": "0" }, { "input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS", "output": "30" }, { "input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..", "output": "80" }, { "input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS", "output": "0" }, { "input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..", "output": "17" }, { "input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS", "output": "0" }, { "input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S", "output": "64" }, { "input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S", "output": "28" }, { "input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S", "output": "10" }, { "input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.", "output": "0" }, { "input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS", "output": "0" }, { "input": "2 2\n..\n..", "output": "4" }, { "input": "3 2\nS.\n.S\nS.", "output": "0" }, { "input": "3 2\nS.\n.S\nS.", "output": "0" }, { "input": "4 3\n.S.\nS.S\n.S.\nS.S", "output": "0" }, { "input": "2 3\n...\nSSS", "output": "3" }, { "input": "2 4\nS.SS\nS.SS", "output": "2" }, { "input": "2 2\n..\n.S", "output": "3" }, { "input": "3 2\n.S\n.S\nSS", "output": "0" }, { "input": "2 4\nSS.S\n..S.", "output": "0" }, { "input": "2 3\n...\nS..", "output": "5" } ]
1,588,258,917
2,147,483,647
Python 3
OK
TESTS
42
218
0
r, c = map(int, input().split()) lst = [[s for s in input()] for _ in range(r)] count, col = 0, set() for i in range(r): if 'S' not in lst[i]: count += 1 for j in range(c): if lst[i][j] == 'S': col.add(j) print((c - len(col)) * (r - count) + count * c)
Title: Cakeminator Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows: The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times. Please output the maximum number of cake cells that the cakeminator can eat. Input Specification: The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these: - '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. Output Specification: Output the maximum number of cake cells that the cakeminator can eat. Demo Input: ['3 4\nS...\n....\n..S.\n'] Demo Output: ['8\n'] Note: For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
```python r, c = map(int, input().split()) lst = [[s for s in input()] for _ in range(r)] count, col = 0, set() for i in range(r): if 'S' not in lst[i]: count += 1 for j in range(c): if lst[i][j] == 'S': col.add(j) print((c - len(col)) * (r - count) + count * c) ```
3
75
A
Life Without Zeros
PROGRAMMING
1,000
[ "implementation" ]
A. Life Without Zeros
2
256
Can you imagine our life if we removed all zeros from it? For sure we will have many problems. In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros? For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation. But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
[ "101\n102\n", "105\n106\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "101\n102", "output": "YES" }, { "input": "105\n106", "output": "NO" }, { "input": "544\n397", "output": "YES" }, { "input": "822\n280", "output": "NO" }, { "input": "101\n413", "output": "NO" }, { "input": "309\n139", "output": "NO" }, { "input": "693\n970", "output": "NO" }, { "input": "981\n1", "output": "YES" }, { "input": "352\n276", "output": "YES" }, { "input": "164\n691", "output": "YES" }, { "input": "110036\n43", "output": "YES" }, { "input": "100\n1000", "output": "NO" }, { "input": "1000000000\n1000000000", "output": "YES" }, { "input": "999999999\n999999999", "output": "YES" }, { "input": "6\n4", "output": "NO" }, { "input": "123456\n876543", "output": "YES" }, { "input": "1234567\n9876543", "output": "NO" }, { "input": "1111111\n1119111", "output": "NO" }, { "input": "10502405\n40403403", "output": "YES" }, { "input": "1\n1", "output": "YES" }, { "input": "5\n4", "output": "YES" }, { "input": "1\n6", "output": "YES" }, { "input": "40\n17", "output": "NO" }, { "input": "35\n81", "output": "YES" }, { "input": "347\n908", "output": "NO" }, { "input": "2081\n7450", "output": "NO" }, { "input": "84355694\n373629503", "output": "NO" }, { "input": "885992048\n510468672", "output": "NO" }, { "input": "540144752\n647307841", "output": "NO" }, { "input": "341781108\n784147010", "output": "NO" }, { "input": "960440938\n572334653", "output": "NO" }, { "input": "657414510\n768771903", "output": "NO" }, { "input": "501871728\n725074574", "output": "NO" }, { "input": "968\n851", "output": "YES" }, { "input": "943\n939", "output": "YES" }, { "input": "347\n908", "output": "NO" }, { "input": "611\n41", "output": "YES" }, { "input": "737\n289", "output": "NO" }, { "input": "168\n571", "output": "YES" }, { "input": "868\n463", "output": "YES" }, { "input": "815732007\n913882008", "output": "NO" }, { "input": "459039901\n453033850", "output": "NO" }, { "input": "975305404\n484601256", "output": "NO" } ]
1,572,374,876
2,147,483,647
PyPy 3
OK
TESTS
43
310
0
a=input() b=input() c=int(a)+int(b) c=str(c) # print(a,b,c) a0=a.count('0') b0=b.count('0') c0=c.count('0') a=a.replace('0','',a0) b=b.replace('0','',b0) c=c.replace('0','',c0) # print(a,b,c) if int(a)+int(b)==int(c): print('YES') else: print('NO')
Title: Life Without Zeros Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Can you imagine our life if we removed all zeros from it? For sure we will have many problems. In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros? For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation. But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation. Input Specification: The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*. Output Specification: The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise. Demo Input: ['101\n102\n', '105\n106\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python a=input() b=input() c=int(a)+int(b) c=str(c) # print(a,b,c) a0=a.count('0') b0=b.count('0') c0=c.count('0') a=a.replace('0','',a0) b=b.replace('0','',b0) c=c.replace('0','',c0) # print(a,b,c) if int(a)+int(b)==int(c): print('YES') else: print('NO') ```
3.9225
544
A
Set of Strings
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct. Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist.
The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence. The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive.
If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*. If there are multiple possible answers, print any of them.
[ "1\nabca\n", "2\naaacas\n", "4\nabc\n" ]
[ "YES\nabca\n", "YES\naaa\ncas\n", "NO\n" ]
In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}.
500
[ { "input": "1\nabca", "output": "YES\nabca" }, { "input": "2\naaacas", "output": "YES\naaa\ncas" }, { "input": "4\nabc", "output": "NO" }, { "input": "3\nnddkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk", "output": "YES\nn\ndd\nkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk" }, { "input": "26\nbiibfmmfifmffbmmfmbmbmiimbmiffmffibibfbiffibibiiimbffbbfbifmiibffbmbbbfmfibmibfffibfbffmfmimbmmmfmfm", "output": "NO" }, { "input": "3\nkydoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia", "output": "YES\nk\ny\ndoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia" }, { "input": "3\nssussususskkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus", "output": "YES\nss\nussususs\nkkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus" }, { "input": "5\naaaaabcdef", "output": "YES\naaaaa\nb\nc\nd\nef" }, { "input": "3\niiiiiiimiriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc", "output": "YES\niiiiiii\nmi\nriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc" }, { "input": "20\ngggggllglgllltgtlglttstsgtttsslhhlssghgagtlsaghhoggtfgsaahtotdodthfltdxggxislnttlanxonhnkddtigppitdh", "output": "NO" }, { "input": "16\nkkkkkkyykkynkknkkonyokdndkyonokdywkwykdkdotknnwzkoywiooinkcyzyntcdnitnppnpziomyzdspomoqmomcyrrospppn", "output": "NO" }, { "input": "15\nwwwgggowgwwhoohwgwghwyohhggywhyyodgwydwgggkhgyydqyggkgkpokgthqghidhworprodtcogqkwgtfiodwdurcctkmrfmh", "output": "YES\nwww\nggg\nowgww\nhoohwgwghw\nyohhggywhyyo\ndgwydwggg\nkhgyyd\nqyggkgk\npokg\nthqgh\nidhwo\nrprodt\ncogqkwgt\nfiodwd\nurcctkmrfmh" }, { "input": "15\nnnnnnntnttttttqqnqqynnqqwwnnnwneenhwtyhhoqeyeqyeuthwtnhtpnphhwetjhouhwnpojvvovoswwjryrwerbwwpbvrwvjj", "output": "YES\nnnnnnn\ntntttttt\nqqnqq\nynnqq\nwwnnnwn\neen\nhwtyhh\noqeyeqye\nuthwtnht\npnphhwet\njhouhwnpoj\nvvovo\nswwj\nryrwer\nbwwpbvrwvjj" }, { "input": "15\nvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv", "output": "NO" }, { "input": "1\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai", "output": "YES\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai" }, { "input": "26\nvvvnnsnnnpsnnswwspncvshtncwphaphmwnwkhvvhuvctvnehemowkmtzissswjaxuuvphzrmfzihamdqmmyhhijbitlipgltyy", "output": "YES\nvvv\nnn\nsnnn\npsnns\nwwspn\ncvs\nh\ntncwph\naph\nmwnw\nkhvvh\nuvctvn\nehem\nowkmt\nz\nisssw\nja\nxuuvphz\nrm\nfziham\nd\nqmm\nyhhij\nbit\nlip\ngltyy" }, { "input": "26\njexzsbwaih", "output": "NO" }, { "input": "1\nk", "output": "YES\nk" }, { "input": "1\nzz", "output": "YES\nzz" }, { "input": "3\nziw", "output": "YES\nz\ni\nw" }, { "input": "26\ntjmbyqwuahlixegopkzrfndcsv", "output": "YES\nt\nj\nm\nb\ny\nq\nw\nu\na\nh\nl\ni\nx\ne\ng\no\np\nk\nz\nr\nf\nn\nd\nc\ns\nv" }, { "input": "25\nvobekscyadzqwnjxruplifmthg", "output": "YES\nv\no\nb\ne\nk\ns\nc\ny\na\nd\nz\nq\nw\nn\nj\nx\nr\nu\np\nl\ni\nf\nm\nt\nhg" }, { "input": "26\nlllplzkkzflzflffzznnnnfgflqlttlmtnkzlztskngyymitqagattkdllyutzimsrskpapcmuupjdopxqlnhqcscwvdtxbflefy", "output": "YES\nlll\npl\nz\nkkz\nflzflffzz\nnnnnf\ngfl\nql\nttl\nmtnkzlzt\nskng\nyym\nitq\nagattk\ndlly\nutzims\nrskpap\ncmuup\njd\nop\nxqln\nhqcsc\nw\nvdtx\nbfl\nefy" }, { "input": "25\nkkrrkrkrkrsrskpskbrppdsdbgbkrbllkbswdwcchgskmkhwiidicczlscsodtjglxbmeotzxnmbjmoqgkquglaoxgcykxvbhdi", "output": "YES\nkk\nrrkrkrkr\nsrsk\npsk\nbrpp\ndsdb\ngbkrb\nllkbs\nwdw\ncc\nhgsk\nmkhw\niidicc\nzlscs\nod\nt\njgl\nxbm\neotzx\nnmbjmo\nqgkq\nugl\naoxgc\nykx\nvbhdi" }, { "input": "25\nuuuuuccpucubccbupxubcbpujiliwbpqbpyiweuywaxwqasbsllwehceruytjvphytraawgbjmerfeymoayujqranlvkpkiypadr", "output": "YES\nuuuuu\ncc\npucu\nbccbup\nxubcbpu\nj\ni\nli\nwbp\nqbp\nyiw\neuyw\naxwqa\nsbsllwe\nhce\nruy\ntj\nvphytraaw\ngbj\nmer\nfeym\noayujqra\nnlv\nkpkiypa\ndr" }, { "input": "26\nxxjxodrogovufvohrodliretxxyjqnrbzmicorptkjafiwmsbwml", "output": "YES\nxx\njx\no\nd\nro\ngo\nv\nu\nfvo\nhrod\nl\nir\ne\ntxx\nyj\nq\nnr\nb\nz\nmi\ncor\npt\nkj\nafi\nwm\nsbwml" }, { "input": "26\npjhsxjbvkqntwmsdnrguecaofylzti", "output": "YES\np\nj\nh\ns\nxj\nb\nv\nk\nq\nn\nt\nw\nms\ndn\nr\ng\nu\ne\nc\na\no\nf\ny\nl\nzt\ni" }, { "input": "25\nrrrrqqwrlqrwglrlylwhrrwyvrhvzgvqahrhgsvavtggyduayivxzgeicinlnrkapoepbsfyjjrt", "output": "YES\nrrrr\nqq\nwr\nlqrw\nglrl\nylw\nhrrwy\nvrhv\nzgvq\nahrhg\nsvav\ntggy\nd\nuay\niv\nxzg\nei\nci\nnlnr\nka\np\noep\nbs\nfy\njjrt" }, { "input": "26\ncccccccaacwwaxxaacczacnnnqqwnaggzqrwagcnabxnrcvgjqjamqzgdntzanaxvjfwqlvdttuzjoxiwtkqvrydospmpeirhg", "output": "YES\nccccccc\naac\nwwa\nxxaacc\nzac\nnnn\nqqwna\nggzq\nrwagcna\nbxnrc\nvg\njqja\nmqzg\ndn\ntzanaxvj\nfwq\nlvdtt\nuzj\nox\niwt\nkqvr\nydo\ns\npmp\neir\nhg" }, { "input": "4\nsssssssssssssssssssssssssslsslslsllsslssslslssllaaslsaalsasaassllasasalrlrslarlaarlsrsaslasarlr", "output": "YES\nssssssssssssssssssssssssss\nlsslslsllsslssslslssll\naaslsaalsasaassllasasal\nrlrslarlaarlsrsaslasarlr" }, { "input": "26\na", "output": "NO" }, { "input": "26\nab", "output": "NO" }, { "input": "2\nab", "output": "YES\na\nb" } ]
1,474,273,430
2,147,483,647
Python 3
OK
TESTS
33
61
0
I=input P=print k=int(I()) r=[] i=0 s=I() while i<len(s) and k>0: j=i+1 while j<len(s)and any(map(lambda x:x[0]==s[j],[s[i]]+r)):j+=1 r+=[s[i:j]];k-=1;i=j if k:P('NO') else: P('YES',end='') t=0 for i in r:P('\n'+i,end='');t+=len(i) P(s[t:])
Title: Set of Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct. Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist. Input Specification: The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence. The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive. Output Specification: If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*. If there are multiple possible answers, print any of them. Demo Input: ['1\nabca\n', '2\naaacas\n', '4\nabc\n'] Demo Output: ['YES\nabca\n', 'YES\naaa\ncas\n', 'NO\n'] Note: In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}.
```python I=input P=print k=int(I()) r=[] i=0 s=I() while i<len(s) and k>0: j=i+1 while j<len(s)and any(map(lambda x:x[0]==s[j],[s[i]]+r)):j+=1 r+=[s[i:j]];k-=1;i=j if k:P('NO') else: P('YES',end='') t=0 for i in r:P('\n'+i,end='');t+=len(i) P(s[t:]) ```
3
952
A
Quirky Quantifiers
PROGRAMMING
800
[ "math" ]
null
null
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999). Output 0 or 1.
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1.
[ "13\n", "927\n", "48\n" ]
[ "1\n", "1\n", "0\n" ]
none
0
[ { "input": "13", "output": "1" }, { "input": "927", "output": "1" }, { "input": "48", "output": "0" }, { "input": "10", "output": "0" }, { "input": "999", "output": "1" }, { "input": "142", "output": "0" }, { "input": "309", "output": "1" }, { "input": "572", "output": "0" }, { "input": "835", "output": "1" }, { "input": "990", "output": "0" }, { "input": "168", "output": "0" }, { "input": "431", "output": "1" }, { "input": "694", "output": "0" }, { "input": "957", "output": "1" }, { "input": "932", "output": "0" } ]
1,693,044,881
2,147,483,647
PyPy 3-64
OK
TESTS
15
62
0
from sys import stdin,stdout # from os import _exit # from bisect import bisect_left,bisect # from heapq import heapify,heappop,heappush # from sys import setrecursionlimit # from collections import defaultdict,Counter # from itertools import permutations # from math import gcd,ceil,sqrt,factorial # setrecursionlimit(int(1e5)) input,print = stdin.readline,stdout.write n = int(input()) if n%2==0: ans = 0 else: ans = 1 print(str(ans)+"\n")
Title: Quirky Quantifiers Time Limit: None seconds Memory Limit: None megabytes Problem Description: The input contains a single integer *a* (10<=≤<=*a*<=≤<=999). Output 0 or 1. Input Specification: The input contains a single integer *a* (10<=≤<=*a*<=≤<=999). Output Specification: Output 0 or 1. Demo Input: ['13\n', '927\n', '48\n'] Demo Output: ['1\n', '1\n', '0\n'] Note: none
```python from sys import stdin,stdout # from os import _exit # from bisect import bisect_left,bisect # from heapq import heapify,heappop,heappush # from sys import setrecursionlimit # from collections import defaultdict,Counter # from itertools import permutations # from math import gcd,ceil,sqrt,factorial # setrecursionlimit(int(1e5)) input,print = stdin.readline,stdout.write n = int(input()) if n%2==0: ans = 0 else: ans = 1 print(str(ans)+"\n") ```
3
87
A
Trains
PROGRAMMING
1,500
[ "implementation", "math" ]
A. Trains
2
256
Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence. When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample). We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously. Help Vasya count to which girlfriend he will go more often.
The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106).
Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency.
[ "3 7\n", "5 3\n", "2 3\n" ]
[ "Dasha\n", "Masha\n", "Equal\n" ]
Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often. If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute. If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute. If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute. If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction. In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often.
500
[ { "input": "3 7", "output": "Dasha" }, { "input": "5 3", "output": "Masha" }, { "input": "2 3", "output": "Equal" }, { "input": "31 88", "output": "Dasha" }, { "input": "8 75", "output": "Dasha" }, { "input": "32 99", "output": "Dasha" }, { "input": "77 4", "output": "Masha" }, { "input": "27 1", "output": "Masha" }, { "input": "84 11", "output": "Masha" }, { "input": "4 6", "output": "Equal" }, { "input": "52 53", "output": "Equal" }, { "input": "397 568", "output": "Dasha" }, { "input": "22 332", "output": "Dasha" }, { "input": "419 430", "output": "Dasha" }, { "input": "638 619", "output": "Masha" }, { "input": "393 325", "output": "Masha" }, { "input": "876 218", "output": "Masha" }, { "input": "552 551", "output": "Equal" }, { "input": "906 912", "output": "Equal" }, { "input": "999 996", "output": "Equal" }, { "input": "652 653", "output": "Equal" }, { "input": "3647 7698", "output": "Dasha" }, { "input": "2661 8975", "output": "Dasha" }, { "input": "251 9731", "output": "Dasha" }, { "input": "9886 8671", "output": "Masha" }, { "input": "8545 7312", "output": "Masha" }, { "input": "4982 2927", "output": "Masha" }, { "input": "7660 7658", "output": "Equal" }, { "input": "9846 9844", "output": "Equal" }, { "input": "9632 9640", "output": "Equal" }, { "input": "5036 5037", "output": "Equal" }, { "input": "64854 77725", "output": "Dasha" }, { "input": "4965 85708", "output": "Dasha" }, { "input": "20393 86640", "output": "Dasha" }, { "input": "99207 30728", "output": "Masha" }, { "input": "77545 13842", "output": "Masha" }, { "input": "30362 10712", "output": "Masha" }, { "input": "51291 51292", "output": "Equal" }, { "input": "55381 55382", "output": "Equal" }, { "input": "91560 91550", "output": "Equal" }, { "input": "99087 99090", "output": "Equal" }, { "input": "983794 986389", "output": "Dasha" }, { "input": "779183 786727", "output": "Dasha" }, { "input": "450766 610961", "output": "Dasha" }, { "input": "664690 630787", "output": "Masha" }, { "input": "461363 256765", "output": "Masha" }, { "input": "638067 409048", "output": "Masha" }, { "input": "929061 929052", "output": "Equal" }, { "input": "996219 996216", "output": "Equal" }, { "input": "716249 716248", "output": "Equal" }, { "input": "782250 782252", "output": "Equal" }, { "input": "1 2", "output": "Equal" }, { "input": "2 1", "output": "Equal" }, { "input": "999999 1000000", "output": "Equal" }, { "input": "999997 1000000", "output": "Dasha" }, { "input": "1000000 999993", "output": "Masha" }, { "input": "999983 999979", "output": "Masha" } ]
1,420,305,438
2,147,483,647
Python 3
OK
TESTS
57
156
0
import sys def gcd(a, b): if(b == 0): return a r = a % b return gcd(b, r) a, b = [int(x) for x in (sys.stdin.readline()).split()] t = gcd(a, b) a /= t b /= t if(a > b): if(a != b + 1): print("Masha") else: print("Equal") else: if(b != a + 1): print("Dasha") else: print("Equal")
Title: Trains Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence. When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample). We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously. Help Vasya count to which girlfriend he will go more often. Input Specification: The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106). Output Specification: Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency. Demo Input: ['3 7\n', '5 3\n', '2 3\n'] Demo Output: ['Dasha\n', 'Masha\n', 'Equal\n'] Note: Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often. If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute. If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute. If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute. If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction. In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often.
```python import sys def gcd(a, b): if(b == 0): return a r = a % b return gcd(b, r) a, b = [int(x) for x in (sys.stdin.readline()).split()] t = gcd(a, b) a /= t b /= t if(a > b): if(a != b + 1): print("Masha") else: print("Equal") else: if(b != a + 1): print("Dasha") else: print("Equal") ```
3.961
34
B
Sale
PROGRAMMING
900
[ "greedy", "sortings" ]
B. Sale
2
256
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
[ "5 3\n-6 0 35 -2 4\n", "4 2\n7 0 0 -7\n" ]
[ "8\n", "7\n" ]
none
1,000
[ { "input": "5 3\n-6 0 35 -2 4", "output": "8" }, { "input": "4 2\n7 0 0 -7", "output": "7" }, { "input": "6 6\n756 -611 251 -66 572 -818", "output": "1495" }, { "input": "5 5\n976 437 937 788 518", "output": "0" }, { "input": "5 3\n-2 -2 -2 -2 -2", "output": "6" }, { "input": "5 1\n998 997 985 937 998", "output": "0" }, { "input": "2 2\n-742 -187", "output": "929" }, { "input": "3 3\n522 597 384", "output": "0" }, { "input": "4 2\n-215 -620 192 647", "output": "835" }, { "input": "10 6\n557 605 685 231 910 633 130 838 -564 -85", "output": "649" }, { "input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59", "output": "10" }, { "input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000", "output": "0" }, { "input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886", "output": "19441" }, { "input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999", "output": "0" }, { "input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993", "output": "16984" }, { "input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981", "output": "21743" }, { "input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654", "output": "81283" }, { "input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782", "output": "0" }, { "input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823", "output": "0" }, { "input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992", "output": "75068" }, { "input": "1 1\n0", "output": "0" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 1\n555", "output": "0" }, { "input": "1 1\n-1", "output": "1" }, { "input": "1 1\n-24", "output": "24" } ]
1,683,561,122
2,147,483,647
Python 3
OK
TESTS
25
62
0
n, m = map(int, input().split()) a = sorted(list(map(int, input().split()))) res = 0 for i in range(m): if a[i] < 0: res += abs(a[i]) else: break print(res)
Title: Sale Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn. Input Specification: The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets. Output Specification: Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets. Demo Input: ['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n'] Demo Output: ['8\n', '7\n'] Note: none
```python n, m = map(int, input().split()) a = sorted(list(map(int, input().split()))) res = 0 for i in range(m): if a[i] < 0: res += abs(a[i]) else: break print(res) ```
3.9845
858
A
k-rounding
PROGRAMMING
1,100
[ "brute force", "math", "number theory" ]
null
null
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*. For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375. Write a program that will perform the *k*-rounding of *n*.
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Print the *k*-rounding of *n*.
[ "375 4\n", "10000 1\n", "38101 0\n", "123456789 8\n" ]
[ "30000\n", "10000\n", "38101\n", "12345678900000000\n" ]
none
750
[ { "input": "375 4", "output": "30000" }, { "input": "10000 1", "output": "10000" }, { "input": "38101 0", "output": "38101" }, { "input": "123456789 8", "output": "12345678900000000" }, { "input": "1 0", "output": "1" }, { "input": "2 0", "output": "2" }, { "input": "100 0", "output": "100" }, { "input": "1000000000 0", "output": "1000000000" }, { "input": "160 2", "output": "800" }, { "input": "3 0", "output": "3" }, { "input": "10 0", "output": "10" }, { "input": "1 1", "output": "10" }, { "input": "2 1", "output": "10" }, { "input": "3 1", "output": "30" }, { "input": "4 1", "output": "20" }, { "input": "5 1", "output": "10" }, { "input": "6 1", "output": "30" }, { "input": "7 1", "output": "70" }, { "input": "8 1", "output": "40" }, { "input": "9 1", "output": "90" }, { "input": "10 1", "output": "10" }, { "input": "11 1", "output": "110" }, { "input": "12 1", "output": "60" }, { "input": "16 2", "output": "400" }, { "input": "2 2", "output": "100" }, { "input": "1 2", "output": "100" }, { "input": "5 2", "output": "100" }, { "input": "15 2", "output": "300" }, { "input": "36 2", "output": "900" }, { "input": "1 8", "output": "100000000" }, { "input": "8 8", "output": "100000000" }, { "input": "96 8", "output": "300000000" }, { "input": "175 8", "output": "700000000" }, { "input": "9999995 8", "output": "199999900000000" }, { "input": "999999999 8", "output": "99999999900000000" }, { "input": "12345678 8", "output": "617283900000000" }, { "input": "78125 8", "output": "100000000" }, { "input": "390625 8", "output": "100000000" }, { "input": "1953125 8", "output": "500000000" }, { "input": "9765625 8", "output": "2500000000" }, { "input": "68359375 8", "output": "17500000000" }, { "input": "268435456 8", "output": "104857600000000" }, { "input": "125829120 8", "output": "9830400000000" }, { "input": "128000 8", "output": "400000000" }, { "input": "300000 8", "output": "300000000" }, { "input": "3711871 8", "output": "371187100000000" }, { "input": "55555 8", "output": "1111100000000" }, { "input": "222222222 8", "output": "11111111100000000" }, { "input": "479001600 8", "output": "7484400000000" }, { "input": "655360001 7", "output": "6553600010000000" }, { "input": "655360001 8", "output": "65536000100000000" }, { "input": "1000000000 1", "output": "1000000000" }, { "input": "1000000000 7", "output": "1000000000" }, { "input": "1000000000 8", "output": "1000000000" }, { "input": "100000000 8", "output": "100000000" }, { "input": "10000000 8", "output": "100000000" }, { "input": "1000000 8", "output": "100000000" }, { "input": "10000009 8", "output": "1000000900000000" }, { "input": "10000005 8", "output": "200000100000000" }, { "input": "10000002 8", "output": "500000100000000" }, { "input": "999999997 8", "output": "99999999700000000" }, { "input": "999999997 7", "output": "9999999970000000" }, { "input": "999999995 8", "output": "19999999900000000" }, { "input": "123 8", "output": "12300000000" }, { "input": "24 2", "output": "600" }, { "input": "16 4", "output": "10000" }, { "input": "123456787 8", "output": "12345678700000000" }, { "input": "100000000 8", "output": "100000000" }, { "input": "7 1", "output": "70" }, { "input": "101 1", "output": "1010" }, { "input": "50 2", "output": "100" }, { "input": "999999818 1", "output": "4999999090" }, { "input": "2 1", "output": "10" }, { "input": "123 1", "output": "1230" }, { "input": "16 1", "output": "80" }, { "input": "1 1", "output": "10" }, { "input": "1000000000 8", "output": "1000000000" }, { "input": "15304 6", "output": "1913000000" }, { "input": "3 8", "output": "300000000" }, { "input": "4 2", "output": "100" }, { "input": "100000 7", "output": "10000000" }, { "input": "5 8", "output": "100000000" }, { "input": "16724 6", "output": "4181000000" }, { "input": "999999999 1", "output": "9999999990" }, { "input": "999999990 8", "output": "9999999900000000" }, { "input": "999999999 8", "output": "99999999900000000" }, { "input": "100000 1", "output": "100000" }, { "input": "8 3", "output": "1000" }, { "input": "16768 6", "output": "262000000" }, { "input": "123456789 1", "output": "1234567890" }, { "input": "2 8", "output": "100000000" }, { "input": "999999937 8", "output": "99999993700000000" }, { "input": "5 1", "output": "10" }, { "input": "2000000 7", "output": "10000000" }, { "input": "1999998 2", "output": "99999900" }, { "input": "125 3", "output": "1000" } ]
1,599,592,440
2,147,483,647
PyPy 3
OK
TESTS
96
140
0
n, k = list(map(int, input().split())) t, two, f, five = 1, 2, 1, 5 while True: if n % two == 0: t += 1 two *= 2 elif n % five == 0: f += 1 five *= 5 else: break while t <= k: n *= 2 t += 1 while f <= k: n *= 5 f += 1 print(n)
Title: k-rounding Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*. For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375. Write a program that will perform the *k*-rounding of *n*. Input Specification: The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8). Output Specification: Print the *k*-rounding of *n*. Demo Input: ['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n'] Demo Output: ['30000\n', '10000\n', '38101\n', '12345678900000000\n'] Note: none
```python n, k = list(map(int, input().split())) t, two, f, five = 1, 2, 1, 5 while True: if n % two == 0: t += 1 two *= 2 elif n % five == 0: f += 1 five *= 5 else: break while t <= k: n *= 2 t += 1 while f <= k: n *= 5 f += 1 print(n) ```
3
149
A
Business trip
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
null
null
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until... Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters. Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
[ "5\n1 1 1 1 2 2 3 2 2 1 1 1\n", "0\n0 0 0 0 0 0 0 1 1 2 3 0\n", "11\n1 1 4 1 1 5 1 1 4 1 1 1\n" ]
[ "2\n", "0\n", "3\n" ]
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters. In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
500
[ { "input": "5\n1 1 1 1 2 2 3 2 2 1 1 1", "output": "2" }, { "input": "0\n0 0 0 0 0 0 0 1 1 2 3 0", "output": "0" }, { "input": "11\n1 1 4 1 1 5 1 1 4 1 1 1", "output": "3" }, { "input": "15\n20 1 1 1 1 2 2 1 2 2 1 1", "output": "1" }, { "input": "7\n8 9 100 12 14 17 21 10 11 100 23 10", "output": "1" }, { "input": "52\n1 12 3 11 4 5 10 6 9 7 8 2", "output": "6" }, { "input": "50\n2 2 3 4 5 4 4 5 7 3 2 7", "output": "-1" }, { "input": "0\n55 81 28 48 99 20 67 95 6 19 10 93", "output": "0" }, { "input": "93\n85 40 93 66 92 43 61 3 64 51 90 21", "output": "1" }, { "input": "99\n36 34 22 0 0 0 52 12 0 0 33 47", "output": "2" }, { "input": "99\n28 32 31 0 10 35 11 18 0 0 32 28", "output": "3" }, { "input": "99\n19 17 0 1 18 11 29 9 29 22 0 8", "output": "4" }, { "input": "76\n2 16 11 10 12 0 20 4 4 14 11 14", "output": "5" }, { "input": "41\n2 1 7 7 4 2 4 4 9 3 10 0", "output": "6" }, { "input": "47\n8 2 2 4 3 1 9 4 2 7 7 8", "output": "7" }, { "input": "58\n6 11 7 0 5 6 3 9 4 9 5 1", "output": "8" }, { "input": "32\n5 2 4 1 5 0 5 1 4 3 0 3", "output": "9" }, { "input": "31\n6 1 0 4 4 5 1 0 5 3 2 0", "output": "9" }, { "input": "35\n2 3 0 0 6 3 3 4 3 5 0 6", "output": "9" }, { "input": "41\n3 1 3 4 3 6 6 1 4 4 0 6", "output": "11" }, { "input": "97\n0 5 3 12 10 16 22 8 21 17 21 10", "output": "5" }, { "input": "100\n21 21 0 0 4 13 0 26 0 0 0 15", "output": "6" }, { "input": "100\n0 0 16 5 22 0 5 0 25 0 14 13", "output": "7" }, { "input": "97\n17 0 10 0 0 0 18 0 14 23 15 0", "output": "6" }, { "input": "100\n0 9 0 18 7 0 0 14 33 3 0 16", "output": "7" }, { "input": "95\n5 2 13 0 15 18 17 0 6 11 0 8", "output": "9" }, { "input": "94\n11 13 0 9 15 8 8 16 3 7 1 3", "output": "11" }, { "input": "96\n8 4 12 15 8 0 4 10 6 6 12 11", "output": "11" }, { "input": "100\n5 5 3 8 6 5 0 3 3 8 1 3", "output": "-1" }, { "input": "100\n1 0 0 1 1 0 1 1 1 1 2 1", "output": "-1" }, { "input": "100\n6 3 2 0 4 1 2 2 2 2 1 1", "output": "-1" }, { "input": "0\n0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0", "output": "-1" }, { "input": "0\n100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100", "output": "1" }, { "input": "12\n1 1 1 1 1 1 1 1 1 1 1 1", "output": "12" }, { "input": "13\n1 1 1 1 1 1 1 1 1 1 1 2", "output": "12" }, { "input": "15\n10 1 1 1 1 1 1 1 1 1 1 1", "output": "6" }, { "input": "1\n0 0 0 0 0 0 0 0 0 0 0 0", "output": "-1" } ]
1,686,990,463
2,147,483,647
PyPy 3-64
OK
TESTS
39
124
0
k = int(input()) cards = list(map(int, input().split())) cards.sort(reverse=True) i = 0 while k > 0 and i < 12: k -= cards[i] i += 1 if k > 0: print(-1) else: print(i)
Title: Business trip Time Limit: None seconds Memory Limit: None megabytes Problem Description: What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until... Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters. Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters. Input Specification: The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100). Output Specification: Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1. Demo Input: ['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n'] Demo Output: ['2\n', '0\n', '3\n'] Note: Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters. In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
```python k = int(input()) cards = list(map(int, input().split())) cards.sort(reverse=True) i = 0 while k > 0 and i < 12: k -= cards[i] i += 1 if k > 0: print(-1) else: print(i) ```
3
219
A
k-String
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes).
[ "2\naazz\n", "3\nabcabcabz\n" ]
[ "azaz\n", "-1\n" ]
none
500
[ { "input": "2\naazz", "output": "azaz" }, { "input": "3\nabcabcabz", "output": "-1" }, { "input": "1\na", "output": "a" }, { "input": "2\nabba", "output": "abab" }, { "input": "2\naaab", "output": "-1" }, { "input": "7\nabacaba", "output": "-1" }, { "input": "5\naaaaa", "output": "aaaaa" }, { "input": "3\naabaaaaabb", "output": "-1" }, { "input": "2\naaab", "output": "-1" }, { "input": "2\nbabac", "output": "-1" }, { "input": "3\nbbbccc", "output": "bcbcbc" }, { "input": "2\naa", "output": "aa" }, { "input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece", "output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece" }, { "input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa", "output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc" }, { "input": "1\naaa", "output": "aaa" }, { "input": "1\naabaab", "output": "aaaabb" }, { "input": "2\naabbbbccccccdddddddd", "output": "abbcccddddabbcccdddd" }, { "input": "3\naaaaaaaaacccdddddd", "output": "aaacddaaacddaaacdd" }, { "input": "3\naaaaaaaaacccbbbbbb", "output": "aaabbcaaabbcaaabbc" }, { "input": "2\naazzzz", "output": "azzazz" }, { "input": "2\naaaa", "output": "aaaa" }, { "input": "2\naaaazz", "output": "aazaaz" }, { "input": "2\naaaabb", "output": "aabaab" }, { "input": "2\naabbbb", "output": "abbabb" }, { "input": "2\naaaazzzz", "output": "aazzaazz" }, { "input": "2\naaazz", "output": "-1" }, { "input": "2\nbbbbaa", "output": "abbabb" }, { "input": "2\naaaaaabbbb", "output": "aaabbaaabb" }, { "input": "2\naaaaaazz", "output": "aaazaaaz" }, { "input": "2\naaaabbbb", "output": "aabbaabb" }, { "input": "2\naabaab", "output": "aabaab" }, { "input": "1\naaaaa", "output": "aaaaa" }, { "input": "2\nbbaaaa", "output": "aabaab" }, { "input": "2\nacaccc", "output": "accacc" } ]
1,697,023,730
2,147,483,647
Python 3
OK
TESTS
42
92
0
d = {} k = int(input()) s = input() for i in s: if i not in d: d[i] =1 else: d[i] +=1 flag= 1 a = "" for key,value in d.items(): if value%k != 0: flag = 0 break else: a += key*(value//k) if flag: print(a*k) else: print(-1)
Title: k-String Time Limit: None seconds Memory Limit: None megabytes Problem Description: A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string. Input Specification: The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*. Output Specification: Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes). Demo Input: ['2\naazz\n', '3\nabcabcabz\n'] Demo Output: ['azaz\n', '-1\n'] Note: none
```python d = {} k = int(input()) s = input() for i in s: if i not in d: d[i] =1 else: d[i] +=1 flag= 1 a = "" for key,value in d.items(): if value%k != 0: flag = 0 break else: a += key*(value//k) if flag: print(a*k) else: print(-1) ```
3
837
A
Text Volume
PROGRAMMING
800
[ "implementation" ]
null
null
You are given a text of single-space separated words, consisting of small and capital Latin letters. Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text. Calculate the volume of the given text.
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text. The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Print one integer number — volume of text.
[ "7\nNonZERO\n", "24\nthis is zero answer text\n", "24\nHarbour Space University\n" ]
[ "5\n", "0\n", "1\n" ]
In the first example there is only one word, there are 5 capital letters in it. In the second example all of the words contain 0 capital letters.
0
[ { "input": "7\nNonZERO", "output": "5" }, { "input": "24\nthis is zero answer text", "output": "0" }, { "input": "24\nHarbour Space University", "output": "1" }, { "input": "2\nWM", "output": "2" }, { "input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz", "output": "105" }, { "input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g", "output": "1" }, { "input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez", "output": "50" }, { "input": "1\ne", "output": "0" }, { "input": "1\nA", "output": "1" }, { "input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ", "output": "10" }, { "input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "200" }, { "input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff", "output": "0" }, { "input": "24\nHarbour Space UniversitY", "output": "2" }, { "input": "5\naA AA", "output": "2" }, { "input": "10\nas AS ASDA", "output": "4" }, { "input": "10\nas AS ASDZ", "output": "4" }, { "input": "3\na A", "output": "1" }, { "input": "24\nHarbour space UniversitY", "output": "2" }, { "input": "10\nas AS ASAa", "output": "3" }, { "input": "15\naAb ABCDFGRHTJS", "output": "11" }, { "input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR", "output": "6" }, { "input": "10\nABC ABc AB", "output": "3" }, { "input": "10\nA c de CDE", "output": "3" }, { "input": "4\nA AB", "output": "2" }, { "input": "18\nHARbour Space UNIV", "output": "4" }, { "input": "13\na b c d e f A", "output": "1" }, { "input": "6\nA B CA", "output": "2" }, { "input": "4\naa A", "output": "1" }, { "input": "3\nA a", "output": "1" } ]
1,594,299,758
2,147,483,647
Python 3
OK
TESTS
29
124
6,758,400
size = int(input()) st = str(input()) counter = 0 maximal = 0 for i in range(0, size): if st[i] < 'a' and st[i] != ' ': counter += 1 if st[i] == ' ' or i == (size - 1): if maximal < counter: maximal = counter counter = 0 print(maximal)
Title: Text Volume Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a text of single-space separated words, consisting of small and capital Latin letters. Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text. Calculate the volume of the given text. Input Specification: The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text. The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters. Output Specification: Print one integer number — volume of text. Demo Input: ['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n'] Demo Output: ['5\n', '0\n', '1\n'] Note: In the first example there is only one word, there are 5 capital letters in it. In the second example all of the words contain 0 capital letters.
```python size = int(input()) st = str(input()) counter = 0 maximal = 0 for i in range(0, size): if st[i] < 'a' and st[i] != ' ': counter += 1 if st[i] == ' ' or i == (size - 1): if maximal < counter: maximal = counter counter = 0 print(maximal) ```
3
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,679,390,669
2,147,483,647
Python 3
OK
TESTS
102
61
0
n1=str(input()) n2=str(input()) s="" for i in range (0,len(n1)): if n1[i]==n2[i]: s+="0" else: s+="1" print(s)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python n1=str(input()) n2=str(input()) s="" for i in range (0,len(n1)): if n1[i]==n2[i]: s+="0" else: s+="1" print(s) ```
3.98475
278
A
Circle Line
PROGRAMMING
800
[ "implementation" ]
null
null
The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations: - *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station. The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d**i*<=≤<=100) — the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=≤<=*s*,<=*t*<=≤<=*n*) — the numbers of stations, between which you need to find the shortest distance. These numbers can be the same. The numbers in the lines are separated by single spaces.
Print a single number — the length of the shortest path between stations number *s* and *t*.
[ "4\n2 3 4 9\n1 3\n", "4\n5 8 2 100\n4 1\n", "3\n1 1 1\n3 1\n", "3\n31 41 59\n1 1\n" ]
[ "5\n", "15\n", "1\n", "0\n" ]
In the first sample the length of path 1 → 2 → 3 equals 5, the length of path 1 → 4 → 3 equals 13. In the second sample the length of path 4 → 1 is 100, the length of path 4 → 3 → 2 → 1 is 15. In the third sample the length of path 3 → 1 is 1, the length of path 3 → 2 → 1 is 2. In the fourth sample the numbers of stations are the same, so the shortest distance equals 0.
500
[ { "input": "4\n2 3 4 9\n1 3", "output": "5" }, { "input": "4\n5 8 2 100\n4 1", "output": "15" }, { "input": "3\n1 1 1\n3 1", "output": "1" }, { "input": "3\n31 41 59\n1 1", "output": "0" }, { "input": "5\n16 13 10 30 15\n4 2", "output": "23" }, { "input": "6\n89 82 87 32 67 33\n4 4", "output": "0" }, { "input": "7\n2 3 17 10 2 2 2\n4 2", "output": "18" }, { "input": "3\n4 37 33\n3 3", "output": "0" }, { "input": "8\n87 40 96 7 86 86 72 97\n6 8", "output": "158" }, { "input": "10\n91 94 75 99 100 91 79 86 79 92\n2 8", "output": "348" }, { "input": "19\n1 1 1 1 2 1 1 1 1 1 2 1 3 2 2 1 1 1 2\n7 7", "output": "0" }, { "input": "34\n96 65 24 99 74 76 97 93 99 69 94 82 92 91 98 83 95 97 96 81 90 95 86 87 43 78 88 86 82 62 76 99 83 96\n21 16", "output": "452" }, { "input": "50\n75 98 65 75 99 89 84 65 9 53 62 61 61 53 80 7 6 47 86 1 89 27 67 1 31 39 53 92 19 20 76 41 60 15 29 94 76 82 87 89 93 38 42 6 87 36 100 97 93 71\n2 6", "output": "337" }, { "input": "99\n1 15 72 78 23 22 26 98 7 2 75 58 100 98 45 79 92 69 79 72 33 88 62 9 15 87 17 73 68 54 34 89 51 91 28 44 20 11 74 7 85 61 30 46 95 72 36 18 48 22 42 46 29 46 86 53 96 55 98 34 60 37 75 54 1 81 20 68 84 19 18 18 75 84 86 57 73 34 23 43 81 87 47 96 57 41 69 1 52 44 54 7 85 35 5 1 19 26 7\n4 64", "output": "1740" }, { "input": "100\n33 63 21 27 49 82 86 93 43 55 4 72 89 85 5 34 80 7 23 13 21 49 22 73 89 65 81 25 6 92 82 66 58 88 48 96 1 1 16 48 67 96 84 63 87 76 20 100 36 4 31 41 35 62 55 76 74 70 68 41 4 16 39 81 2 41 34 73 66 57 41 89 78 93 68 96 87 47 92 60 40 58 81 12 19 74 56 83 56 61 83 97 26 92 62 52 39 57 89 95\n71 5", "output": "2127" }, { "input": "100\n95 98 99 81 98 96 100 92 96 90 99 91 98 98 91 78 97 100 96 98 87 93 96 99 91 92 96 92 90 97 85 83 99 95 66 91 87 89 100 95 100 88 99 84 96 79 99 100 94 100 99 99 92 89 99 91 100 94 98 97 91 92 90 87 84 99 97 98 93 100 90 85 75 95 86 71 98 93 91 87 92 95 98 94 95 94 100 98 96 100 97 96 95 95 86 86 94 97 98 96\n67 57", "output": "932" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 97 100 100 100 100 100 99 100 100 99 99 100 99 100 100 100 100 100 100 100 100 100 97 99 98 98 100 98 98 100 99 100 100 100 100 99 100 98 100 99 98 99 98 98 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 98 100 99 99 100 96 100 96 100 99 100 100 99 100 99 100 100 100 99 100 100 100 100 98 98 97 100 100 99 98\n16 6", "output": "997" }, { "input": "100\n3 6 23 4 23 1 2 14 2 3 3 9 17 8 10 5 1 14 8 5 7 4 13 8 5 6 24 3 12 3 4 9 2 8 2 1 2 1 3 2 1 6 14 23 8 6 3 5 7 8 18 9 2 5 22 6 13 16 2 4 31 20 4 3 3 6 6 1 1 18 5 11 1 14 4 16 6 37 11 1 8 3 7 11 21 14 3 3 12 2 5 1 9 16 3 1 3 4 4 2\n98 24", "output": "195" }, { "input": "100\n1 1 3 1 1 2 1 2 1 1 2 2 2 1 1 1 1 1 1 3 1 1 1 3 1 3 3 1 1 2 1 1 1 1 1 2 1 1 1 4 1 1 3 3 2 1 1 1 1 1 2 2 1 3 1 1 1 2 4 1 1 2 5 2 1 1 2 1 1 1 2 3 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 2 2 3 1 7 3 1 3 1 2 1 2 1\n49 10", "output": "60" }, { "input": "100\n75 62 31 96 62 76 93 96 72 67 88 35 67 34 60 56 95 86 82 48 64 61 74 100 56 98 76 98 78 55 53 10 12 78 58 45 86 90 93 77 69 73 88 66 92 88 33 50 95 69 89 12 93 57 93 89 59 53 71 86 15 13 61 93 24 100 58 76 46 95 76 82 50 20 79 38 5 72 99 81 55 90 90 65 85 44 63 39 6 34 98 72 88 30 59 73 84 61 25 67\n86 25", "output": "2523" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n1 51", "output": "5000" }, { "input": "4\n1 1 1 1\n2 4", "output": "2" }, { "input": "4\n1 1 2 1\n2 4", "output": "2" } ]
1,631,850,157
2,147,483,647
Python 3
OK
TESTS
23
124
6,758,400
n = int(input()) a = list(map(int, input().split())) s, t = sorted(map(int, input().split())) d = sum(a[s - 1 : t - 1]) print(min(d, sum(a) - d))
Title: Circle Line Time Limit: None seconds Memory Limit: None megabytes Problem Description: The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations: - *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station. The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d**i*<=≤<=100) — the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=≤<=*s*,<=*t*<=≤<=*n*) — the numbers of stations, between which you need to find the shortest distance. These numbers can be the same. The numbers in the lines are separated by single spaces. Output Specification: Print a single number — the length of the shortest path between stations number *s* and *t*. Demo Input: ['4\n2 3 4 9\n1 3\n', '4\n5 8 2 100\n4 1\n', '3\n1 1 1\n3 1\n', '3\n31 41 59\n1 1\n'] Demo Output: ['5\n', '15\n', '1\n', '0\n'] Note: In the first sample the length of path 1 → 2 → 3 equals 5, the length of path 1 → 4 → 3 equals 13. In the second sample the length of path 4 → 1 is 100, the length of path 4 → 3 → 2 → 1 is 15. In the third sample the length of path 3 → 1 is 1, the length of path 3 → 2 → 1 is 2. In the fourth sample the numbers of stations are the same, so the shortest distance equals 0.
```python n = int(input()) a = list(map(int, input().split())) s, t = sorted(map(int, input().split())) d = sum(a[s - 1 : t - 1]) print(min(d, sum(a) - d)) ```
3
989
A
A Blend of Springtime
PROGRAMMING
900
[ "implementation", "strings" ]
null
null
"What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone." "But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic. The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty. When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible. You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order.
The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively.
Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise. You can print each letter in any case (upper or lower).
[ ".BAC.\n", "AA..CB\n" ]
[ "Yes\n", "No\n" ]
In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it. In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell.
500
[ { "input": ".BAC.", "output": "Yes" }, { "input": "AA..CB", "output": "No" }, { "input": ".", "output": "No" }, { "input": "ACB.AAAAAA", "output": "Yes" }, { "input": "B.BC.BBBCA", "output": "Yes" }, { "input": "BA..CAB..B", "output": "Yes" }, { "input": "CACCBAA.BC", "output": "Yes" }, { "input": ".CAACCBBA.CBB.AC..BABCCBCCB..B.BC..CBC.CA.CC.C.CC.B.A.CC.BBCCBB..ACAACAC.CBCCB.AABAAC.CBCC.BA..CCBC.", "output": "Yes" }, { "input": "A", "output": "No" }, { "input": "..", "output": "No" }, { "input": "BC", "output": "No" }, { "input": "CAB", "output": "Yes" }, { "input": "A.CB", "output": "No" }, { "input": "B.ACAA.CA..CBCBBAA.B.CCBCB.CAC.ABC...BC.BCCC.BC.CB", "output": "Yes" }, { "input": "B.B...CC.B..CCCB.CB..CBCB..CBCC.CCBC.B.CB..CA.C.C.", "output": "No" }, { "input": "AA.CBAABABCCC..B..B.ABBABAB.B.B.CCA..CB.B...A..CBC", "output": "Yes" }, { "input": "CA.ABB.CC.B.C.BBBABAAB.BBBAACACAAA.C.AACA.AAC.C.BCCB.CCBC.C..CCACA.CBCCB.CCAABAAB.AACAA..A.AAA.", "output": "No" }, { "input": "CBC...AC.BBBB.BBABABA.CAAACC.AAABB..A.BA..BC.CBBBC.BBBBCCCAA.ACCBB.AB.C.BA..CC..AAAC...AB.A.AAABBA.A", "output": "No" }, { "input": "CC.AAAC.BA.BBB.AABABBCCAA.A.CBCCB.B.BC.ABCBCBBAA.CACA.CCCA.CB.CCB.A.BCCCB...C.A.BCCBC..B.ABABB.C.BCB", "output": "Yes" }, { "input": "CCC..A..CACACCA.CA.ABAAB.BBA..C.AAA...ACB.ACA.CA.B.AB.A..C.BC.BC.A.C....ABBCCACCCBCC.BBBAA.ACCACB.BB", "output": "Yes" }, { "input": "BC.ABACAACC..AC.A..CCCAABBCCACAC.AA.CC.BAABABABBCBB.BA..C.C.C.A.BBA.C..BC.ACACCC.AAAACCCCC.AAC.AC.AB", "output": "Yes" }, { "input": "ACAC.BAA.C..CAAC..ABBAACC..BAA...CC...ACCBBCA.BAABABAACCAC.A.BBCACCC..BCB.BABAAAACCBCB.BCAABBC.C.BBB", "output": "Yes" }, { "input": "CCAC.BCBC.A.ABBAB.C.C.BC.CCABBCBCCBC..B.AA.C.BC...B..BAA.ACCCCBBB.AAAACA.CAACCB.CCB.CC.BCCAB.BBBBABB", "output": "Yes" }, { "input": ".AACAA.AAAAC.BBBB.BC...CCACCACAAA.A..CCA..BCC.AB.ABAAB..AABA...B.C.CBAB.BAAB.A.C.AAC.BBBA.ACAAA.BB.C", "output": "Yes" }, { "input": "CC.ACCC.BCCCCAA.BBAACB.ABABAAAA.A.CBAB.CBACBBC..C.CA.AAA..AA..ABBB.A.C..CBBCAAACC.B..CC.AC..CAABACB.", "output": "Yes" }, { "input": ".BAB.", "output": "No" }, { "input": "BBBBBBBBB", "output": "No" }, { "input": "..AAC..", "output": "No" }, { "input": ".AAABBBCCC.", "output": "No" }, { "input": "AAABC", "output": "Yes" }, { "input": "BBB", "output": "No" }, { "input": "AAAAABABAAAAA", "output": "No" }, { "input": "AABBCC", "output": "No" }, { "input": ".BA", "output": "No" }, { "input": "CAAAAB", "output": "No" } ]
1,545,098,148
648
Python 3
OK
TESTS
37
109
0
x = input() if 'ABC' in x: print('Yes') elif 'ACB' in x: print('Yes') elif 'BAC' in x: print('Yes') elif 'BCA' in x: print('Yes') elif 'CAB' in x: print('Yes') elif 'CBA' in x: print('Yes') else: print('No')
Title: A Blend of Springtime Time Limit: None seconds Memory Limit: None megabytes Problem Description: "What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone." "But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic. The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty. When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible. You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order. Input Specification: The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively. Output Specification: Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['.BAC.\n', 'AA..CB\n'] Demo Output: ['Yes\n', 'No\n'] Note: In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it. In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell.
```python x = input() if 'ABC' in x: print('Yes') elif 'ACB' in x: print('Yes') elif 'BAC' in x: print('Yes') elif 'BCA' in x: print('Yes') elif 'CAB' in x: print('Yes') elif 'CBA' in x: print('Yes') else: print('No') ```
3
887
A
Div. 64
PROGRAMMING
1,000
[ "implementation" ]
null
null
Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills. Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system.
In the only line given a non-empty binary string *s* with length up to 100.
Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise.
[ "100010001\n", "100\n" ]
[ "yes", "no" ]
In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system. You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system)
500
[ { "input": "100010001", "output": "yes" }, { "input": "100", "output": "no" }, { "input": "0000001000000", "output": "yes" }, { "input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "no" }, { "input": "1111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111111111", "output": "no" }, { "input": "0111111101111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "no" }, { "input": "1111011111111111111111111111110111110111111111111111111111011111111111111110111111111111111111111111", "output": "no" }, { "input": "1111111111101111111111111111111111111011111111111111111111111101111011111101111111111101111111111111", "output": "yes" }, { "input": "0110111111111111111111011111111110110111110111111111111111111111111111111111111110111111111111111111", "output": "yes" }, { "input": "1100110001111011001101101000001110111110011110111110010100011000100101000010010111100000010001001101", "output": "yes" }, { "input": "000000", "output": "no" }, { "input": "0001000", "output": "no" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "no" }, { "input": "1000000", "output": "yes" }, { "input": "0", "output": "no" }, { "input": "1", "output": "no" }, { "input": "10000000000", "output": "yes" }, { "input": "0000000000", "output": "no" }, { "input": "0010000", "output": "no" }, { "input": "000000011", "output": "no" }, { "input": "000000000", "output": "no" }, { "input": "00000000", "output": "no" }, { "input": "000000000011", "output": "no" }, { "input": "0000000", "output": "no" }, { "input": "00000000011", "output": "no" }, { "input": "000000001", "output": "no" }, { "input": "000000000000000000000000000", "output": "no" }, { "input": "0000001", "output": "no" }, { "input": "00000001", "output": "no" }, { "input": "00000000100", "output": "no" }, { "input": "00000000000000000000", "output": "no" }, { "input": "0000000000000000000", "output": "no" }, { "input": "00001000", "output": "no" }, { "input": "0000000000010", "output": "no" }, { "input": "000000000010", "output": "no" }, { "input": "000000000000010", "output": "no" }, { "input": "0100000", "output": "no" }, { "input": "00010000", "output": "no" }, { "input": "00000000000000000", "output": "no" }, { "input": "00000000000", "output": "no" }, { "input": "000001000", "output": "no" }, { "input": "000000000000", "output": "no" }, { "input": "100000000000000", "output": "yes" }, { "input": "000010000", "output": "no" }, { "input": "00000100", "output": "no" }, { "input": "0001100000", "output": "no" }, { "input": "000000000000000000000000001", "output": "no" }, { "input": "000000100", "output": "no" }, { "input": "0000000000001111111111", "output": "no" }, { "input": "00000010", "output": "no" }, { "input": "0001110000", "output": "no" }, { "input": "0000000000000000000000", "output": "no" }, { "input": "000000010010", "output": "no" }, { "input": "0000100", "output": "no" }, { "input": "0000000001", "output": "no" }, { "input": "000000111", "output": "no" }, { "input": "0000000000000", "output": "no" }, { "input": "000000000000000000", "output": "no" }, { "input": "0000000000000000000000000", "output": "no" }, { "input": "000000000000000", "output": "no" }, { "input": "0010000000000100", "output": "yes" }, { "input": "0000001000", "output": "no" }, { "input": "00000000000000000001", "output": "no" }, { "input": "100000000", "output": "yes" }, { "input": "000000000001", "output": "no" }, { "input": "0000011001", "output": "no" }, { "input": "000", "output": "no" }, { "input": "000000000000000000000", "output": "no" }, { "input": "0000000000011", "output": "no" }, { "input": "0000000000000000", "output": "no" }, { "input": "00000000000000001", "output": "no" }, { "input": "00000000000000", "output": "no" }, { "input": "0000000000000000010", "output": "no" }, { "input": "00000000000000000000000000000000000000000000000000000000", "output": "no" }, { "input": "000011000", "output": "no" }, { "input": "00000011", "output": "no" }, { "input": "0000000000001100", "output": "no" }, { "input": "00000", "output": "no" }, { "input": "000000000000000000000000000111111111111111", "output": "no" }, { "input": "000000010", "output": "no" }, { "input": "00000000111", "output": "no" }, { "input": "000000000000001", "output": "no" }, { "input": "0000000000000011111111111111111", "output": "no" }, { "input": "0000000010", "output": "no" }, { "input": "0000000000000000000000000000000000000000000000000", "output": "no" }, { "input": "00000000010", "output": "no" }, { "input": "101000000000", "output": "yes" }, { "input": "00100000", "output": "no" }, { "input": "00000000000001", "output": "no" }, { "input": "0000000000100", "output": "no" }, { "input": "0000", "output": "no" }, { "input": "00000000000111", "output": "no" }, { "input": "0000000000000011", "output": "no" }, { "input": "0000000000000000000000000000000000000000", "output": "no" }, { "input": "0000000000000010", "output": "no" }, { "input": "0010101010", "output": "no" }, { "input": "0000000000000001", "output": "no" }, { "input": "1010101", "output": "no" } ]
1,513,475,377
2,147,483,647
Python 3
OK
TESTS
98
77
5,529,600
a = input() sz = len(a) flg = 0 cnt = 0 for i in range (0,sz): k = a[i] if(int(k)==1) : flg = 1 continue if(flg==1 and int(k)==0) : cnt+=1 if(cnt>=6) : print("yes") else : print("no")
Title: Div. 64 Time Limit: None seconds Memory Limit: None megabytes Problem Description: Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills. Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system. Input Specification: In the only line given a non-empty binary string *s* with length up to 100. Output Specification: Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise. Demo Input: ['100010001\n', '100\n'] Demo Output: ['yes', 'no'] Note: In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system. You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system)
```python a = input() sz = len(a) flg = 0 cnt = 0 for i in range (0,sz): k = a[i] if(int(k)==1) : flg = 1 continue if(flg==1 and int(k)==0) : cnt+=1 if(cnt>=6) : print("yes") else : print("no") ```
3
801
B
Valued Keys
PROGRAMMING
900
[ "constructive algorithms", "greedy", "strings" ]
null
null
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length. The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2. For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel". You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
The first line of input contains the string *x*. The second line of input contains the string *y*. Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1. Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
[ "ab\naa\n", "nzwzl\nniwel\n", "ab\nba\n" ]
[ "ba\n", "xiyez\n", "-1\n" ]
The first case is from the statement. Another solution for the second case is "zizez" There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) =  "ba".
1,000
[ { "input": "ab\naa", "output": "ba" }, { "input": "nzwzl\nniwel", "output": "xiyez" }, { "input": "ab\nba", "output": "-1" }, { "input": "r\nl", "output": "l" }, { "input": "d\ny", "output": "-1" }, { "input": "yvowz\ncajav", "output": "cajav" }, { "input": "lwzjp\ninjit", "output": "-1" }, { "input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm", "output": "eodnlemiicdedmkcgavqbnqmm" }, { "input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs", "output": "-1" }, { "input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf", "output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf" }, { "input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen", "output": "-1" }, { "input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb", "output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb" }, { "input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym", "output": "-1" }, { "input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib", "output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib" }, { "input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew", "output": "-1" }, { "input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv", "output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv" }, { "input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns", "output": "-1" }, { "input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf", "output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf" }, { "input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp", "output": "-1" }, { "input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp", "output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp" }, { "input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej", "output": "-1" }, { "input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe", "output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe" }, { "input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang", "output": "-1" }, { "input": "ftfr\nftfr", "output": "ftfr" }, { "input": "ftr\nftr", "output": "ftr" }, { "input": "shftr\nshftr", "output": "shftr" }, { "input": "vkvkkv\nvkvkkv", "output": "vkvkkv" }, { "input": "ftrd\nftrd", "output": "ftrd" }, { "input": "fztr\nfztr", "output": "fztr" }, { "input": "frtr\nfrtr", "output": "frtr" }, { "input": "shdftr\nshdftr", "output": "shdftr" }, { "input": "zzz\nzzz", "output": "zzz" }, { "input": "shtr\nshtr", "output": "shtr" }, { "input": "aaaaa\nzzzzz", "output": "-1" }, { "input": "efr\nefr", "output": "efr" } ]
1,660,142,869
2,147,483,647
Python 3
OK
TESTS
35
46
0
a=input() b=input() for i in range(len(a)): if(ord(a[i]) <ord(b[i])): print('-1') break else: print(b)
Title: Valued Keys Time Limit: None seconds Memory Limit: None megabytes Problem Description: You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length. The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2. For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel". You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists. Input Specification: The first line of input contains the string *x*. The second line of input contains the string *y*. Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100. Output Specification: If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1. Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters. Demo Input: ['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n'] Demo Output: ['ba\n', 'xiyez\n', '-1\n'] Note: The first case is from the statement. Another solution for the second case is "zizez" There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) =  "ba".
```python a=input() b=input() for i in range(len(a)): if(ord(a[i]) <ord(b[i])): print('-1') break else: print(b) ```
3
859
B
Lazy Security Guard
PROGRAMMING
1,000
[ "brute force", "geometry", "math" ]
null
null
Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite.
Input will consist of a single integer *N* (1<=≤<=*N*<=≤<=106), the number of city blocks that must be enclosed by the route.
Print the minimum perimeter that can be achieved.
[ "4\n", "11\n", "22\n" ]
[ "8\n", "14\n", "20\n" ]
Here are some possible shapes for the examples: <img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/>
750
[ { "input": "4", "output": "8" }, { "input": "11", "output": "14" }, { "input": "22", "output": "20" }, { "input": "3", "output": "8" }, { "input": "1024", "output": "128" }, { "input": "101", "output": "42" }, { "input": "30", "output": "22" }, { "input": "1000000", "output": "4000" }, { "input": "1", "output": "4" }, { "input": "2", "output": "6" }, { "input": "5", "output": "10" }, { "input": "6", "output": "10" }, { "input": "7", "output": "12" }, { "input": "8", "output": "12" }, { "input": "9", "output": "12" }, { "input": "10", "output": "14" }, { "input": "999000", "output": "3998" }, { "input": "999001", "output": "4000" }, { "input": "999999", "output": "4000" }, { "input": "933206", "output": "3866" }, { "input": "718351", "output": "3392" }, { "input": "607443", "output": "3118" }, { "input": "347887", "output": "2360" }, { "input": "246206", "output": "1986" }, { "input": "151375", "output": "1558" }, { "input": "12639", "output": "450" }, { "input": "3751", "output": "246" }, { "input": "3607", "output": "242" }, { "input": "124", "output": "46" }, { "input": "64", "output": "32" }, { "input": "31", "output": "24" }, { "input": "23", "output": "20" }, { "input": "15", "output": "16" }, { "input": "19", "output": "18" }, { "input": "59637", "output": "978" } ]
1,516,134,013
2,147,483,647
Python 3
OK
TESTS
35
62
5,632,000
from math import sqrt n = int(input()) side_of_s = int(sqrt(n)) are_of_s = side_of_s * side_of_s rest = n - are_of_s output = side_of_s * 4 if rest > 0: output += 2 rest -= side_of_s if rest > 0: output += 2 print(output)
Title: Lazy Security Guard Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite. Input Specification: Input will consist of a single integer *N* (1<=≤<=*N*<=≤<=106), the number of city blocks that must be enclosed by the route. Output Specification: Print the minimum perimeter that can be achieved. Demo Input: ['4\n', '11\n', '22\n'] Demo Output: ['8\n', '14\n', '20\n'] Note: Here are some possible shapes for the examples: <img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python from math import sqrt n = int(input()) side_of_s = int(sqrt(n)) are_of_s = side_of_s * side_of_s rest = n - are_of_s output = side_of_s * 4 if rest > 0: output += 2 rest -= side_of_s if rest > 0: output += 2 print(output) ```
3
340
A
The Wall
PROGRAMMING
1,200
[ "math" ]
null
null
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on. Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink. After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
[ "2 3 6 18\n" ]
[ "3" ]
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
500
[ { "input": "2 3 6 18", "output": "3" }, { "input": "4 6 20 201", "output": "15" }, { "input": "15 27 100 10000", "output": "74" }, { "input": "105 60 3456 78910", "output": "179" }, { "input": "1 1 1000 100000", "output": "99001" }, { "input": "3 2 5 5", "output": "0" }, { "input": "555 777 1 1000000", "output": "257" }, { "input": "1000 1000 1 32323", "output": "32" }, { "input": "45 125 93451125 100000000", "output": "5821" }, { "input": "101 171 1 1000000000", "output": "57900" }, { "input": "165 255 69696 1000000000", "output": "356482" }, { "input": "555 777 666013 1000000000", "output": "257229" }, { "input": "23 46 123321 900000000", "output": "19562537" }, { "input": "321 123 15 1000000", "output": "75" }, { "input": "819 1000 9532 152901000", "output": "186" }, { "input": "819 1000 10000 1000000", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "1 2 2 1000003", "output": "500001" }, { "input": "1 1 1 1000000000", "output": "1000000000" }, { "input": "10 15 69 195610342", "output": "6520342" }, { "input": "2 1 1 1000000000", "output": "500000000" }, { "input": "1000 1000 1 20", "output": "0" }, { "input": "1 1 1 2000000000", "output": "2000000000" }, { "input": "1 2 1 2000000000", "output": "1000000000" }, { "input": "2 1 1 2000000000", "output": "1000000000" }, { "input": "2 3 1 1000000000", "output": "166666666" }, { "input": "2 3 1 2000000000", "output": "333333333" }, { "input": "3 7 1 1000000000", "output": "47619047" }, { "input": "1 1 1000000000 2000000000", "output": "1000000001" }, { "input": "2 2 1 2000000000", "output": "1000000000" }, { "input": "1 1 2 2000000000", "output": "1999999999" }, { "input": "3 2 1 2000000000", "output": "333333333" }, { "input": "1 1 2000000000 2000000000", "output": "1" }, { "input": "2 3 7 7", "output": "0" }, { "input": "3 3 3 7", "output": "2" } ]
1,378,350,449
2,147,483,647
Python 3
OK
TESTS
35
124
0
import sys _gcd = lambda s, m, n : m if n==0 else _gcd(s, n, m % n) gcd = lambda m, n : _gcd(_gcd, m, n) lcm = lambda m, n : m // gcd(m, n) * n (x, y, a, b) = list(map(int, input().split())) z = lcm(x, y) print(b//z-(a-1)//z)
Title: The Wall Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on. Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink. After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question. Input Specification: The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*). Output Specification: Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink. Demo Input: ['2 3 6 18\n'] Demo Output: ['3'] Note: Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
```python import sys _gcd = lambda s, m, n : m if n==0 else _gcd(s, n, m % n) gcd = lambda m, n : _gcd(_gcd, m, n) lcm = lambda m, n : m // gcd(m, n) * n (x, y, a, b) = list(map(int, input().split())) z = lcm(x, y) print(b//z-(a-1)//z) ```
3
519
A
A and B and Chess
PROGRAMMING
900
[ "implementation" ]
null
null
A and B are preparing themselves for programming contests. To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger. For each chess piece we know its weight: - the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position. The player's weight equals to the sum of weights of all his pieces on the board. As A doesn't like counting, he asked you to help him determine which player has the larger position weight.
The input contains eight lines, eight characters each — the board's description. The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters. The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'. The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively. An empty square of the board is marked as '.' (a dot). It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on.
Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal.
[ "...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n", "rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n", "rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n" ]
[ "White\n", "Draw\n", "Black\n" ]
In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5. In the second test sample the weights of the positions of the black and the white pieces are equal to 39. In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16.
500
[ { "input": "rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR", "output": "Draw" }, { "input": "....bQ.K\n.B......\n.....P..\n........\n........\n........\n...N.P..\n.....R..", "output": "White" }, { "input": "b....p..\nR.......\n.pP...b.\npp......\nq.PPNpPR\n..K..rNn\nP.....p.\n...Q..B.", "output": "White" }, { "input": "...Nn...\n........\n........\n........\n.R....b.\n........\n........\n......p.", "output": "White" }, { "input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq", "output": "Black" }, { "input": "QQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ", "output": "White" }, { "input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ", "output": "Draw" }, { "input": "QQQQQQQQ\nQQQQQQQQ\n........\n........\n........\n........\nrrrrrr..\nrrrrrrrr", "output": "White" }, { "input": "........\n........\n........\n........\n........\n........\n........\n.......n", "output": "Black" }, { "input": "........\n...b....\n........\n........\n........\n........\n........\n.......K", "output": "Black" }, { "input": "........\n........\n........\n........\n........\n........\n........\n......Kp", "output": "Black" }, { "input": "........\n........\n........\n........\n........\n........\n........\n.......Q", "output": "White" }, { "input": "........\n........\n........\n........\n........\n........\n........\n......Bp", "output": "White" }, { "input": "........\n........\n........\n........\n........\n........\n........\nkkkkkB..", "output": "White" }, { "input": "QqPQNN.Q\n.qBbr.qB\np.RKBpNK\nPknBr.nq\nKqKRNKKk\n.BqPqkb.\nPBNPr.rk\nBpBKrPRR", "output": "Black" }, { "input": "........\n........\n........\n........\n........\n........\n........\n.......K", "output": "Draw" } ]
1,646,975,898
2,147,483,647
Python 3
OK
TESTS
65
46
0
white={"Q","R","B","N","P"} black={"q","r","b","n","p"} wval={"Q":9,"R":5,"B":3,"N":3,"P":1} bval={"q":9,"r":5,"b":3,"n":3,"p":1} s_black=0 s_white=0 for inhg in range(0,8): s=input() for i in range(0,8): j=s[i] if s[i]in white: s_white+=wval[j] if s[i] in black: s_black+=bval[j] if s_black > s_white: print("Black") elif s_black == s_white: print("Draw") else: print("White")
Title: A and B and Chess Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger. For each chess piece we know its weight: - the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position. The player's weight equals to the sum of weights of all his pieces on the board. As A doesn't like counting, he asked you to help him determine which player has the larger position weight. Input Specification: The input contains eight lines, eight characters each — the board's description. The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters. The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'. The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively. An empty square of the board is marked as '.' (a dot). It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on. Output Specification: Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal. Demo Input: ['...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n', 'rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n', 'rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n'] Demo Output: ['White\n', 'Draw\n', 'Black\n'] Note: In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5. In the second test sample the weights of the positions of the black and the white pieces are equal to 39. In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16.
```python white={"Q","R","B","N","P"} black={"q","r","b","n","p"} wval={"Q":9,"R":5,"B":3,"N":3,"P":1} bval={"q":9,"r":5,"b":3,"n":3,"p":1} s_black=0 s_white=0 for inhg in range(0,8): s=input() for i in range(0,8): j=s[i] if s[i]in white: s_white+=wval[j] if s[i] in black: s_black+=bval[j] if s_black > s_white: print("Black") elif s_black == s_white: print("Draw") else: print("White") ```
3
353
A
Domino
PROGRAMMING
1,200
[ "implementation", "math" ]
null
null
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
[ "2\n4 2\n6 4\n", "1\n2 3\n", "3\n1 4\n2 3\n4 4\n" ]
[ "0\n", "-1\n", "1\n" ]
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
500
[ { "input": "2\n4 2\n6 4", "output": "0" }, { "input": "1\n2 3", "output": "-1" }, { "input": "3\n1 4\n2 3\n4 4", "output": "1" }, { "input": "5\n5 4\n5 4\n1 5\n5 5\n3 3", "output": "1" }, { "input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4", "output": "-1" }, { "input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4", "output": "-1" }, { "input": "1\n2 4", "output": "0" }, { "input": "1\n1 1", "output": "-1" }, { "input": "1\n1 2", "output": "-1" }, { "input": "2\n1 1\n3 3", "output": "0" }, { "input": "2\n1 1\n2 2", "output": "-1" }, { "input": "2\n1 1\n1 2", "output": "-1" }, { "input": "5\n1 2\n6 6\n1 1\n3 3\n6 1", "output": "1" }, { "input": "5\n5 4\n2 6\n6 2\n1 4\n6 2", "output": "0" }, { "input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1", "output": "0" }, { "input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5", "output": "-1" }, { "input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1", "output": "1" }, { "input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4", "output": "-1" }, { "input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2", "output": "0" }, { "input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5", "output": "-1" }, { "input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4", "output": "-1" }, { "input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4", "output": "-1" }, { "input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6", "output": "1" }, { "input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5", "output": "1" }, { "input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3", "output": "1" }, { "input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5", "output": "1" }, { "input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5", "output": "-1" }, { "input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6", "output": "-1" }, { "input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1", "output": "-1" }, { "input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6", "output": "-1" }, { "input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4", "output": "1" }, { "input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6", "output": "-1" }, { "input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2", "output": "0" }, { "input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3", "output": "-1" }, { "input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3", "output": "-1" }, { "input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4", "output": "-1" }, { "input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5", "output": "1" }, { "input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1", "output": "1" }, { "input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5", "output": "-1" }, { "input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2", "output": "0" }, { "input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1", "output": "0" }, { "input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2", "output": "1" }, { "input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2", "output": "0" }, { "input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2", "output": "-1" }, { "input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5", "output": "0" }, { "input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1", "output": "-1" }, { "input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5", "output": "-1" }, { "input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3", "output": "-1" }, { "input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5", "output": "0" }, { "input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4", "output": "-1" }, { "input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2", "output": "-1" }, { "input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2", "output": "1" }, { "input": "1\n2 2", "output": "0" }, { "input": "3\n2 4\n6 6\n3 3", "output": "-1" }, { "input": "2\n3 6\n4 1", "output": "1" }, { "input": "3\n1 1\n1 1\n3 3", "output": "-1" }, { "input": "3\n2 3\n1 1\n2 3", "output": "1" }, { "input": "3\n2 2\n2 1\n1 2", "output": "1" }, { "input": "3\n1 1\n1 1\n1 1", "output": "-1" } ]
1,611,325,543
2,147,483,647
PyPy 3
OK
TESTS
59
248
409,600
from math import * from collections import * from sys import * t=stdin.readline p=stdout.write def GI(): return map(int, t().strip().split()) def GS(): return map(str, t().strip().split()) def GL(): return list(map(int, t().strip().split())) def SL(): return list(map(str, t().strip().split())) c1,c2,o=0,0,0 o1,o2=0,0 n=int(t()) for _ in range(n): x,y=GI() if (x%2==0 and y%2==1) or (x%2==1 and y%2==0): o+=1 c1+=x;c2+=y if c1%2==0 and c2%2==0: p('0') elif (c1%2==0 and c2%2==1) or (c1%2==1 and c2%2==0): p('-1') else: if o>0: p('1') else: p('-1')
Title: Domino Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half. Output Specification: Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1. Demo Input: ['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
```python from math import * from collections import * from sys import * t=stdin.readline p=stdout.write def GI(): return map(int, t().strip().split()) def GS(): return map(str, t().strip().split()) def GL(): return list(map(int, t().strip().split())) def SL(): return list(map(str, t().strip().split())) c1,c2,o=0,0,0 o1,o2=0,0 n=int(t()) for _ in range(n): x,y=GI() if (x%2==0 and y%2==1) or (x%2==1 and y%2==0): o+=1 c1+=x;c2+=y if c1%2==0 and c2%2==0: p('0') elif (c1%2==0 and c2%2==1) or (c1%2==1 and c2%2==0): p('-1') else: if o>0: p('1') else: p('-1') ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,674,096,830
2,147,483,647
Python 3
OK
TESTS
31
92
0
n=int(input()) q=[] for _ in range (n): q.append(list(map(int,input().split()))) k=0 a=q for i in q: for j in a: if j!=i: if i[0]==j[1]: k+=1 print(k)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python n=int(input()) q=[] for _ in range (n): q.append(list(map(int,input().split()))) k=0 a=q for i in q: for j in a: if j!=i: if i[0]==j[1]: k+=1 print(k) ```
3
884
B
Japanese Crosswords Strike Back
PROGRAMMING
1,100
[ "implementation" ]
null
null
A one-dimensional Japanese crossword can be represented as a binary string of length *x*. An encoding of this crossword is an array *a* of size *n*, where *n* is the number of segments formed completely of 1's, and *a**i* is the length of *i*-th segment. No two segments touch or intersect. For example: - If *x*<==<=6 and the crossword is 111011, then its encoding is an array {3,<=2}; - If *x*<==<=8 and the crossword is 01101010, then its encoding is an array {2,<=1,<=1}; - If *x*<==<=5 and the crossword is 11111, then its encoding is an array {5}; - If *x*<==<=5 and the crossword is 00000, then its encoding is an empty array. Mishka wants to create a new one-dimensional Japanese crossword. He has already picked the length and the encoding for this crossword. And now he needs to check if there is exactly one crossword such that its length and encoding are equal to the length and encoding he picked. Help him to check it!
The first line contains two integer numbers *n* and *x* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*x*<=≤<=109) — the number of elements in the encoding and the length of the crossword Mishka picked. The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10000) — the encoding.
Print YES if there exists exaclty one crossword with chosen length and encoding. Otherwise, print NO.
[ "2 4\n1 3\n", "3 10\n3 3 2\n", "2 10\n1 3\n" ]
[ "NO\n", "YES\n", "NO\n" ]
none
0
[ { "input": "2 4\n1 3", "output": "NO" }, { "input": "3 10\n3 3 2", "output": "YES" }, { "input": "2 10\n1 3", "output": "NO" }, { "input": "1 1\n1", "output": "YES" }, { "input": "1 10\n10", "output": "YES" }, { "input": "1 10000\n10000", "output": "YES" }, { "input": "10 1\n5 78 3 87 4 9 5 8 9 1235", "output": "NO" }, { "input": "3 12\n3 3 3", "output": "NO" }, { "input": "3 9\n2 2 2", "output": "NO" }, { "input": "2 5\n1 1", "output": "NO" }, { "input": "1 2\n1", "output": "NO" }, { "input": "3 13\n3 3 3", "output": "NO" }, { "input": "3 6\n1 1 1", "output": "NO" }, { "input": "1 6\n5", "output": "NO" }, { "input": "3 11\n3 3 2", "output": "NO" }, { "input": "2 6\n1 3", "output": "NO" }, { "input": "3 10\n2 2 2", "output": "NO" }, { "input": "3 8\n2 1 1", "output": "NO" }, { "input": "1 5\n2", "output": "NO" }, { "input": "1 3\n1", "output": "NO" }, { "input": "5 5\n1 1 1 1 1", "output": "NO" }, { "input": "2 10\n4 4", "output": "NO" }, { "input": "2 8\n2 3", "output": "NO" }, { "input": "2 4\n1 1", "output": "NO" }, { "input": "3 10\n1 2 4", "output": "NO" }, { "input": "3 10\n2 1 3", "output": "NO" }, { "input": "2 6\n1 2", "output": "NO" }, { "input": "3 4\n1 1 1", "output": "NO" }, { "input": "3 11\n1 2 4", "output": "NO" }, { "input": "3 12\n3 3 2", "output": "NO" }, { "input": "4 9\n1 1 1 1", "output": "NO" }, { "input": "1 10\n9", "output": "NO" }, { "input": "1 7\n5", "output": "NO" }, { "input": "2 5\n1 2", "output": "NO" }, { "input": "3 8\n1 1 2", "output": "NO" }, { "input": "3 7\n1 1 1", "output": "NO" }, { "input": "1 10\n1", "output": "NO" }, { "input": "3 10\n2 3 4", "output": "NO" }, { "input": "3 9\n1 2 3", "output": "NO" }, { "input": "3 9\n3 3 2", "output": "NO" }, { "input": "3 6\n3 3 2", "output": "NO" }, { "input": "1 1\n3", "output": "NO" }, { "input": "1 3\n2", "output": "NO" }, { "input": "3 10\n3 3 3", "output": "NO" }, { "input": "3 5\n1 1 1", "output": "YES" }, { "input": "2 1\n100 100", "output": "NO" }, { "input": "3 3\n3 3 3", "output": "NO" }, { "input": "4 17\n3 3 9 1", "output": "NO" }, { "input": "4 1660\n1505 13 37 100", "output": "NO" }, { "input": "3 5\n3 3 2", "output": "NO" }, { "input": "4 10\n3 3 2 5", "output": "NO" }, { "input": "5 5\n5 5 5 5 5", "output": "NO" }, { "input": "1 1\n2", "output": "NO" }, { "input": "5 10\n1 2 2 4 5", "output": "NO" }, { "input": "2 1\n1 1", "output": "NO" } ]
1,593,062,201
341
PyPy 3
OK
TESTS
66
187
28,979,200
import sys import math #import random #sys.setrecursionlimit(1000000) input = sys.stdin.readline ############ ---- USER DEFINED INPUT FUNCTIONS ---- ############ def inp(): return(int(input())) def inara(): return(list(map(int,input().split()))) def insr(): s = input() return(list(s[:len(s) - 1])) def invr(): return(map(int,input().split())) ################################################################ ############ ---- THE ACTUAL CODE STARTS BELOW ---- ############ n,x=invr() ara=inara() tot=n-1 for num in ara: tot+=num if tot==x: print("YES") else: print("NO")
Title: Japanese Crosswords Strike Back Time Limit: None seconds Memory Limit: None megabytes Problem Description: A one-dimensional Japanese crossword can be represented as a binary string of length *x*. An encoding of this crossword is an array *a* of size *n*, where *n* is the number of segments formed completely of 1's, and *a**i* is the length of *i*-th segment. No two segments touch or intersect. For example: - If *x*<==<=6 and the crossword is 111011, then its encoding is an array {3,<=2}; - If *x*<==<=8 and the crossword is 01101010, then its encoding is an array {2,<=1,<=1}; - If *x*<==<=5 and the crossword is 11111, then its encoding is an array {5}; - If *x*<==<=5 and the crossword is 00000, then its encoding is an empty array. Mishka wants to create a new one-dimensional Japanese crossword. He has already picked the length and the encoding for this crossword. And now he needs to check if there is exactly one crossword such that its length and encoding are equal to the length and encoding he picked. Help him to check it! Input Specification: The first line contains two integer numbers *n* and *x* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*x*<=≤<=109) — the number of elements in the encoding and the length of the crossword Mishka picked. The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10000) — the encoding. Output Specification: Print YES if there exists exaclty one crossword with chosen length and encoding. Otherwise, print NO. Demo Input: ['2 4\n1 3\n', '3 10\n3 3 2\n', '2 10\n1 3\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: none
```python import sys import math #import random #sys.setrecursionlimit(1000000) input = sys.stdin.readline ############ ---- USER DEFINED INPUT FUNCTIONS ---- ############ def inp(): return(int(input())) def inara(): return(list(map(int,input().split()))) def insr(): s = input() return(list(s[:len(s) - 1])) def invr(): return(map(int,input().split())) ################################################################ ############ ---- THE ACTUAL CODE STARTS BELOW ---- ############ n,x=invr() ara=inara() tot=n-1 for num in ara: tot+=num if tot==x: print("YES") else: print("NO") ```
3
144
A
Arrival of the General
PROGRAMMING
800
[ "implementation" ]
null
null
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground. By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important. For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong. Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
[ "4\n33 44 11 22\n", "7\n10 10 58 31 63 40 76\n" ]
[ "2\n", "10\n" ]
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11). In the second sample the colonel may swap the soldiers in the following sequence: 1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
500
[ { "input": "4\n33 44 11 22", "output": "2" }, { "input": "7\n10 10 58 31 63 40 76", "output": "10" }, { "input": "2\n88 89", "output": "1" }, { "input": "5\n100 95 100 100 88", "output": "0" }, { "input": "7\n48 48 48 48 45 45 45", "output": "0" }, { "input": "10\n68 47 67 29 63 71 71 65 54 56", "output": "10" }, { "input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92", "output": "4" }, { "input": "3\n1 2 1", "output": "1" }, { "input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14", "output": "0" }, { "input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42", "output": "7" }, { "input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99", "output": "47" }, { "input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57", "output": "50" }, { "input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13", "output": "3" }, { "input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36", "output": "3" }, { "input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73", "output": "73" }, { "input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68", "output": "7" }, { "input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94", "output": "15" }, { "input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64", "output": "104" }, { "input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97", "output": "33" }, { "input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43", "output": "145" }, { "input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26", "output": "76" }, { "input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34", "output": "15" }, { "input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81", "output": "11" }, { "input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95", "output": "13" }, { "input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15", "output": "104" }, { "input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67", "output": "100" }, { "input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32", "output": "107" }, { "input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22", "output": "50" }, { "input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61", "output": "59" }, { "input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95", "output": "99" }, { "input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10", "output": "0" }, { "input": "3\n2 1 2", "output": "1" }, { "input": "2\n100 99", "output": "0" }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "197" }, { "input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87", "output": "0" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "3\n2 2 2", "output": "0" }, { "input": "3\n1 3 2", "output": "2" } ]
1,695,035,686
2,147,483,647
Python 3
OK
TESTS
39
92
0
n = int(input()) x = list(map(int, input().split())) y = max(x); z = min(x) a = x.index(y); x.pop(a); x.insert(0,y) x.reverse() b = x.index(z) print(a+b)
Title: Arrival of the General Time Limit: None seconds Memory Limit: None megabytes Problem Description: A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground. By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important. For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong. Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct. Input Specification: The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different. Output Specification: Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like. Demo Input: ['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n'] Demo Output: ['2\n', '10\n'] Note: In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11). In the second sample the colonel may swap the soldiers in the following sequence: 1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
```python n = int(input()) x = list(map(int, input().split())) y = max(x); z = min(x) a = x.index(y); x.pop(a); x.insert(0,y) x.reverse() b = x.index(z) print(a+b) ```
3
435
C
Cardiogram
PROGRAMMING
1,600
[ "implementation" ]
null
null
In this problem, your task is to use ASCII graphics to paint a cardiogram. A cardiogram is a polyline with the following corners: That is, a cardiogram is fully defined by a sequence of positive integers *a*1,<=*a*2,<=...,<=*a**n*. Your task is to paint a cardiogram by given sequence *a**i*.
The first line contains integer *n* (2<=≤<=*n*<=≤<=1000). The next line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). It is guaranteed that the sum of all *a**i* doesn't exceed 1000.
Print *max* |*y**i*<=-<=*y**j*| lines (where *y**k* is the *y* coordinate of the *k*-th point of the polyline), in each line print characters. Each character must equal either «<=/<=» (slash), « \ » (backslash), « » (space). The printed image must be the image of the given polyline. Please study the test samples for better understanding of how to print a cardiogram. Note that in this problem the checker checks your answer taking spaces into consideration. Do not print any extra characters. Remember that the wrong answer to the first pretest doesn't give you a penalty.
[ "5\n3 1 2 5 1\n", "3\n1 5 1\n" ]
[ "/ \\ \n  / \\ /  \\ \n  /  \\ \n /  \\ \n \\ / \n", "/ \\ \n \\ \n \\ \n \\ \n \\ / \n" ]
Due to the technical reasons the answers for the samples cannot be copied from the statement. We've attached two text documents with the answers below. http://assets.codeforces.com/rounds/435/1.txt http://assets.codeforces.com/rounds/435/2.txt
1,500
[ { "input": "5\n3 1 2 5 1", "output": " /\\ \n /\\/ \\ \n / \\ \n/ \\ \n \\/" }, { "input": "3\n1 5 1", "output": "/\\ \n \\ \n \\ \n \\ \n \\/" }, { "input": "2\n1 1", "output": "/\\" }, { "input": "2\n2 1", "output": " /\\\n/ " }, { "input": "2\n1 2", "output": "/\\ \n \\" }, { "input": "2\n2 2", "output": " /\\ \n/ \\" }, { "input": "3\n1 1 1", "output": "/\\/" }, { "input": "100\n14 6 10 12 11 12 6 19 12 7 10 17 8 10 10 5 9 6 9 14 15 5 9 11 8 12 14 15 9 9 9 11 13 15 11 10 4 10 8 7 13 11 17 10 14 14 15 8 10 7 12 8 7 15 13 8 7 13 5 11 12 8 9 8 7 16 11 10 10 15 9 11 2 12 12 9 9 13 7 6 9 7 8 7 4 6 15 6 8 11 7 10 11 9 17 8 8 5 9 9", "output": " /\\ ..." }, { "input": "2\n478 522", "output": " /\\ ..." }, { "input": "3\n328 341 331", "output": " /\\ ..." }, { "input": "4\n253 250 261 236", "output": " ..." }, { "input": "5\n198 213 195 189 205", "output": " /\\ ..." }, { "input": "6\n163 170 175 168 172 152", "output": " ..." }, { "input": "7\n154 157 138 129 136 148 138", "output": " /\\ ..." }, { "input": "8\n117 140 141 105 129 127 122 118", "output": " ..." }, { "input": "9\n96 114 117 124 114 107 126 95 105", "output": " ..." }, { "input": "4\n1 1 1 1", "output": "/\\/\\" }, { "input": "4\n1 1 2 1", "output": " /\\\n/\\/ " }, { "input": "4\n1 1 2 2", "output": " /\\ \n/\\/ \\" }, { "input": "4\n1 2 2 2", "output": "/\\ /\\ \n \\/ \\" }, { "input": "4\n2 2 2 2", "output": " /\\ /\\ \n/ \\/ \\" }, { "input": "5\n1 1 1 1 1", "output": "/\\/\\/" }, { "input": "5\n1 2 1 1 1", "output": "/\\ \n \\/\\/" }, { "input": "5\n2 1 1 2 1", "output": " /\\/\\ \n/ \\/" }, { "input": "5\n2 1 1 1 3", "output": " /\n / \n /\\/\\/ \n/ " }, { "input": "5\n2 2 1 2 2", "output": " /\\ \n/ \\/\\ /\n \\/ " }, { "input": "5\n2 1 2 3 2", "output": " /\\ \n /\\/ \\ /\n/ \\/ " }, { "input": "2\n500 500", "output": " /\\ ..." }, { "input": "3\n1 499 500", "output": " ..." }, { "input": "6\n1 200 1 200 1 200", "output": "/\\ ..." }, { "input": "6\n200 1 200 1 200 1", "output": " ..." }, { "input": "123\n2 5 7 7 3 7 8 7 6 6 7 10 7 8 7 4 6 6 7 6 6 6 5 8 9 6 3 3 5 5 6 7 7 8 8 6 4 1 3 8 9 9 3 4 5 6 6 7 9 9 4 7 7 6 3 9 7 7 6 3 6 5 3 7 7 1 6 5 10 4 5 6 3 7 7 7 4 7 7 8 6 10 9 5 5 6 5 4 5 7 3 6 7 8 3 5 6 5 4 5 5 9 5 4 9 6 3 4 7 5 7 2 3 10 5 8 5 5 5 9 3 6 7", "output": " /\\ ..." }, { "input": "23\n33 42 55 36 37 42 36 39 35 27 38 38 31 33 26 40 20 32 45 32 31 35 36", "output": " /\\ ..." }, { "input": "3\n2 1 1", "output": " /\\/\n/ " }, { "input": "3\n1 1 2", "output": " /\n/\\/ " }, { "input": "3\n1 2 1", "output": "/\\ \n \\/" }, { "input": "3\n1 2 2", "output": "/\\ /\n \\/ " }, { "input": "3\n2 2 1", "output": " /\\ \n/ \\/" }, { "input": "3\n2 1 2", "output": " /\n /\\/ \n/ " }, { "input": "3\n2 2 2", "output": " /\\ /\n/ \\/ " }, { "input": "2\n999 1", "output": " ..." }, { "input": "2\n1 999", "output": "/\\ ..." }, { "input": "3\n10 1 10", "output": " /\n / \n / \n / \n / \n / \n / \n / \n / \n /\\/ \n / \n / \n / \n / \n / \n / \n / \n / \n/ " } ]
1,401,469,308
5,508
Python 3
OK
TESTS
46
171
4,403,200
import operator n = int(input()) points = list(map(int, input().split())) def praf(g): for i in g[1:]: print(''.join(i)) def calc(n): global points a = b = 0 step = 1 for i in range(n): a += points[i] b += points[i] * step step = -step return (a, b) seq = [(0, 0)] for i in range(len(points)): seq.append(calc(i+1)) seq = sorted(seq, key=lambda x: x[0]) seq = {i: seq[i] for i in range(len(seq))} #print(seq) for i in range(len(seq)): r = 0 if i != len(seq)-1: if seq[i][1] > seq[i+1][1]: r = -1 else: r = 1 seq[i] = seq[i] + tuple([r]) seqy = sorted(seq.items(), key=lambda x: x[1][1], reverse=True) pts = {x[0]: x[2] for x in seq.values()} pts[seq[len(seq)-1][0]] = 1 #print('---seq---') #print(seq) #print('----seqy---') #print(seqy) #print('---pts---') #print(pts) graph = [[' '] * seq[len(seq)-1][0] for x in range(seqy[0][1][1]-seqy[-1][1][1]+1)] y = seqy[0][1][1] way = pts[0] for i in range(len(graph[0])): if i in pts.keys(): if pts[i] != way: if way == 1: y+=1 else: y-=1 way = pts[i] graph[y][i] = '/' if way == 1 else '\\' y -= way # praf(graph) #print('----------------graph-----------------------------------------------------------') praf(graph) #praf(graph)
Title: Cardiogram Time Limit: None seconds Memory Limit: None megabytes Problem Description: In this problem, your task is to use ASCII graphics to paint a cardiogram. A cardiogram is a polyline with the following corners: That is, a cardiogram is fully defined by a sequence of positive integers *a*1,<=*a*2,<=...,<=*a**n*. Your task is to paint a cardiogram by given sequence *a**i*. Input Specification: The first line contains integer *n* (2<=≤<=*n*<=≤<=1000). The next line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). It is guaranteed that the sum of all *a**i* doesn't exceed 1000. Output Specification: Print *max* |*y**i*<=-<=*y**j*| lines (where *y**k* is the *y* coordinate of the *k*-th point of the polyline), in each line print characters. Each character must equal either «<=/<=» (slash), « \ » (backslash), « » (space). The printed image must be the image of the given polyline. Please study the test samples for better understanding of how to print a cardiogram. Note that in this problem the checker checks your answer taking spaces into consideration. Do not print any extra characters. Remember that the wrong answer to the first pretest doesn't give you a penalty. Demo Input: ['5\n3 1 2 5 1\n', '3\n1 5 1\n'] Demo Output: ['/\u2009\\ \n \u2009/\u2009\\\u2009/\u2009 \\ \n \u2009/\u2009 \\ \n\u2009/\u2009 \\ \n \\\u2009/\u2009\n', '/\u2009\\ \n \\ \n \\ \n \\ \n \\\u2009/\u2009\n'] Note: Due to the technical reasons the answers for the samples cannot be copied from the statement. We've attached two text documents with the answers below. http://assets.codeforces.com/rounds/435/1.txt http://assets.codeforces.com/rounds/435/2.txt
```python import operator n = int(input()) points = list(map(int, input().split())) def praf(g): for i in g[1:]: print(''.join(i)) def calc(n): global points a = b = 0 step = 1 for i in range(n): a += points[i] b += points[i] * step step = -step return (a, b) seq = [(0, 0)] for i in range(len(points)): seq.append(calc(i+1)) seq = sorted(seq, key=lambda x: x[0]) seq = {i: seq[i] for i in range(len(seq))} #print(seq) for i in range(len(seq)): r = 0 if i != len(seq)-1: if seq[i][1] > seq[i+1][1]: r = -1 else: r = 1 seq[i] = seq[i] + tuple([r]) seqy = sorted(seq.items(), key=lambda x: x[1][1], reverse=True) pts = {x[0]: x[2] for x in seq.values()} pts[seq[len(seq)-1][0]] = 1 #print('---seq---') #print(seq) #print('----seqy---') #print(seqy) #print('---pts---') #print(pts) graph = [[' '] * seq[len(seq)-1][0] for x in range(seqy[0][1][1]-seqy[-1][1][1]+1)] y = seqy[0][1][1] way = pts[0] for i in range(len(graph[0])): if i in pts.keys(): if pts[i] != way: if way == 1: y+=1 else: y-=1 way = pts[i] graph[y][i] = '/' if way == 1 else '\\' y -= way # praf(graph) #print('----------------graph-----------------------------------------------------------') praf(graph) #praf(graph) ```
3
659
D
Bicycle Race
PROGRAMMING
1,500
[ "geometry", "implementation", "math" ]
null
null
Maria participates in a bicycle race. The speedway takes place on the shores of Lake Lucerne, just repeating its contour. As you know, the lake shore consists only of straight sections, directed to the north, south, east or west. Let's introduce a system of coordinates, directing the *Ox* axis from west to east, and the *Oy* axis from south to north. As a starting position of the race the southernmost point of the track is selected (and if there are several such points, the most western among them). The participants start the race, moving to the north. At all straight sections of the track, the participants travel in one of the four directions (north, south, east or west) and change the direction of movement only in bends between the straight sections. The participants, of course, never turn back, that is, they do not change the direction of movement from north to south or from east to west (or vice versa). Maria is still young, so she does not feel confident at some turns. Namely, Maria feels insecure if at a failed or untimely turn, she gets into the water. In other words, Maria considers the turn dangerous if she immediately gets into the water if it is ignored. Help Maria get ready for the competition — determine the number of dangerous turns on the track.
The first line of the input contains an integer *n* (4<=≤<=*n*<=≤<=1000) — the number of straight sections of the track. The following (*n*<=+<=1)-th line contains pairs of integers (*x**i*,<=*y**i*) (<=-<=10<=000<=≤<=*x**i*,<=*y**i*<=≤<=10<=000). The first of these points is the starting position. The *i*-th straight section of the track begins at the point (*x**i*,<=*y**i*) and ends at the point (*x**i*<=+<=1,<=*y**i*<=+<=1). It is guaranteed that: - the first straight section is directed to the north; - the southernmost (and if there are several, then the most western of among them) point of the track is the first point; - the last point coincides with the first one (i.e., the start position); - any pair of straight sections of the track has no shared points (except for the neighboring ones, they share exactly one point); - no pair of points (except for the first and last one) is the same; - no two adjacent straight sections are directed in the same direction or in opposite directions.
Print a single integer — the number of dangerous turns on the track.
[ "6\n0 0\n0 1\n1 1\n1 2\n2 2\n2 0\n0 0\n", "16\n1 1\n1 5\n3 5\n3 7\n2 7\n2 9\n6 9\n6 7\n5 7\n5 3\n4 3\n4 4\n3 4\n3 2\n5 2\n5 1\n1 1\n" ]
[ "1\n", "6\n" ]
The first sample corresponds to the picture: The picture shows that you can get in the water under unfortunate circumstances only at turn at the point (1, 1). Thus, the answer is 1.
1,250
[ { "input": "6\n0 0\n0 1\n1 1\n1 2\n2 2\n2 0\n0 0", "output": "1" }, { "input": "16\n1 1\n1 5\n3 5\n3 7\n2 7\n2 9\n6 9\n6 7\n5 7\n5 3\n4 3\n4 4\n3 4\n3 2\n5 2\n5 1\n1 1", "output": "6" }, { "input": "4\n-10000 -10000\n-10000 10000\n10000 10000\n10000 -10000\n-10000 -10000", "output": "0" }, { "input": "4\n6 8\n6 9\n7 9\n7 8\n6 8", "output": "0" }, { "input": "8\n-10000 -10000\n-10000 5000\n0 5000\n0 10000\n10000 10000\n10000 0\n0 0\n0 -10000\n-10000 -10000", "output": "2" }, { "input": "20\n-4286 -10000\n-4286 -7778\n-7143 -7778\n-7143 -3334\n-10000 -3334\n-10000 1110\n-4286 1110\n-4286 -3334\n4285 -3334\n4285 -1112\n7142 -1112\n7142 3332\n4285 3332\n4285 9998\n9999 9998\n9999 -3334\n7142 -3334\n7142 -5556\n-1429 -5556\n-1429 -10000\n-4286 -10000", "output": "8" }, { "input": "24\n-10000 -10000\n-10000 9998\n9998 9998\n9998 -10000\n-6364 -10000\n-6364 6362\n6362 6362\n6362 -6364\n-2728 -6364\n-2728 2726\n2726 2726\n2726 -910\n908 -910\n908 908\n-910 908\n-910 -4546\n4544 -4546\n4544 4544\n-4546 4544\n-4546 -8182\n8180 -8182\n8180 8180\n-8182 8180\n-8182 -10000\n-10000 -10000", "output": "10" }, { "input": "12\n-10000 -10000\n-10000 10000\n10000 10000\n10000 6000\n-6000 6000\n-6000 2000\n10000 2000\n10000 -2000\n-6000 -2000\n-6000 -6000\n10000 -6000\n10000 -10000\n-10000 -10000", "output": "4" }, { "input": "12\n-10000 -10000\n-10000 10000\n10000 10000\n10000 6000\n-9800 6000\n-9800 2000\n10000 2000\n10000 -2000\n-9800 -2000\n-9800 -6000\n10000 -6000\n10000 -10000\n-10000 -10000", "output": "4" }, { "input": "4\n0 0\n0 10000\n10000 10000\n10000 0\n0 0", "output": "0" }, { "input": "4\n-10000 -10000\n-10000 10000\n10000 10000\n10000 -10000\n-10000 -10000", "output": "0" } ]
1,663,616,688
2,147,483,647
PyPy 3-64
OK
TESTS
22
77
1,638,400
n=int(input()) x1,y1=map(int,input().split()) x2,y2=x1,y1 dir1,dir2="","" count=0 for i in range(n-1): x1,y1=x2,y2 dir1=dir2 x2,y2=map(int,input().split()) if x2>x1: dir2="R" elif x2<x1: dir2="L" elif y1>y2: dir2="D" else: dir2="U" if dir1=="U" and dir2=="L": count+=1 elif dir1=="D" and dir2=="R": count+=1 elif dir1=="R" and dir2=="U": count+=1 elif dir1=="L" and dir2=="D": count+=1 print(count)
Title: Bicycle Race Time Limit: None seconds Memory Limit: None megabytes Problem Description: Maria participates in a bicycle race. The speedway takes place on the shores of Lake Lucerne, just repeating its contour. As you know, the lake shore consists only of straight sections, directed to the north, south, east or west. Let's introduce a system of coordinates, directing the *Ox* axis from west to east, and the *Oy* axis from south to north. As a starting position of the race the southernmost point of the track is selected (and if there are several such points, the most western among them). The participants start the race, moving to the north. At all straight sections of the track, the participants travel in one of the four directions (north, south, east or west) and change the direction of movement only in bends between the straight sections. The participants, of course, never turn back, that is, they do not change the direction of movement from north to south or from east to west (or vice versa). Maria is still young, so she does not feel confident at some turns. Namely, Maria feels insecure if at a failed or untimely turn, she gets into the water. In other words, Maria considers the turn dangerous if she immediately gets into the water if it is ignored. Help Maria get ready for the competition — determine the number of dangerous turns on the track. Input Specification: The first line of the input contains an integer *n* (4<=≤<=*n*<=≤<=1000) — the number of straight sections of the track. The following (*n*<=+<=1)-th line contains pairs of integers (*x**i*,<=*y**i*) (<=-<=10<=000<=≤<=*x**i*,<=*y**i*<=≤<=10<=000). The first of these points is the starting position. The *i*-th straight section of the track begins at the point (*x**i*,<=*y**i*) and ends at the point (*x**i*<=+<=1,<=*y**i*<=+<=1). It is guaranteed that: - the first straight section is directed to the north; - the southernmost (and if there are several, then the most western of among them) point of the track is the first point; - the last point coincides with the first one (i.e., the start position); - any pair of straight sections of the track has no shared points (except for the neighboring ones, they share exactly one point); - no pair of points (except for the first and last one) is the same; - no two adjacent straight sections are directed in the same direction or in opposite directions. Output Specification: Print a single integer — the number of dangerous turns on the track. Demo Input: ['6\n0 0\n0 1\n1 1\n1 2\n2 2\n2 0\n0 0\n', '16\n1 1\n1 5\n3 5\n3 7\n2 7\n2 9\n6 9\n6 7\n5 7\n5 3\n4 3\n4 4\n3 4\n3 2\n5 2\n5 1\n1 1\n'] Demo Output: ['1\n', '6\n'] Note: The first sample corresponds to the picture: The picture shows that you can get in the water under unfortunate circumstances only at turn at the point (1, 1). Thus, the answer is 1.
```python n=int(input()) x1,y1=map(int,input().split()) x2,y2=x1,y1 dir1,dir2="","" count=0 for i in range(n-1): x1,y1=x2,y2 dir1=dir2 x2,y2=map(int,input().split()) if x2>x1: dir2="R" elif x2<x1: dir2="L" elif y1>y2: dir2="D" else: dir2="U" if dir1=="U" and dir2=="L": count+=1 elif dir1=="D" and dir2=="R": count+=1 elif dir1=="R" and dir2=="U": count+=1 elif dir1=="L" and dir2=="D": count+=1 print(count) ```
3
116
A
Tram
PROGRAMMING
800
[ "implementation" ]
null
null
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
[ "4\n0 3\n2 5\n4 2\n4 0\n" ]
[ "6\n" ]
For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
500
[ { "input": "4\n0 3\n2 5\n4 2\n4 0", "output": "6" }, { "input": "5\n0 4\n4 6\n6 5\n5 4\n4 0", "output": "6" }, { "input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0", "output": "18" }, { "input": "3\n0 1\n1 1\n1 0", "output": "1" }, { "input": "4\n0 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "3\n0 0\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "5\n0 73\n73 189\n189 766\n766 0\n0 0", "output": "766" }, { "input": "5\n0 0\n0 0\n0 0\n0 1\n1 0", "output": "1" }, { "input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0", "output": "1011" }, { "input": "5\n0 1\n1 2\n2 1\n1 2\n2 0", "output": "2" }, { "input": "5\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0", "output": "22" }, { "input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0", "output": "1776" }, { "input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0", "output": "1016" }, { "input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0", "output": "3" }, { "input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0", "output": "2071" }, { "input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0", "output": "3" }, { "input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0", "output": "1329" }, { "input": "2\n0 863\n863 0", "output": "863" }, { "input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0", "output": "8" }, { "input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0", "output": "11" }, { "input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0", "output": "7" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 900\n900 0", "output": "900" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1000\n1000 0", "output": "1000" }, { "input": "3\n0 802\n175 188\n815 0", "output": "815" }, { "input": "3\n0 910\n910 976\n976 0", "output": "976" }, { "input": "3\n0 2\n2 1\n1 0", "output": "2" } ]
1,688,472,633
2,147,483,647
Python 3
OK
TESTS
71
92
0
n=int(input()) x=0 y=0 l=[] for i in range(0,n): a,b=map(int,input().split(" ")) x+=b x-=a l.append(x) print(max(l))
Title: Tram Time Limit: None seconds Memory Limit: None megabytes Problem Description: Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram. Input Specification: The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0. Output Specification: Print a single integer denoting the minimum possible capacity of the tram (0 is allowed). Demo Input: ['4\n0 3\n2 5\n4 2\n4 0\n'] Demo Output: ['6\n'] Note: For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
```python n=int(input()) x=0 y=0 l=[] for i in range(0,n): a,b=map(int,input().split(" ")) x+=b x-=a l.append(x) print(max(l)) ```
3
37
A
Towers
PROGRAMMING
1,000
[ "sortings" ]
A. Towers
2
256
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
[ "3\n1 2 3\n", "4\n6 5 6 7\n" ]
[ "1 3\n", "2 3\n" ]
none
500
[ { "input": "3\n1 2 3", "output": "1 3" }, { "input": "4\n6 5 6 7", "output": "2 3" }, { "input": "4\n3 2 1 1", "output": "2 3" }, { "input": "4\n1 2 3 3", "output": "2 3" }, { "input": "3\n20 22 36", "output": "1 3" }, { "input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162", "output": "2 23" }, { "input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193", "output": "2 43" }, { "input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111", "output": "2 57" }, { "input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642", "output": "2 80" }, { "input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188", "output": "2 92" }, { "input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233", "output": "3 101" }, { "input": "5\n5 5 5 5 5", "output": "5 1" }, { "input": "3\n1000 1000 1000", "output": "3 1" }, { "input": "1\n1000", "output": "1 1" }, { "input": "1\n1", "output": "1 1" }, { "input": "5\n1 1000 1000 1000 1000", "output": "4 2" }, { "input": "5\n1000 1000 1000 8 7", "output": "3 3" } ]
1,486,539,806
2,147,483,647
Python 3
OK
TESTS
61
186
4,608,000
n = int(input()) #n, m = map(int, input().split()) #s = input() c = list(map(int, input().split())) c.sort() l = 0 k = 0 p = set() for i in c: if c.count(i) > l: l = c.count(i) if not i in p: k += 1 p.add(i) print(l, k)
Title: Towers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible. Input Specification: The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000. Output Specification: In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars. Demo Input: ['3\n1 2 3\n', '4\n6 5 6 7\n'] Demo Output: ['1 3\n', '2 3\n'] Note: none
```python n = int(input()) #n, m = map(int, input().split()) #s = input() c = list(map(int, input().split())) c.sort() l = 0 k = 0 p = set() for i in c: if c.count(i) > l: l = c.count(i) if not i in p: k += 1 p.add(i) print(l, k) ```
3.944917
186
A
Comparing Strings
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters. Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
[ "ab\nba\n", "aa\nab\n" ]
[ "YES\n", "NO\n" ]
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
500
[ { "input": "ab\nba", "output": "YES" }, { "input": "aa\nab", "output": "NO" }, { "input": "a\nza", "output": "NO" }, { "input": "vvea\nvvae", "output": "YES" }, { "input": "rtfabanpc\natfabrnpc", "output": "YES" }, { "input": "mt\ntm", "output": "YES" }, { "input": "qxolmbkkt\naovlajmlf", "output": "NO" }, { "input": "b\ng", "output": "NO" }, { "input": "ab\naba", "output": "NO" }, { "input": "ba\na", "output": "NO" }, { "input": "a\nab", "output": "NO" }, { "input": "a\naa", "output": "NO" }, { "input": "a\nz", "output": "NO" }, { "input": "aabb\nbbaa", "output": "NO" }, { "input": "ab\nbd", "output": "NO" }, { "input": "bac\ndae", "output": "NO" }, { "input": "abc\nakl", "output": "NO" }, { "input": "cb\naa", "output": "NO" }, { "input": "abaab\naabba", "output": "NO" }, { "input": "aab\naaa", "output": "NO" }, { "input": "abcde\nedcba", "output": "NO" }, { "input": "abab\nbaba", "output": "NO" }, { "input": "ab\nbac", "output": "NO" }, { "input": "abcd\naqcb", "output": "NO" }, { "input": "abc\nbad", "output": "NO" }, { "input": "ab\nca", "output": "NO" }, { "input": "abc\nab", "output": "NO" }, { "input": "ab\nbae", "output": "NO" }, { "input": "aaaabcccca\naaaadccccb", "output": "NO" }, { "input": "acaa\nabca", "output": "NO" }, { "input": "aba\naab", "output": "YES" }, { "input": "ah\nla", "output": "NO" }, { "input": "aab\naa", "output": "NO" }, { "input": "abab\nabcd", "output": "NO" }, { "input": "ed\nab", "output": "NO" } ]
1,620,053,210
2,147,483,647
Python 3
OK
TESTS
53
218
716,800
str1 = input() str2 = input() if(len(str1)!=len(str2)): print("NO") else: freq_1 = [0]*26 freq_2 = [0]*26 ct = 0 flag = 0 str1_list = [] str2_list = [] for i in range(len(str1)): freq_1[ord(str1[i])-97]+=1 freq_2[ord(str2[i])-97]+=1 if(str1[i]!=str2[i]): ct+=1 if(ct>2): flag = 1 break else: str1_list.append(str1[i]) str2_list.append(str2[i]) if(flag==1): print("NO") else: freq_flag = 0 for i in range(len(freq_1)): if(freq_1[i]!=freq_2[i]): freq_flag = 1 break if(freq_flag==1): print("NO") else: if(str1_list[0]==str2_list[1] and str1_list[1]==str2_list[0]): print("YES") else: print("NO")
Title: Comparing Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters. Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not. Input Specification: The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length. Output Specification: Print "YES", if the dwarves belong to the same race. Otherwise, print "NO". Demo Input: ['ab\nba\n', 'aa\nab\n'] Demo Output: ['YES\n', 'NO\n'] Note: - First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
```python str1 = input() str2 = input() if(len(str1)!=len(str2)): print("NO") else: freq_1 = [0]*26 freq_2 = [0]*26 ct = 0 flag = 0 str1_list = [] str2_list = [] for i in range(len(str1)): freq_1[ord(str1[i])-97]+=1 freq_2[ord(str2[i])-97]+=1 if(str1[i]!=str2[i]): ct+=1 if(ct>2): flag = 1 break else: str1_list.append(str1[i]) str2_list.append(str2[i]) if(flag==1): print("NO") else: freq_flag = 0 for i in range(len(freq_1)): if(freq_1[i]!=freq_2[i]): freq_flag = 1 break if(freq_flag==1): print("NO") else: if(str1_list[0]==str2_list[1] and str1_list[1]==str2_list[0]): print("YES") else: print("NO") ```
3
43
B
Letter
PROGRAMMING
1,100
[ "implementation", "strings" ]
B. Letter
2
256
Vasya decided to write an anonymous letter cutting the letters out of a newspaper heading. He knows heading *s*1 and text *s*2 that he wants to send. Vasya can use every single heading letter no more than once. Vasya doesn't have to cut the spaces out of the heading — he just leaves some blank space to mark them. Help him; find out if he will manage to compose the needed text.
The first line contains a newspaper heading *s*1. The second line contains the letter text *s*2. *s*1 и *s*2 are non-empty lines consisting of spaces, uppercase and lowercase Latin letters, whose lengths do not exceed 200 symbols. The uppercase and lowercase letters should be differentiated. Vasya does not cut spaces out of the heading.
If Vasya can write the given anonymous letter, print YES, otherwise print NO
[ "Instead of dogging Your footsteps it disappears but you dont notice anything\nwhere is your dog\n", "Instead of dogging Your footsteps it disappears but you dont notice anything\nYour dog is upstears\n", "Instead of dogging your footsteps it disappears but you dont notice anything\nYour dog is upstears\n", "abcdefg hijk\nk j i h g f e d c b a\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
none
1,000
[ { "input": "Instead of dogging Your footsteps it disappears but you dont notice anything\nwhere is your dog", "output": "NO" }, { "input": "Instead of dogging Your footsteps it disappears but you dont notice anything\nYour dog is upstears", "output": "YES" }, { "input": "Instead of dogging your footsteps it disappears but you dont notice anything\nYour dog is upstears", "output": "NO" }, { "input": "abcdefg hijk\nk j i h g f e d c b a", "output": "YES" }, { "input": "HpOKgo\neAtAVB", "output": "NO" }, { "input": "GRZGc\nLPzD", "output": "NO" }, { "input": "GtPXu\nd", "output": "NO" }, { "input": "FVF\nr ", "output": "NO" }, { "input": "HpOKgo\nogK", "output": "YES" }, { "input": "GRZGc\nZG", "output": "YES" }, { "input": "HpOKgoueAtAVBdGffvQheJDejNDHhhwyKJisugiRAH OseK yUwqPPNuThUxTfthqIUeb wS jChGOdFDarNrKRT MlwKecxWNoKEeD BbiHAruE XMlvKYVsJGPP\nAHN XvoaNwV AVBKwKjr u U K wKE D K Jy KiHsR h d W Js IHyMPK Br iSqe E fDA g H", "output": "YES" }, { "input": "GRZGcsLPzDrCSXhhNTaibJqVphhjbcPoZhCDUlzAbDnRWjHvxLKtpGiFWiGbfeDxBwCrdJmJGCGv GebAOinUsFrlqKTILOmxrFjSpEoVGoTdSSstJWVgMLKMPettxHASaQZNdOIObcTxtF qTHWBdNIKwj\nWqrxze Ji x q aT GllLrRV jMpGiMDTwwS JDsPGpAZKACmsFCOS CD Sj bCDgKF jJxa RddtLFAi VGLHH SecObzG q hPF ", "output": "YES" }, { "input": "GtPXuwdAxNhODQbjRslDDKciOALJrCifTjDQurQEBeFUUSZWwCZQPdYwZkYbrduMijFjgodAOrKIuUKwSXageZuOWMIhAMexyLRzFuzuXqBDTEaWMzVdbzhxDGSJC SsIYuYILwpiwwcObEHWpFvHeBkWYNitqYrxqgHReHcKnHbtjcWZuaxPBVPb\nTQIKyqFaewOkY lZUOOuxEw EwuKcArxRQGFYkvVWIAe SuanPeHuDjquurJu aSxwgOSw jYMwjxItNUUArQjO BIujAhSwttLWp", "output": "YES" }, { "input": "FVFSr unvtXbpKWF vPaAgNaoTqklzVqiGYcUcBIcattzBrRuNSnKUtmdGKbjcE\nUzrU K an GFGR Wc zt iBa P c T K v p V In b B c", "output": "YES" }, { "input": "lSwjnYLYtDNIZjxHiTawdh ntSzggZogcIZTuiTMWVgwyloMtEhqkrOxgIcFvwvsboXUPILPIymFAEXnhApewJXJNtFyZ\nAoxe jWZ u yImg o AZ FNI w lpj tNhT g y ZYcb rc J w Dlv", "output": "YES" }, { "input": "kvlekcdJqODUKdsJlXkRaileTmdGwUHWWgvgUokQxRzzbpFnswvNKiDnjfOFGvFcnaaiRnBGQmqoPxDHepgYasLhzjDgmvaFfVNEcSPVQCJKAbSyTGpXsAjIHr\nGjzUllNaGGKXUdYmDFpqFAKIwvTpjmqnyswWRTnxlBnavAGvavxJemrjvRJc", "output": "YES" }, { "input": "kWbvhgvvoYOhwXmgTwOSCDXrtFHhqwvMlCvsuuAUXMmWaYXiqHplFZZemhgkTuvsUtIaUxtyYauBIpjdbyYxjZ ZkaBPzwqPfqF kCqGRmXvWuabnQognnkvdNDtRUsSUvSzgBuxCMBWJifbxWegsknp\nBsH bWHJD n Ca T xq PRCv tatn Wjy sm I q s WCjFqdWe t W XUs Do eb Pfh ii hTbF O Fll", "output": "YES" }, { "input": "OTmLdkMhmDEOMQMiW ZpzEIjyElHFrNCfFQDp SZyoZaEIUIpyCHfwOUqiSkKtFHggrTBGkqfOxkChPztmPrsHoxVwAdrxbZLKxPXHlMnrkgMgiaHFopiFFiUEtKwCjpJtwdwkbJCgA bxeDIscFdmHQJLAMNhWlrZisQrHQpvbALWTwpf jnx\nDbZwrQbydCdkJMCrftiwtPFfpMiwwrfIrKidEChKECxQUBVUEfFirbGWiLkFQkdJiFtkrtkbIAEXCEDkwLpK", "output": "YES" }, { "input": "NwcGaIeSkOva\naIa", "output": "YES" }, { "input": "gSrAcVYgAdbdayzbKGhIzLDjyznLRIJH KyvilAaEddmgkBPCNzpmPNeGEbmmpAyHvUSoPvnaORrPUuafpReEGoDOQsAYnUHYfBqhdcopQfxJuGXgKnbdVMQNhJYkyjiJDKlShqBTtnnDQQzEijOMcYRGMgPGVhfIReYennKBLwDTVvcHMIHMgVpJkvzTrezxqS\nHJerIVvRyfrPgAQMTI AqGNO mQDfDwQHKgeeYmuRmozKHILvehMPOJNMRtPTAfvKvsoGKi xHEeKqDAYmQJPUXRJbIbHrgVOMGMTdvYiLui", "output": "YES" }, { "input": "ReB hksbHqQXxUgpvoNK bFqmNVCEiOyKdKcAJQRkpeohpfuqZabvrLfmpZOMcfyFBJGZwVMxiUPP pbZZtJjxhEwvrAba\nJTCpQnIViIGIdQtLnmkVzmcbBZR CoxAdTtWSYpbOglDFifqIVQ vfGKGtLpxpJHiHSWCMeRcrVOXBGBhoEnVhNTPWGTOErNtSvokcGdgZXbgTEtISUyTwaXUEIlJMmutsdCbiyrPZPJyRdOjnSuAGttLy", "output": "NO" }, { "input": "hrLzRegCuDGxTrhDgVvM KowwyYuXGzIpcXdSMgeQVfVOtJZdkhNYSegwFWWoPqcZoeapbQnyCtojgkcyezUNHGGIZrhzsKrvvcrtokIdcnqXXkCNKjrOjrnEAKBNxyDdiMVeyLvXxUYMZQRFdlcdlcxzKTeYzBlmpNiwWbNAAhWkMoGpRxkCuyqkzXdKWwGH\nJESKDOfnFdxPvUOCkrgSBEPQHJtJHzuNGstRbTCcchRWJvCcveSEAtwtOmZZiW", "output": "NO" }, { "input": "yDBxCtUygQwWqONxQCcuAvVCkMGlqgC zvkfEkwqbhMCQxnkwQIUhucCbVUyOBUcXvTNEGriTBwMDMfdsPZgWRgIUDqM\neptVnORTTyixxmWIBpSTEwOXqGZllBgSxPenYCDlFwckJlWsoVwWLAIbPOmFqcKcTcoQqahetl KLfVSyaLVebzsGwPSVbtQAeUdZAaJtfxlCEvvaRhLlVvRJhKat IaB awdqcDlrrhTbRxjEbzGwcdmdavkhcjHjzmwbxAgw", "output": "NO" }, { "input": "jlMwnnotSdlQMluKWkJwAeCetcqbIEnKeNyLWoKCGONDRBQOjbkGpUvDlmSFUJ bWhohqmmIUWTlDsvelUArAcZJBipMDwUvRfBsYzMdQnPDPAuBaeJmAxVKwUMJrwMDxNtlrtAowVWqWiwFGtmquZAcrpFsLHCrvMSMMlvQUqypAihQWrFMNoaqfs IBg\nNzeWQ bafrmDsYlpNHSGTBBgPl WIcuNhyNaNOEFvL", "output": "NO" }, { "input": "zyWvXBcUZqGqjHwZHQryBtFliLYnweXAoMKNpLaunaOlzaauWmLtywsEvWPiwxJapocAFRMjrqWJXYqfKEbBKnzLO\npsbi bsXpSeJaCkIuPWfSRADXdIClxcDCowwJzGCDTyAl", "output": "NO" }, { "input": "kKhuIwRPLCwPFfcnsyCfBdnsraGeOCcLTfXuGjqFSGPSAeDZJSS bXKFanNqWjpFnvRpWxHJspvisDlADJBioxXNbVoXeUedoPcNEpUyEeYxdJXhGzFAmpAiHotSVwbZQsuWjIVhVaEGgqbZHIoDpiEmjTtFylCwCkWWzUOoUfOHxEZvDwNpXhBWamHn\nK VpJjGhNbwCRhcfmNGVjewBFpEmPlIKeTuWiukDtEWpjgqciqglkyNfWrBLbGAKvlNWxaUelJmSlSoakSpRzePvJsshOsTYrMPXdxKpaShjyVIXGhRIAdtiGpNwtiRmGTBZhkJqIMdxMHX RMxCMYcWjcjhtCHyFnCvjjezGbkRDRiVxkbh", "output": "NO" }, { "input": "AXssNpFKyQmJcBdBdfkhhMUzfqJVgcLBddkwtnFSzSRUCjiDcdtmkzIGkCKSxWUEGhmHmciktJyGMkgCductyHx\nI nYhmJfPnvoKUiXYUBIPIcxNYTtvwPUoXERZvY ahlDpQFNMmVZqEBiYqYlHNqcpSCmhFczBlOAhsYFeqMGfqL EJsDNOgwoJfBzqijKOFcYQ", "output": "NO" }, { "input": "lkhrzDZmkdbjzYKPNMRkiwCFoZsMzBQMnxxdKKVJezSBjnLjPpUYtabcPTIaDJeDEobbWHdKOdVfMQwDXzDDcSrwVenDEYpMqfiOQ xSsqApWnAMoyhQXCKFzHvvzvUvkWwmwZrvZz\nsUzGspYpRFsHRbRgTQuCBgnFgPkisTUfFNwyEEWWRiweWWgjRkVQxgTwxOzdsOwfrGIH O gCXpzvHzfItuEHaihmugEyymSJIogYwX qAwcwIItidfnzZDhZgQHi eRjMAeVkJHceDZuJkmxGowOsmcGYYvk Ajtgi TxwihvjLViNZjvscTWvsaQUelTSivLShhEl", "output": "NO" }, { "input": "BRsVjyNhrqRHVwrJzuzRigEhdpbDmaACSPfed\nlWqKTjlrqOCUbgBBZdZDGCeQJDXawPnnDkQdZDgwrEQk", "output": "NO" }, { "input": "KRmINuyBYPwiTsdlyiNVuylToysJKmOpcLovAtwGPqrgFJQNAYvuAiyQRkeFMECVZvkDEmTauXlyjAaYRnTJXORMZRnTakBaUzSelMilejySDIZjQjzcOIrwXdvDvpeRIkoBgreyFXIyyIZutjiEBtwrmzQtPVUhvvdEtDMbXjBpoPVjGdM EXTAK JbCnw\nXZZqlJvzKKtvdNlzFPDTYxidqlsgufVzyEmO FZuLQ vVQsJESNviUCovCK NwwlbxsmPtOJNmAonCqrOZ bZ LVKAsQGmoLnYjeekvEIECFk", "output": "NO" } ]
1,620,716,537
2,147,483,647
PyPy 3
OK
TESTS
30
218
20,480,000
from collections import Counter s1=list(input()) s2=list(input()) c1=Counter(s1) c2=Counter(s2) flag=1 for ele in c2.keys(): if ele==' ': continue if c2[ele]>c1[ele]: print("NO") flag=0 break if flag: print("YES")
Title: Letter Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya decided to write an anonymous letter cutting the letters out of a newspaper heading. He knows heading *s*1 and text *s*2 that he wants to send. Vasya can use every single heading letter no more than once. Vasya doesn't have to cut the spaces out of the heading — he just leaves some blank space to mark them. Help him; find out if he will manage to compose the needed text. Input Specification: The first line contains a newspaper heading *s*1. The second line contains the letter text *s*2. *s*1 и *s*2 are non-empty lines consisting of spaces, uppercase and lowercase Latin letters, whose lengths do not exceed 200 symbols. The uppercase and lowercase letters should be differentiated. Vasya does not cut spaces out of the heading. Output Specification: If Vasya can write the given anonymous letter, print YES, otherwise print NO Demo Input: ['Instead of dogging Your footsteps it disappears but you dont notice anything\nwhere is your dog\n', 'Instead of dogging Your footsteps it disappears but you dont notice anything\nYour dog is upstears\n', 'Instead of dogging your footsteps it disappears but you dont notice anything\nYour dog is upstears\n', 'abcdefg hijk\nk j i h g f e d c b a\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: none
```python from collections import Counter s1=list(input()) s2=list(input()) c1=Counter(s1) c2=Counter(s2) flag=1 for ele in c2.keys(): if ele==' ': continue if c2[ele]>c1[ele]: print("NO") flag=0 break if flag: print("YES") ```
3.907353
263
A
Beautiful Matrix
PROGRAMMING
800
[ "implementation" ]
null
null
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
[ "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n", "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "4" }, { "input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "3" } ]
1,698,610,342
2,147,483,647
Python 3
OK
TESTS
25
92
0
Mt = [] order_Mt = 5 for i in range(order_Mt): Mt_row = list(map(int, input().split())) Mt.append(Mt_row) single_row, single_col = None, None for i in range(order_Mt): for j in range(order_Mt): if Mt[i][j] == 1: single_row, single_col = i, j row_move = abs(single_row - 2) col_move = abs(single_col - 2) m = row_move + col_move print(m)
Title: Beautiful Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. Input Specification: The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. Output Specification: Print a single integer — the minimum number of moves needed to make the matrix beautiful. Demo Input: ['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n'] Demo Output: ['3\n', '1\n'] Note: none
```python Mt = [] order_Mt = 5 for i in range(order_Mt): Mt_row = list(map(int, input().split())) Mt.append(Mt_row) single_row, single_col = None, None for i in range(order_Mt): for j in range(order_Mt): if Mt[i][j] == 1: single_row, single_col = i, j row_move = abs(single_row - 2) col_move = abs(single_col - 2) m = row_move + col_move print(m) ```
3
466
A
Cheap Travel
PROGRAMMING
1,200
[ "implementation" ]
null
null
Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides?
The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket.
Print a single integer — the minimum sum in rubles that Ann will need to spend.
[ "6 2 1 2\n", "5 2 2 3\n" ]
[ "6\n", "8\n" ]
In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets.
500
[ { "input": "6 2 1 2", "output": "6" }, { "input": "5 2 2 3", "output": "8" }, { "input": "10 3 5 1", "output": "4" }, { "input": "1000 1 1000 1000", "output": "1000000" }, { "input": "1000 3 1000 1000", "output": "334000" }, { "input": "1 1 1 1", "output": "1" }, { "input": "10 2 1 1", "output": "5" }, { "input": "1 1000 1 2", "output": "1" }, { "input": "1 1000 3 2", "output": "2" }, { "input": "10 3 1 2", "output": "7" }, { "input": "995 1 2 1", "output": "995" }, { "input": "556 2 16 15", "output": "4170" }, { "input": "477 2 16 14", "output": "3346" }, { "input": "101 110 1 100", "output": "100" }, { "input": "9 3 3 10", "output": "27" }, { "input": "100 8 10 1", "output": "13" }, { "input": "6 4 1 3", "output": "5" }, { "input": "8 5 2 8", "output": "14" }, { "input": "1000 2 1 1000", "output": "1000" } ]
1,694,985,069
2,147,483,647
Python 3
OK
TESTS
19
295
0
# Ann has recently started commuting by subway. We know that a one ride subway ticket costs a rubles. Besides, # Ann found out that she can buy a special ticket for m rides (she can buy it several times). It costs b rubles. Ann # did the math; she will need to use subway n times. Help Ann, tell her what is the minimum sum of money she will # have to spend to make n rides? # Input The single line contains four space-separated integers n, m, a, b — the number of rides Ann has planned, # the number of rides covered by the m ride ticket, the price of a one ride ticket and the price of an m ride ticket. # Output # Print a single integer — the minimum sum in rubles that Ann will need to spend. vl = input().split() # the number of rides Ann has planned n = int(vl[0]) # the number of rides covered by the m ride ticket m = int(vl[1]) # the price of a one ride ticket a = int(vl[2]) # the price of an m ride ticket b = int(vl[3]) onerideminimal = n if (n / m) >= (n//m): mminimaltickets = n//m + 1 else: mminimaltickets = n/m minimal_spend = n*a for i in range(mminimaltickets+1): for j in range(onerideminimal+1): t_rides = i * m + j cost = i * b + j * a if t_rides >= n: if cost <= minimal_spend: minimal_spend = cost print(minimal_spend)
Title: Cheap Travel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides? Input Specification: The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket. Output Specification: Print a single integer — the minimum sum in rubles that Ann will need to spend. Demo Input: ['6 2 1 2\n', '5 2 2 3\n'] Demo Output: ['6\n', '8\n'] Note: In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets.
```python # Ann has recently started commuting by subway. We know that a one ride subway ticket costs a rubles. Besides, # Ann found out that she can buy a special ticket for m rides (she can buy it several times). It costs b rubles. Ann # did the math; she will need to use subway n times. Help Ann, tell her what is the minimum sum of money she will # have to spend to make n rides? # Input The single line contains four space-separated integers n, m, a, b — the number of rides Ann has planned, # the number of rides covered by the m ride ticket, the price of a one ride ticket and the price of an m ride ticket. # Output # Print a single integer — the minimum sum in rubles that Ann will need to spend. vl = input().split() # the number of rides Ann has planned n = int(vl[0]) # the number of rides covered by the m ride ticket m = int(vl[1]) # the price of a one ride ticket a = int(vl[2]) # the price of an m ride ticket b = int(vl[3]) onerideminimal = n if (n / m) >= (n//m): mminimaltickets = n//m + 1 else: mminimaltickets = n/m minimal_spend = n*a for i in range(mminimaltickets+1): for j in range(onerideminimal+1): t_rides = i * m + j cost = i * b + j * a if t_rides >= n: if cost <= minimal_spend: minimal_spend = cost print(minimal_spend) ```
3
78
A
Haiku
PROGRAMMING
800
[ "implementation", "strings" ]
A. Haiku
2
256
Haiku is a genre of Japanese traditional poetry. A haiku poem consists of 17 syllables split into three phrases, containing 5, 7 and 5 syllables correspondingly (the first phrase should contain exactly 5 syllables, the second phrase should contain exactly 7 syllables, and the third phrase should contain exactly 5 syllables). A haiku masterpiece contains a description of a moment in those three phrases. Every word is important in a small poem, which is why haiku are rich with symbols. Each word has a special meaning, a special role. The main principle of haiku is to say much using a few words. To simplify the matter, in the given problem we will consider that the number of syllable in the phrase is equal to the number of vowel letters there. Only the following letters are regarded as vowel letters: "a", "e", "i", "o" and "u". Three phases from a certain poem are given. Determine whether it is haiku or not.
The input data consists of three lines. The length of each line is between 1 and 100, inclusive. The *i*-th line contains the *i*-th phrase of the poem. Each phrase consists of one or more words, which are separated by one or more spaces. A word is a non-empty sequence of lowercase Latin letters. Leading and/or trailing spaces in phrases are allowed. Every phrase has at least one non-space character. See the example for clarification.
Print "YES" (without the quotes) if the poem is a haiku. Otherwise, print "NO" (also without the quotes).
[ "on codeforces \nbeta round is running\n a rustling of keys \n", "how many gallons\nof edo s rain did you drink\n cuckoo\n" ]
[ "YES", "NO" ]
none
500
[ { "input": "on codeforces \nbeta round is running\n a rustling of keys ", "output": "YES" }, { "input": "how many gallons\nof edo s rain did you drink\n cuckoo", "output": "NO" }, { "input": " hatsu shigure\n saru mo komino wo\nhoshige nari", "output": "YES" }, { "input": "o vetus stagnum\n rana de ripa salit\n ac sonant aquae", "output": "NO" }, { "input": " furuike ya\nkawazu tobikomu\nmizu no oto ", "output": "YES" }, { "input": " noch da leich\na stamperl zum aufwaerma\n da pfarrer kimmt a ", "output": "NO" }, { "input": " sommerfuglene \n hvorfor bruge mange ord\n et kan gore det", "output": "YES" }, { "input": " ab der mittagszeit\n ist es etwas schattiger\n ein wolkenhimmel", "output": "NO" }, { "input": "tornando a vederli\ni fiori di ciliegio la sera\nson divenuti frutti", "output": "NO" }, { "input": "kutaburete\nyado karu koro ya\nfuji no hana", "output": "YES" }, { "input": " beginnings of poetry\n the rice planting songs \n of the interior", "output": "NO" }, { "input": " door zomerregens\n zijn de kraanvogelpoten\n korter geworden", "output": "NO" }, { "input": " derevo na srub\na ptitsi bezzabotno\n gnezdishko tam vyut", "output": "YES" }, { "input": "writing in the dark\nunaware that my pen\nhas run out of ink", "output": "NO" }, { "input": "kusaaiu\nuieueua\nuo efaa", "output": "YES" }, { "input": "v\nh\np", "output": "NO" }, { "input": "i\ni\nu", "output": "NO" }, { "input": "awmio eoj\nabdoolceegood\nwaadeuoy", "output": "YES" }, { "input": "xzpnhhnqsjpxdboqojixmofawhdjcfbscq\nfoparnxnbzbveycoltwdrfbwwsuobyoz hfbrszy\nimtqryscsahrxpic agfjh wvpmczjjdrnwj mcggxcdo", "output": "YES" }, { "input": "wxjcvccp cppwsjpzbd dhizbcnnllckybrnfyamhgkvkjtxxfzzzuyczmhedhztugpbgpvgh\nmdewztdoycbpxtp bsiw hknggnggykdkrlihvsaykzfiiw\ndewdztnngpsnn lfwfbvnwwmxoojknygqb hfe ibsrxsxr", "output": "YES" }, { "input": "nbmtgyyfuxdvrhuhuhpcfywzrbclp znvxw synxmzymyxcntmhrjriqgdjh xkjckydbzjbvtjurnf\nhhnhxdknvamywhsrkprofnyzlcgtdyzzjdsfxyddvilnzjziz qmwfdvzckgcbrrxplxnxf mpxwxyrpesnewjrx ajxlfj\nvcczq hddzd cvefmhxwxxyqcwkr fdsndckmesqeq zyjbwbnbyhybd cta nsxzidl jpcvtzkldwd", "output": "YES" }, { "input": "rvwdsgdsrutgjwscxz pkd qtpmfbqsmctuevxdj kjzknzghdvxzlaljcntg jxhvzn yciktbsbyscfypx x xhkxnfpdp\nwdfhvqgxbcts mnrwbr iqttsvigwdgvlxwhsmnyxnttedonxcfrtmdjjmacvqtkbmsnwwvvrlxwvtggeowtgsqld qj\nvsxcdhbzktrxbywpdvstr meykarwtkbm pkkbhvwvelclfmpngzxdmblhcvf qmabmweldplmczgbqgzbqnhvcdpnpjtch ", "output": "YES" }, { "input": "brydyfsmtzzkpdsqvvztmprhqzbzqvgsblnz naait tdtiprjsttwusdykndwcccxfmzmrmfmzjywkpgbfnjpypgcbcfpsyfj k\nucwdfkfyxxxht lxvnovqnnsqutjsyagrplb jhvtwdptrwcqrovncdvqljjlrpxcfbxqgsfylbgmcjpvpl ccbcybmigpmjrxpu\nfgwtpcjeywgnxgbttgx htntpbk tkkpwbgxwtbxvcpkqbzetjdkcwad tftnjdxxjdvbpfibvxuglvx llyhgjvggtw jtjyphs", "output": "YES" }, { "input": "nyc aqgqzjjlj mswgmjfcxlqdscheskchlzljlsbhyn iobxymwzykrsnljj\nnnebeaoiraga\nqpjximoqzswhyyszhzzrhfwhf iyxysdtcpmikkwpugwlxlhqfkn", "output": "NO" }, { "input": "lzrkztgfe mlcnq ay ydmdzxh cdgcghxnkdgmgfzgahdjjmqkpdbskreswpnblnrc fmkwziiqrbskp\np oukeaz gvvy kghtrjlczyl qeqhgfgfej\nwfolhkmktvsjnrpzfxcxzqmfidtlzmuhxac wsncjgmkckrywvxmnjdpjpfydhk qlmdwphcvyngansqhl", "output": "NO" }, { "input": "yxcboqmpwoevrdhvpxfzqmammak\njmhphkxppkqkszhqqtkvflarsxzla pbxlnnnafqbsnmznfj qmhoktgzix qpmrgzxqvmjxhskkksrtryehfnmrt dtzcvnvwp\nscwymuecjxhw rdgsffqywwhjpjbfcvcrnisfqllnbplpadfklayjguyvtrzhwblftclfmsr", "output": "NO" }, { "input": "qfdwsr jsbrpfmn znplcx nhlselflytndzmgxqpgwhpi ghvbbxrkjdirfghcybhkkqdzmyacvrrcgsneyjlgzfvdmxyjmph\nylxlyrzs drbktzsniwcbahjkgohcghoaczsmtzhuwdryjwdijmxkmbmxv yyfrokdnsx\nyw xtwyzqlfxwxghugoyscqlx pljtz aldfskvxlsxqgbihzndhxkswkxqpwnfcxzfyvncstfpqf", "output": "NO" }, { "input": "g rguhqhcrzmuqthtmwzhfyhpmqzzosa\nmhjimzvchkhejh irvzejhtjgaujkqfxhpdqjnxr dvqallgssktqvsxi\npcwbliftjcvuzrsqiswohi", "output": "NO" }, { "input": " ngxtlq iehiise vgffqcpnmsoqzyseuqqtggokymol zn\nvjdjljazeujwoubkcvtsbepooxqzrueaauokhepiquuopfild\ngoabauauaeotoieufueeknudiilupouaiaexcoapapu", "output": "NO" }, { "input": "ycnvnnqk mhrmhctpkfbc qbyvtjznmndqjzgbcxmvrpkfcll zwspfptmbxgrdv dsgkk nfytsqjrnfbhh pzdldzymvkdxxwh\nvnhjfwgdnyjptsmblyxmpzylsbjlmtkkwjcbqwjctqvrlqqkdsrktxlnslspvnn mdgsmzblhbnvpczmqkcffwhwljqkzmk hxcm\nrghnjvzcpprrgmtgytpkzyc mrdnnhpkwypwqbtzjyfwvrdwyjltbzxtbstzs xdjzdmx yjsqtzlrnvyssvglsdjrmsrfrcdpqt", "output": "NO" }, { "input": "ioeeaioeiuoeaeieuuieooaouiuouiioaueeaiaiuoaoiioeeaauooiuuieeuaeeoauieeaiuoieiaieuoauaaoioooieueueuai\nuooaoeeaoiuuoeioaoouaououoeioiaeueoioaiouaeaoioiuuaueeuaiuoiueoiuaoeeieeouaeeaeeieioeoiiieuuueuuieuo\naeeouieeieoueaioeoioooiouaeeeiaaioueauaueiouuuaieuuioiaeiueauueaoieauauoeueuaiueuuaueeoueauaeaoieeoo", "output": "NO" }, { "input": "mkgycgmrqtmlwj vddlbsgdptyfrcj nmrddjchydvbsyhgzytfzvwbhqmmhkpsyrcnknpsqrr wcnf wfvgskrnsmnrcqgcnc q\npn cclcyjjdp rqkpgyrvyyd hhynrochfa pthyffqvskazfshvzcmvhmsrxvquzkdvivlbfypwbgltfbjmhzljvgzmxjlrjdjq\nauuouieuaaauoooeoiuoaueuueauiuuuiaeuwuoiaeoeaieauieouoaeiiieiioiuuuiuauioiiuoeauueieaueiaioeuaoaaau", "output": "NO" }, { "input": "ab\na\na", "output": "NO" }, { "input": "on codeforcs\nbeta round is runnineg\na rustling of keys", "output": "NO" }, { "input": "coooooooooooooooood\nd\nd", "output": "NO" }, { "input": "on codeforces \nbeta round is runninog\n a rustling of keys", "output": "NO" }, { "input": "aaaaaaaaaaaaaaa\na\na", "output": "NO" }, { "input": "aaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\naaaaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\naaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc", "output": "YES" }, { "input": "cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\ncccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\ncccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc", "output": "NO" }, { "input": "aaaaaa\naaaaaa\naaaaa", "output": "NO" } ]
1,664,002,477
2,147,483,647
Python 3
OK
TESTS
40
92
0
l=[] m=[] for i in range(3): l.append(input('')) for j in l: k=list(j) a=k.count('a') b=k.count('e') c=k.count('i') d=k.count('o') e=k.count('u') s=a+b+c+d+e m.append(s) #print(m) if m[0]==5 and m[1]==7 and m[2]==5: print('YES') else: print('NO')
Title: Haiku Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Haiku is a genre of Japanese traditional poetry. A haiku poem consists of 17 syllables split into three phrases, containing 5, 7 and 5 syllables correspondingly (the first phrase should contain exactly 5 syllables, the second phrase should contain exactly 7 syllables, and the third phrase should contain exactly 5 syllables). A haiku masterpiece contains a description of a moment in those three phrases. Every word is important in a small poem, which is why haiku are rich with symbols. Each word has a special meaning, a special role. The main principle of haiku is to say much using a few words. To simplify the matter, in the given problem we will consider that the number of syllable in the phrase is equal to the number of vowel letters there. Only the following letters are regarded as vowel letters: "a", "e", "i", "o" and "u". Three phases from a certain poem are given. Determine whether it is haiku or not. Input Specification: The input data consists of three lines. The length of each line is between 1 and 100, inclusive. The *i*-th line contains the *i*-th phrase of the poem. Each phrase consists of one or more words, which are separated by one or more spaces. A word is a non-empty sequence of lowercase Latin letters. Leading and/or trailing spaces in phrases are allowed. Every phrase has at least one non-space character. See the example for clarification. Output Specification: Print "YES" (without the quotes) if the poem is a haiku. Otherwise, print "NO" (also without the quotes). Demo Input: ['on codeforces \nbeta round is running\n a rustling of keys \n', 'how many gallons\nof edo s rain did you drink\n cuckoo\n'] Demo Output: ['YES', 'NO'] Note: none
```python l=[] m=[] for i in range(3): l.append(input('')) for j in l: k=list(j) a=k.count('a') b=k.count('e') c=k.count('i') d=k.count('o') e=k.count('u') s=a+b+c+d+e m.append(s) #print(m) if m[0]==5 and m[1]==7 and m[2]==5: print('YES') else: print('NO') ```
3.977
127
A
Wasted Time
PROGRAMMING
900
[ "geometry" ]
null
null
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers.
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
[ "2 1\n0 0\n10 0\n", "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n", "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n" ]
[ "0.200000000", "6.032163204", "3.000000000" ]
none
500
[ { "input": "2 1\n0 0\n10 0", "output": "0.200000000" }, { "input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0", "output": "6.032163204" }, { "input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0", "output": "3.000000000" }, { "input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8", "output": "429.309294877" }, { "input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10", "output": "13629.282573522" }, { "input": "2 1\n-20 -10\n-10 -6", "output": "0.215406592" }, { "input": "2 13\n13 -10\n-3 -2", "output": "4.651021393" }, { "input": "2 21\n13 8\n14 10", "output": "0.939148551" }, { "input": "2 75\n-3 12\n1 12", "output": "6.000000000" }, { "input": "2 466\n10 16\n-6 -3", "output": "231.503997374" }, { "input": "2 999\n6 16\n-17 -14", "output": "755.286284531" }, { "input": "2 1000\n-17 -14\n-14 -8", "output": "134.164078650" }, { "input": "3 384\n-4 -19\n-17 -2\n3 4", "output": "324.722285390" }, { "input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5", "output": "668.956254495" }, { "input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15", "output": "789.212495576" }, { "input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18", "output": "3415.618464093" }, { "input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5", "output": "2113.552527680" }, { "input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6", "output": "2999.497312668" }, { "input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4", "output": "2797.756635934" }, { "input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5", "output": "12766.080247922" }, { "input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3", "output": "36.467924851" }, { "input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4", "output": "9495.010556306" }, { "input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14", "output": "6087.366930474" }, { "input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11", "output": "8929.162822862" }, { "input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13", "output": "16314.207721932" }, { "input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11", "output": "22153.369189802" } ]
1,590,054,821
2,147,483,647
Python 3
OK
TESTS
42
248
307,200
n, k = map(int, input().split()) x1, y1 = map(float, input().split()) sum = 0 for i in range(n-1): x2, y2 = map(float, input().split()) d = pow(pow(x2 - x1,2) + pow(y2 - y1,2), (1/2)) x1 = x2 y1 = y2 sum += d ans = (sum * k)/50 print(ans)
Title: Wasted Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers. Input Specification: The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters. Output Specification: Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6. Demo Input: ['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n'] Demo Output: ['0.200000000', '6.032163204', '3.000000000'] Note: none
```python n, k = map(int, input().split()) x1, y1 = map(float, input().split()) sum = 0 for i in range(n-1): x2, y2 = map(float, input().split()) d = pow(pow(x2 - x1,2) + pow(y2 - y1,2), (1/2)) x1 = x2 y1 = y2 sum += d ans = (sum * k)/50 print(ans) ```
3
71
A
Way Too Long Words
PROGRAMMING
800
[ "strings" ]
A. Way Too Long Words
1
256
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
[ "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n" ]
[ "word\nl10n\ni18n\np43s\n" ]
none
500
[ { "input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis", "output": "word\nl10n\ni18n\np43s" }, { "input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm", "output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m" }, { "input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd", "output": "n20n\nj27b\nk15d" }, { "input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt", "output": "t41t" }, { "input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings", "output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings" }, { "input": "1\na", "output": "a" }, { "input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz", "output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz" }, { "input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij", "output": "a98j" }, { "input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco", "output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco" }, { "input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt", "output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t" }, { "input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr", "output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr" } ]
1,674,851,531
2,147,483,647
PyPy 3-64
OK
TESTS
20
62
0
n=int(input()) for i in range(n): a=input() if len(a)>10: b=a[0] d=a[len(a) - 1] c=int(len(a))-2 print(b,c,d, sep="") else: print(a)
Title: Way Too Long Words Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. Output Specification: Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. Demo Input: ['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n'] Demo Output: ['word\nl10n\ni18n\np43s\n'] Note: none
```python n=int(input()) for i in range(n): a=input() if len(a)>10: b=a[0] d=a[len(a) - 1] c=int(len(a))-2 print(b,c,d, sep="") else: print(a) ```
3.969
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,652,715,315
2,147,483,647
Python 3
OK
TESTS
81
92
4,505,600
n = int(input()) sa = 0 sb = 0 sc = 0 for i in range(n): a, b, c = map(int, input().split()) sa = a + sa sb = b + sb sc = c + sc if sa == 0 and sb == 0 and sc == 0: print('YES') else: print('NO')
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python n = int(input()) sa = 0 sb = 0 sc = 0 for i in range(n): a, b, c = map(int, input().split()) sa = a + sa sb = b + sb sc = c + sc if sa == 0 and sb == 0 and sc == 0: print('YES') else: print('NO') ```
3.968608
431
C
k-Tree
PROGRAMMING
1,600
[ "dp", "implementation", "trees" ]
null
null
Quite recently a creative student Lesha had a lecture on trees. After the lecture Lesha was inspired and came up with the tree of his own which he called a *k*-tree. A *k*-tree is an infinite rooted tree where: - each vertex has exactly *k* children; - each edge has some weight; - if we look at the edges that goes from some vertex to its children (exactly *k* edges), then their weights will equal 1,<=2,<=3,<=...,<=*k*. The picture below shows a part of a 3-tree. Help Dima find an answer to his question. As the number of ways can be rather large, print it modulo 1000000007 (109<=+<=7).
A single line contains three space-separated integers: *n*, *k* and *d* (1<=≤<=*n*,<=*k*<=≤<=100; 1<=≤<=*d*<=≤<=*k*).
Print a single integer — the answer to the problem modulo 1000000007 (109<=+<=7).
[ "3 3 2\n", "3 3 3\n", "4 3 2\n", "4 5 2\n" ]
[ "3\n", "1\n", "6\n", "7\n" ]
none
1,500
[ { "input": "3 3 2", "output": "3" }, { "input": "3 3 3", "output": "1" }, { "input": "4 3 2", "output": "6" }, { "input": "4 5 2", "output": "7" }, { "input": "28 6 3", "output": "110682188" }, { "input": "5 100 1", "output": "16" }, { "input": "50 6 3", "output": "295630102" }, { "input": "10 13 6", "output": "48" }, { "input": "20 16 14", "output": "236" }, { "input": "1 10 1", "output": "1" }, { "input": "8 11 4", "output": "47" }, { "input": "16 5 4", "output": "16175" }, { "input": "5 26 17", "output": "0" }, { "input": "35 47 42", "output": "0" }, { "input": "11 6 2", "output": "975" }, { "input": "54 60 16", "output": "931055544" }, { "input": "47 5 1", "output": "164058640" }, { "input": "70 6 1", "output": "592826579" }, { "input": "40 77 77", "output": "0" }, { "input": "96 9 6", "output": "362487247" }, { "input": "52 46 4", "output": "27907693" }, { "input": "74 41 28", "output": "806604424" }, { "input": "100 100 100", "output": "1" }, { "input": "99 99 5", "output": "700732369" }, { "input": "100 100 1", "output": "988185646" }, { "input": "98 98 64", "output": "237643149" }, { "input": "28 74 2", "output": "134217727" }, { "input": "86 69 62", "output": "217513984" }, { "input": "9 17 14", "output": "0" }, { "input": "73 72 12", "output": "426374014" }, { "input": "41 98 76", "output": "0" }, { "input": "1 1 1", "output": "1" }, { "input": "1 100 100", "output": "0" }, { "input": "1 100 1", "output": "1" }, { "input": "1 100 2", "output": "0" }, { "input": "2 100 2", "output": "1" }, { "input": "2 100 1", "output": "2" }, { "input": "50 50 1", "output": "949480669" }, { "input": "100 50 50", "output": "661237556" }, { "input": "3 2 2", "output": "2" }, { "input": "100 50 3", "output": "494224664" }, { "input": "90 97 24", "output": "413496885" }, { "input": "31 8 8", "output": "52532592" }, { "input": "78 90 38", "output": "744021655" }, { "input": "100 13 11", "output": "883875774" }, { "input": "100 45 8", "output": "367847193" }, { "input": "31 8 4", "output": "924947104" }, { "input": "35 95 9", "output": "927164672" }, { "input": "45 5 3", "output": "252804490" }, { "input": "1 5 5", "output": "0" }, { "input": "89 75 59", "output": "179807625" }, { "input": "90 100 30", "output": "697322870" }, { "input": "89 73 32", "output": "152673180" }, { "input": "100 90 80", "output": "11531520" } ]
1,676,759,607
2,147,483,647
PyPy 3-64
OK
TESTS
54
62
1,843,200
dp = [] mod = 1000000007 def main(): n, k, d = input().split() n = int(n) k = int(k) d = int(d) dp.append(1) for i in range(1, n+1): dp.append(0) sup = 1 while i - sup >= 0 and sup <= k: dp[i] += dp[i - sup] sup = sup+1 whole = dp[n] dp[0] = 1 for i in range(1, n+1): dp[i] = 0 sup = 1 while i - sup >= 0 and sup <= (d-1): dp[i] += dp[i - sup] sup = sup+1 print((whole-dp[n])%mod) main()
Title: k-Tree Time Limit: None seconds Memory Limit: None megabytes Problem Description: Quite recently a creative student Lesha had a lecture on trees. After the lecture Lesha was inspired and came up with the tree of his own which he called a *k*-tree. A *k*-tree is an infinite rooted tree where: - each vertex has exactly *k* children; - each edge has some weight; - if we look at the edges that goes from some vertex to its children (exactly *k* edges), then their weights will equal 1,<=2,<=3,<=...,<=*k*. The picture below shows a part of a 3-tree. Help Dima find an answer to his question. As the number of ways can be rather large, print it modulo 1000000007 (109<=+<=7). Input Specification: A single line contains three space-separated integers: *n*, *k* and *d* (1<=≤<=*n*,<=*k*<=≤<=100; 1<=≤<=*d*<=≤<=*k*). Output Specification: Print a single integer — the answer to the problem modulo 1000000007 (109<=+<=7). Demo Input: ['3 3 2\n', '3 3 3\n', '4 3 2\n', '4 5 2\n'] Demo Output: ['3\n', '1\n', '6\n', '7\n'] Note: none
```python dp = [] mod = 1000000007 def main(): n, k, d = input().split() n = int(n) k = int(k) d = int(d) dp.append(1) for i in range(1, n+1): dp.append(0) sup = 1 while i - sup >= 0 and sup <= k: dp[i] += dp[i - sup] sup = sup+1 whole = dp[n] dp[0] = 1 for i in range(1, n+1): dp[i] = 0 sup = 1 while i - sup >= 0 and sup <= (d-1): dp[i] += dp[i - sup] sup = sup+1 print((whole-dp[n])%mod) main() ```
3
214
A
System of Equations
PROGRAMMING
800
[ "brute force" ]
null
null
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you? You are given a system of equations: You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
On a single line print the answer to the problem.
[ "9 3\n", "14 28\n", "4 20\n" ]
[ "1\n", "1\n", "0\n" ]
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
500
[ { "input": "9 3", "output": "1" }, { "input": "14 28", "output": "1" }, { "input": "4 20", "output": "0" }, { "input": "18 198", "output": "1" }, { "input": "22 326", "output": "1" }, { "input": "26 104", "output": "1" }, { "input": "14 10", "output": "0" }, { "input": "8 20", "output": "0" }, { "input": "2 8", "output": "0" }, { "input": "20 11", "output": "0" }, { "input": "57 447", "output": "1" }, { "input": "1 1", "output": "2" }, { "input": "66 296", "output": "1" }, { "input": "75 683", "output": "1" }, { "input": "227 975", "output": "1" }, { "input": "247 499", "output": "1" }, { "input": "266 116", "output": "1" }, { "input": "286 916", "output": "1" }, { "input": "307 341", "output": "1" }, { "input": "451 121", "output": "1" }, { "input": "471 921", "output": "1" }, { "input": "502 346", "output": "1" }, { "input": "535 59", "output": "1" }, { "input": "555 699", "output": "1" }, { "input": "747 351", "output": "1" }, { "input": "790 64", "output": "1" }, { "input": "810 704", "output": "1" }, { "input": "855 225", "output": "1" }, { "input": "902 34", "output": "1" }, { "input": "922 514", "output": "1" }, { "input": "971 131", "output": "1" }, { "input": "991 931", "output": "1" }, { "input": "840 780", "output": "0" }, { "input": "102 595", "output": "0" }, { "input": "139 433", "output": "0" }, { "input": "968 288", "output": "0" }, { "input": "563 354", "output": "0" }, { "input": "994 975", "output": "0" }, { "input": "456 221", "output": "0" }, { "input": "205 210", "output": "0" }, { "input": "1 11", "output": "0" }, { "input": "1000 1000", "output": "0" }, { "input": "3 3", "output": "0" }, { "input": "11 99", "output": "0" }, { "input": "2 2", "output": "1" }, { "input": "11 1", "output": "0" }, { "input": "6 6", "output": "1" }, { "input": "100 452", "output": "0" }, { "input": "420 380", "output": "0" }, { "input": "31 31", "output": "0" }, { "input": "2 6", "output": "0" }, { "input": "112 134", "output": "0" }, { "input": "13 13", "output": "0" }, { "input": "1 571", "output": "0" } ]
1,652,980,196
2,147,483,647
PyPy 3-64
OK
TESTS
54
124
28,467,200
n,m = map(int,input().split()) c = 0 for i in range(n+1): c += (i**2 + (n-i)**0.5) ==m print(c)
Title: System of Equations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you? You are given a system of equations: You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system. Input Specification: A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space. Output Specification: On a single line print the answer to the problem. Demo Input: ['9 3\n', '14 28\n', '4 20\n'] Demo Output: ['1\n', '1\n', '0\n'] Note: In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
```python n,m = map(int,input().split()) c = 0 for i in range(n+1): c += (i**2 + (n-i)**0.5) ==m print(c) ```
3
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,549,041,721
2,147,483,647
Python 3
OK
TESTS
36
374
1,126,400
from fractions import gcd x, y = map(int,input().split()) d = 6-max(x,y)+1 f = gcd(d,6) d = int(d/f) a = int(6/f) print (str(d)+"/"+str(a))
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python from fractions import gcd x, y = map(int,input().split()) d = 6-max(x,y)+1 f = gcd(d,6) d = int(d/f) a = int(6/f) print (str(d)+"/"+str(a)) ```
3.804608
599
A
Patrick and Shopping
PROGRAMMING
800
[ "implementation" ]
null
null
Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house. Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled.
The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths. - *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops.
Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house.
[ "10 20 30\n", "1 1 5\n" ]
[ "60\n", "4\n" ]
The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
500
[ { "input": "10 20 30", "output": "60" }, { "input": "1 1 5", "output": "4" }, { "input": "100 33 34", "output": "134" }, { "input": "777 777 777", "output": "2331" }, { "input": "2 2 8", "output": "8" }, { "input": "12 34 56", "output": "92" }, { "input": "789 101112 131415", "output": "203802" }, { "input": "27485716 99999999 35182", "output": "55041796" }, { "input": "1 293548 5", "output": "12" }, { "input": "12059 259855 5874875", "output": "543828" }, { "input": "46981 105809 585858", "output": "305580" }, { "input": "9889 1221 2442", "output": "7326" }, { "input": "100500 200600 300700", "output": "601800" }, { "input": "318476 318476 318476", "output": "955428" }, { "input": "23985 3353 75633", "output": "54676" }, { "input": "120 1298 2222", "output": "2836" }, { "input": "98437 23487 666672", "output": "243848" }, { "input": "100000000 100000000 100000000", "output": "300000000" }, { "input": "2 5 2", "output": "8" }, { "input": "1 1000 1", "output": "4" }, { "input": "1 100000000 1", "output": "4" } ]
1,621,417,762
2,147,483,647
Python 3
OK
TESTS
21
62
0
x, y, z = (int(i) for i in input().split()) res1 = x * 2 + y * 2 res2 = x + y + z res3 = min(x, y) * 2 + z * 2 print(min(res1, res2, res3))
Title: Patrick and Shopping Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house. Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled. Input Specification: The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths. - *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops. Output Specification: Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house. Demo Input: ['10 20 30\n', '1 1 5\n'] Demo Output: ['60\n', '4\n'] Note: The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
```python x, y, z = (int(i) for i in input().split()) res1 = x * 2 + y * 2 res2 = x + y + z res3 = min(x, y) * 2 + z * 2 print(min(res1, res2, res3)) ```
3
224
A
Parallelepiped
PROGRAMMING
1,100
[ "brute force", "geometry", "math" ]
null
null
You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped.
The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=&gt;<=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement.
Print a single number — the sum of all edges of the parallelepiped.
[ "1 1 1\n", "4 6 6\n" ]
[ "12\n", "28\n" ]
In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
500
[ { "input": "1 1 1", "output": "12" }, { "input": "4 6 6", "output": "28" }, { "input": "20 10 50", "output": "68" }, { "input": "9 4 36", "output": "56" }, { "input": "324 9 36", "output": "184" }, { "input": "1333 93 129", "output": "308" }, { "input": "1022 584 112", "output": "380" }, { "input": "66 174 319", "output": "184" }, { "input": "912 276 1748", "output": "444" }, { "input": "65 156 60", "output": "120" }, { "input": "1 10000 10000", "output": "40008" }, { "input": "1485 55 27", "output": "332" }, { "input": "152 108 4104", "output": "528" }, { "input": "1656 6900 1350", "output": "740" }, { "input": "12 14 42", "output": "60" }, { "input": "615 18 1230", "output": "856" }, { "input": "680 60 408", "output": "336" }, { "input": "644 966 6", "output": "1308" }, { "input": "1 432 432", "output": "1736" }, { "input": "2239 2239 1", "output": "8964" }, { "input": "4106 8212 2", "output": "16436" }, { "input": "10000 10000 10000", "output": "1200" }, { "input": "3623 3623 1", "output": "14500" }, { "input": "9801 9801 9801", "output": "1188" }, { "input": "10000 1 10000", "output": "40008" }, { "input": "9 9 9", "output": "36" }, { "input": "9801 9702 9702", "output": "1184" } ]
1,620,775,708
2,147,483,647
Python 3
OK
TESTS
27
154
6,758,400
import math arr = list(map(int, input().rstrip().split())) t = 0 a = math.sqrt((arr[0]*arr[1]/arr[2])) b = math.sqrt((arr[1]*arr[2]/arr[0])) c = math.sqrt((arr[0]*arr[2]/arr[1])) print(int((a+b+c)*4))
Title: Parallelepiped Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped. Input Specification: The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=&gt;<=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement. Output Specification: Print a single number — the sum of all edges of the parallelepiped. Demo Input: ['1 1 1\n', '4 6 6\n'] Demo Output: ['12\n', '28\n'] Note: In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
```python import math arr = list(map(int, input().rstrip().split())) t = 0 a = math.sqrt((arr[0]*arr[1]/arr[2])) b = math.sqrt((arr[1]*arr[2]/arr[0])) c = math.sqrt((arr[0]*arr[2]/arr[1])) print(int((a+b+c)*4)) ```
3
519
A
A and B and Chess
PROGRAMMING
900
[ "implementation" ]
null
null
A and B are preparing themselves for programming contests. To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger. For each chess piece we know its weight: - the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position. The player's weight equals to the sum of weights of all his pieces on the board. As A doesn't like counting, he asked you to help him determine which player has the larger position weight.
The input contains eight lines, eight characters each — the board's description. The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters. The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'. The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively. An empty square of the board is marked as '.' (a dot). It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on.
Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal.
[ "...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n", "rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n", "rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n" ]
[ "White\n", "Draw\n", "Black\n" ]
In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5. In the second test sample the weights of the positions of the black and the white pieces are equal to 39. In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16.
500
[ { "input": "rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR", "output": "Draw" }, { "input": "....bQ.K\n.B......\n.....P..\n........\n........\n........\n...N.P..\n.....R..", "output": "White" }, { "input": "b....p..\nR.......\n.pP...b.\npp......\nq.PPNpPR\n..K..rNn\nP.....p.\n...Q..B.", "output": "White" }, { "input": "...Nn...\n........\n........\n........\n.R....b.\n........\n........\n......p.", "output": "White" }, { "input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq", "output": "Black" }, { "input": "QQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ", "output": "White" }, { "input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ", "output": "Draw" }, { "input": "QQQQQQQQ\nQQQQQQQQ\n........\n........\n........\n........\nrrrrrr..\nrrrrrrrr", "output": "White" }, { "input": "........\n........\n........\n........\n........\n........\n........\n.......n", "output": "Black" }, { "input": "........\n...b....\n........\n........\n........\n........\n........\n.......K", "output": "Black" }, { "input": "........\n........\n........\n........\n........\n........\n........\n......Kp", "output": "Black" }, { "input": "........\n........\n........\n........\n........\n........\n........\n.......Q", "output": "White" }, { "input": "........\n........\n........\n........\n........\n........\n........\n......Bp", "output": "White" }, { "input": "........\n........\n........\n........\n........\n........\n........\nkkkkkB..", "output": "White" }, { "input": "QqPQNN.Q\n.qBbr.qB\np.RKBpNK\nPknBr.nq\nKqKRNKKk\n.BqPqkb.\nPBNPr.rk\nBpBKrPRR", "output": "Black" }, { "input": "........\n........\n........\n........\n........\n........\n........\n.......K", "output": "Draw" } ]
1,699,975,039
2,147,483,647
PyPy 3-64
OK
TESTS
65
62
0
i = [input() for _ in range(8)] bp = {'q': 9, 'r': 5, 'b': 3, 'n':3, 'p': 1} wp = {'Q': 9, 'R': 5, 'B': 3, 'N':3, 'P': 1} black, white = 0, 0 for row in i: for piece in row: if piece in bp.keys(): black += bp[piece] elif piece in wp.keys(): white += wp[piece] if white == black: print('Draw') else: print('White' if white > black else 'Black')
Title: A and B and Chess Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger. For each chess piece we know its weight: - the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position. The player's weight equals to the sum of weights of all his pieces on the board. As A doesn't like counting, he asked you to help him determine which player has the larger position weight. Input Specification: The input contains eight lines, eight characters each — the board's description. The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters. The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'. The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively. An empty square of the board is marked as '.' (a dot). It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on. Output Specification: Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal. Demo Input: ['...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n', 'rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n', 'rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n'] Demo Output: ['White\n', 'Draw\n', 'Black\n'] Note: In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5. In the second test sample the weights of the positions of the black and the white pieces are equal to 39. In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16.
```python i = [input() for _ in range(8)] bp = {'q': 9, 'r': 5, 'b': 3, 'n':3, 'p': 1} wp = {'Q': 9, 'R': 5, 'B': 3, 'N':3, 'P': 1} black, white = 0, 0 for row in i: for piece in row: if piece in bp.keys(): black += bp[piece] elif piece in wp.keys(): white += wp[piece] if white == black: print('Draw') else: print('White' if white > black else 'Black') ```
3
120
F
Spiders
PROGRAMMING
1,400
[ "dp", "greedy", "trees" ]
null
null
One day mum asked Petya to sort his toys and get rid of some of them. Petya found a whole box of toy spiders. They were quite dear to him and the boy didn't want to throw them away. Petya conjured a cunning plan: he will glue all the spiders together and attach them to the ceiling. Besides, Petya knows that the lower the spiders will hang, the more mum is going to like it and then she won't throw his favourite toys away. Help Petya carry out the plan. A spider consists of *k* beads tied together by *k*<=-<=1 threads. Each thread connects two different beads, at that any pair of beads that make up a spider is either directly connected by a thread, or is connected via some chain of threads and beads. Petya may glue spiders together directly gluing their beads. The length of each thread equals 1. The sizes of the beads can be neglected. That's why we can consider that gluing spiders happens by identifying some of the beads (see the picture). Besides, the construction resulting from the gluing process should also represent a spider, that is, it should have the given features. After Petya glues all spiders together, he measures the length of the resulting toy. The distance between a pair of beads is identified as the total length of the threads that connect these two beads. The length of the resulting construction is the largest distance between all pairs of beads. Petya wants to make the spider whose length is as much as possible. The picture two shows two spiders from the second sample. We can glue to the bead number 2 of the first spider the bead number 1 of the second spider. The threads in the spiders that form the sequence of threads of maximum lengths are highlighted on the picture.
The first input file line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of spiders. Next *n* lines contain the descriptions of each spider: integer *n**i* (2<=≤<=*n**i*<=≤<=100) — the number of beads, then *n**i*<=-<=1 pairs of numbers denoting the numbers of the beads connected by threads. The beads that make up each spider are numbered from 1 to *n**i*.
Print a single number — the length of the required construction.
[ "1\n3 1 2 2 3\n", "2\n3 1 2 1 3\n4 1 2 2 3 2 4\n", "2\n5 1 2 2 3 3 4 3 5\n7 3 4 1 2 2 4 4 6 2 7 6 5\n" ]
[ "2\n", "4\n", "7\n" ]
none
0
[ { "input": "1\n3 1 2 2 3", "output": "2" }, { "input": "2\n3 1 2 1 3\n4 1 2 2 3 2 4", "output": "4" }, { "input": "2\n5 1 2 2 3 3 4 3 5\n7 3 4 1 2 2 4 4 6 2 7 6 5", "output": "7" }, { "input": "3\n3 1 2 2 3\n5 2 5 5 3 3 4 5 1\n9 6 5 5 9 4 8 4 7 2 1 2 6 2 4 6 3", "output": "10" }, { "input": "7\n2 2 1\n4 1 4 2 3 1 2\n3 3 1 3 2\n5 1 4 3 5 1 2 1 3\n6 4 5 1 3 4 2 3 6 5 1\n7 1 3 3 6 7 4 7 1 5 2 3 5\n10 6 8 2 6 6 3 2 7 2 4 6 10 3 1 6 5 6 9", "output": "23" }, { "input": "10\n3 1 2 1 3\n3 1 2 1 3\n7 1 2 1 3 3 4 7 5 1 6 5 1\n2 1 2\n4 4 3 3 1 4 2\n3 3 1 3 2\n5 4 2 5 1 3 5 3 4\n6 1 6 2 4 6 2 4 3 5 1\n7 2 4 4 6 7 3 3 1 3 5 2 7\n10 3 5 5 6 1 9 5 2 7 8 8 1 6 10 4 3 4 7", "output": "36" }, { "input": "7\n4 2 3 4 1 2 4\n4 4 3 2 1 3 2\n3 2 1 2 3\n5 5 4 1 5 1 2 2 3\n6 1 3 4 5 2 6 3 2 1 4\n7 6 4 4 7 6 2 6 3 3 1 6 5\n10 8 10 4 8 5 9 5 6 3 4 3 1 5 3 4 7 1 2", "output": "26" }, { "input": "7\n2 1 2\n4 4 1 1 2 4 3\n3 3 2 2 1\n5 4 1 1 5 4 3 1 2\n6 4 2 3 1 3 4 3 5 3 6\n8 7 4 6 2 6 7 4 5 4 1 1 3 6 8\n10 4 1 8 9 7 8 2 4 8 6 6 5 2 7 8 3 7 10", "output": "23" }, { "input": "3\n4 3 2 3 1 1 4\n4 3 1 2 4 3 2\n4 1 4 2 1 4 3", "output": "9" }, { "input": "3\n10 7 3 10 9 7 10 4 7 8 6 8 2 4 8 8 5 5 1\n12 10 3 11 4 11 9 12 1 10 12 8 7 8 11 6 5 10 6 10 2 6 8\n13 3 7 10 4 3 8 3 1 8 5 4 12 9 2 8 6 10 9 1 10 10 11 4 13", "output": "18" }, { "input": "4\n5 3 2 3 5 4 1 4 3\n6 6 4 1 2 2 3 2 6 6 5\n7 6 1 6 4 4 5 1 7 4 3 2 6\n8 2 1 6 8 4 5 8 3 4 7 4 2 2 6", "output": "15" }, { "input": "2\n10 8 1 6 7 10 8 7 5 3 4 5 3 9 2 6 9 2 10\n10 9 7 6 1 8 10 6 4 8 3 9 2 3 5 8 9 3 6", "output": "14" }, { "input": "6\n3 1 3 1 2\n3 2 1 3 2\n5 2 5 5 1 2 3 2 4\n4 2 3 2 4 1 2\n5 2 3 2 1 3 5 2 4\n5 3 5 2 3 5 1 4 2", "output": "16" }, { "input": "1\n50 4 37 49 41 40 10 23 14 35 3 39 46 40 8 11 35 32 17 3 7 25 47 17 27 49 1 28 9 6 38 41 29 22 13 38 16 4 48 4 21 13 23 49 30 35 44 25 34 25 18 31 50 21 6 32 19 19 28 22 42 39 25 22 26 21 40 21 33 21 39 14 43 3 15 17 2 19 12 26 24 28 5 22 11 4 20 10 45 48 36 4 22 4 32 4 31 39 49", "output": "10" }, { "input": "4\n10 9 5 9 7 7 6 7 2 1 4 9 1 7 3 2 10 3 8\n10 9 10 2 5 3 6 5 7 9 3 9 1 9 2 2 8 2 4\n10 5 3 2 5 1 6 6 8 3 9 3 10 5 1 8 4 3 7\n10 7 6 3 1 8 10 2 3 2 7 5 9 10 5 1 4 2 8", "output": "23" } ]
1,580,547,716
6,416
PyPy 3
OK
TESTS
30
872
7,065,600
from queue import Queue def bfs(v, g, m): q = Queue() visit = [False] * m visit[v] = True q.put((v, 0)) last = v, 0 while not q.empty(): v, l = q.get() for i in g[v]: if not visit[i]: q.put((i, l + 1)) visit[i] = True if q.empty(): last = v, l return last fin = ''.join(open('input.txt', 'r').readlines()).split('\n') fout = open('output.txt', 'w') n = int(fin[0]) res = 0 for i in range(n): mas = [int(j) for j in fin[1 + i].split()] g = {} for j in range(mas[0] - 1): a, b = mas[1 + j * 2] - 1, mas[2 + j * 2] - 1 g[a] = g.get(a, []) g[b] = g.get(b, []) g[a].append(b) g[b].append(a) _, dist = bfs(bfs(0, g, mas[0])[0], g, mas[0]) res += dist fout.write(str(res))
Title: Spiders Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day mum asked Petya to sort his toys and get rid of some of them. Petya found a whole box of toy spiders. They were quite dear to him and the boy didn't want to throw them away. Petya conjured a cunning plan: he will glue all the spiders together and attach them to the ceiling. Besides, Petya knows that the lower the spiders will hang, the more mum is going to like it and then she won't throw his favourite toys away. Help Petya carry out the plan. A spider consists of *k* beads tied together by *k*<=-<=1 threads. Each thread connects two different beads, at that any pair of beads that make up a spider is either directly connected by a thread, or is connected via some chain of threads and beads. Petya may glue spiders together directly gluing their beads. The length of each thread equals 1. The sizes of the beads can be neglected. That's why we can consider that gluing spiders happens by identifying some of the beads (see the picture). Besides, the construction resulting from the gluing process should also represent a spider, that is, it should have the given features. After Petya glues all spiders together, he measures the length of the resulting toy. The distance between a pair of beads is identified as the total length of the threads that connect these two beads. The length of the resulting construction is the largest distance between all pairs of beads. Petya wants to make the spider whose length is as much as possible. The picture two shows two spiders from the second sample. We can glue to the bead number 2 of the first spider the bead number 1 of the second spider. The threads in the spiders that form the sequence of threads of maximum lengths are highlighted on the picture. Input Specification: The first input file line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of spiders. Next *n* lines contain the descriptions of each spider: integer *n**i* (2<=≤<=*n**i*<=≤<=100) — the number of beads, then *n**i*<=-<=1 pairs of numbers denoting the numbers of the beads connected by threads. The beads that make up each spider are numbered from 1 to *n**i*. Output Specification: Print a single number — the length of the required construction. Demo Input: ['1\n3 1 2 2 3\n', '2\n3 1 2 1 3\n4 1 2 2 3 2 4\n', '2\n5 1 2 2 3 3 4 3 5\n7 3 4 1 2 2 4 4 6 2 7 6 5\n'] Demo Output: ['2\n', '4\n', '7\n'] Note: none
```python from queue import Queue def bfs(v, g, m): q = Queue() visit = [False] * m visit[v] = True q.put((v, 0)) last = v, 0 while not q.empty(): v, l = q.get() for i in g[v]: if not visit[i]: q.put((i, l + 1)) visit[i] = True if q.empty(): last = v, l return last fin = ''.join(open('input.txt', 'r').readlines()).split('\n') fout = open('output.txt', 'w') n = int(fin[0]) res = 0 for i in range(n): mas = [int(j) for j in fin[1 + i].split()] g = {} for j in range(mas[0] - 1): a, b = mas[1 + j * 2] - 1, mas[2 + j * 2] - 1 g[a] = g.get(a, []) g[b] = g.get(b, []) g[a].append(b) g[b].append(a) _, dist = bfs(bfs(0, g, mas[0])[0], g, mas[0]) res += dist fout.write(str(res)) ```
3
361
A
Levko and Table
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*. Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value. If there are multiple suitable tables, you are allowed to print any of them.
[ "2 4\n", "4 7\n" ]
[ "1 3\n3 1\n", "2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n" ]
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample. In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
500
[ { "input": "2 4", "output": "4 0 \n0 4 " }, { "input": "4 7", "output": "7 0 0 0 \n0 7 0 0 \n0 0 7 0 \n0 0 0 7 " }, { "input": "1 8", "output": "8 " }, { "input": "9 3", "output": "3 0 0 0 0 0 0 0 0 \n0 3 0 0 0 0 0 0 0 \n0 0 3 0 0 0 0 0 0 \n0 0 0 3 0 0 0 0 0 \n0 0 0 0 3 0 0 0 0 \n0 0 0 0 0 3 0 0 0 \n0 0 0 0 0 0 3 0 0 \n0 0 0 0 0 0 0 3 0 \n0 0 0 0 0 0 0 0 3 " }, { "input": "31 581", "output": "581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 1000", "output": "1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..." }, { "input": "100 999", "output": "999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "99 998", "output": "998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 997", "output": "997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "81 111", "output": "111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 111 0 0..." }, { "input": "1 407", "output": "407 " }, { "input": "54 341", "output": "341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "92 460", "output": "460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "34 47", "output": "47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 ..." }, { "input": "11 547", "output": "547 0 0 0 0 0 0 0 0 0 0 \n0 547 0 0 0 0 0 0 0 0 0 \n0 0 547 0 0 0 0 0 0 0 0 \n0 0 0 547 0 0 0 0 0 0 0 \n0 0 0 0 547 0 0 0 0 0 0 \n0 0 0 0 0 547 0 0 0 0 0 \n0 0 0 0 0 0 547 0 0 0 0 \n0 0 0 0 0 0 0 547 0 0 0 \n0 0 0 0 0 0 0 0 547 0 0 \n0 0 0 0 0 0 0 0 0 547 0 \n0 0 0 0 0 0 0 0 0 0 547 " }, { "input": "100 1", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "99 1", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "99 2", "output": "2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "2 7", "output": "7 0 \n0 7 " }, { "input": "100 100", "output": "100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "4 3", "output": "3 0 0 0 \n0 3 0 0 \n0 0 3 0 \n0 0 0 3 " }, { "input": "3 2", "output": "2 0 0 \n0 2 0 \n0 0 2 " } ]
1,598,160,998
2,147,483,647
Python 3
OK
TESTS
22
109
7,065,600
import sys def input(): return sys.stdin.readline().strip() def iinput(): return int(input()) def rinput(): return map(int, sys.stdin.readline().strip().split()) def get_list(): return list(map(int, sys.stdin.readline().strip().split())) n,k=rinput() a=[] for i in range(n): for j in range(n): if(i==j): a.append(k) else: a.append(0) for i in range(0,n*n+1,n): print(*a[i:n+i])
Title: Levko and Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*. Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them. Input Specification: The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Output Specification: Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value. If there are multiple suitable tables, you are allowed to print any of them. Demo Input: ['2 4\n', '4 7\n'] Demo Output: ['1 3\n3 1\n', '2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n'] Note: In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample. In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
```python import sys def input(): return sys.stdin.readline().strip() def iinput(): return int(input()) def rinput(): return map(int, sys.stdin.readline().strip().split()) def get_list(): return list(map(int, sys.stdin.readline().strip().split())) n,k=rinput() a=[] for i in range(n): for j in range(n): if(i==j): a.append(k) else: a.append(0) for i in range(0,n*n+1,n): print(*a[i:n+i]) ```
3
300
A
Array
PROGRAMMING
1,100
[ "brute force", "constructive algorithms", "implementation" ]
null
null
Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold: 1. The product of all numbers in the first set is less than zero (<=&lt;<=0). 1. The product of all numbers in the second set is greater than zero (<=&gt;<=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set. Help Vitaly. Divide the given array.
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements.
In the first line print integer *n*1 (*n*1<=&gt;<=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set. In the next line print integer *n*2 (*n*2<=&gt;<=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set. In the next line print integer *n*3 (*n*3<=&gt;<=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set. The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them.
[ "3\n-1 2 0\n", "4\n-1 -2 -3 0\n" ]
[ "1 -1\n1 2\n1 0\n", "1 -1\n2 -3 -2\n1 0\n" ]
none
500
[ { "input": "3\n-1 2 0", "output": "1 -1\n1 2\n1 0" }, { "input": "4\n-1 -2 -3 0", "output": "1 -1\n2 -3 -2\n1 0" }, { "input": "5\n-1 -2 1 2 0", "output": "1 -1\n2 1 2\n2 0 -2" }, { "input": "100\n-64 -51 -75 -98 74 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 52 -35 4 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 86 -25 -94 -56 60 -24 -37 -72 -41 -31 11 -48 28 -38 -42 -39 -33 -70 -84 0 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 17 -2 -63 -89 88 13 -58 -82", "output": "89 -64 -51 -75 -98 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 -35 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 -25 -94 -56 -24 -37 -72 -41 -31 -48 -38 -42 -39 -33 -70 -84 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 -2 -63 -89 -58 -82\n10 74 52 4 86 60 11 28 17 88 13\n1 0" }, { "input": "100\n3 -66 -17 54 24 -29 76 89 32 -37 93 -16 99 -25 51 78 23 68 -95 59 18 34 -45 77 9 39 -10 19 8 73 -5 60 12 31 0 2 26 40 48 30 52 49 27 4 87 57 85 58 -61 50 83 80 69 67 91 97 -96 11 100 56 82 53 13 -92 -72 70 1 -94 -63 47 21 14 74 7 6 33 55 65 64 -41 81 42 36 28 38 20 43 71 90 -88 22 84 -86 15 75 62 44 35 98 46", "output": "19 -66 -17 -29 -37 -16 -25 -95 -45 -10 -5 -61 -96 -92 -72 -94 -63 -41 -88 -86\n80 3 54 24 76 89 32 93 99 51 78 23 68 59 18 34 77 9 39 19 8 73 60 12 31 2 26 40 48 30 52 49 27 4 87 57 85 58 50 83 80 69 67 91 97 11 100 56 82 53 13 70 1 47 21 14 74 7 6 33 55 65 64 81 42 36 28 38 20 43 71 90 22 84 15 75 62 44 35 98 46\n1 0" }, { "input": "100\n-17 16 -70 32 -60 75 -100 -9 -68 -30 -42 86 -88 -98 -47 -5 58 -14 -94 -73 -80 -51 -66 -85 -53 49 -25 -3 -45 -69 -11 -64 83 74 -65 67 13 -91 81 6 -90 -54 -12 -39 0 -24 -71 -41 -44 57 -93 -20 -92 18 -43 -52 -55 -84 -89 -19 40 -4 -99 -26 -87 -36 -56 -61 -62 37 -95 -28 63 23 35 -82 1 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 46 -15 -48 -34 -59 -7 -29 50 -33 -72 -79 22 38", "output": "75 -17 -70 -60 -100 -9 -68 -30 -42 -88 -98 -47 -5 -14 -94 -73 -80 -51 -66 -85 -53 -25 -3 -45 -69 -11 -64 -65 -91 -90 -54 -12 -39 -24 -71 -41 -44 -93 -20 -92 -43 -52 -55 -84 -89 -19 -4 -99 -26 -87 -36 -56 -61 -62 -95 -28 -82 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 -15 -48 -34 -59 -7 -29 -33 -72 -79\n24 16 32 75 86 58 49 83 74 67 13 81 6 57 18 40 37 63 23 35 1 46 50 22 38\n1 0" }, { "input": "100\n-97 -90 61 78 87 -52 -3 65 83 38 30 -60 35 -50 -73 -77 44 -32 -81 17 -67 58 -6 -34 47 -28 71 -45 69 -80 -4 -7 -57 -79 43 -27 -31 29 16 -89 -21 -93 95 -82 74 -5 -70 -20 -18 36 -64 -66 72 53 62 -68 26 15 76 -40 -99 8 59 88 49 -23 9 10 56 -48 -98 0 100 -54 25 94 13 -63 42 39 -1 55 24 -12 75 51 41 84 -96 -85 -2 -92 14 -46 -91 -19 -11 -86 22 -37", "output": "51 -97 -90 -52 -3 -60 -50 -73 -77 -32 -81 -67 -6 -34 -28 -45 -80 -4 -7 -57 -79 -27 -31 -89 -21 -93 -82 -5 -70 -20 -18 -64 -66 -68 -40 -99 -23 -48 -98 -54 -63 -1 -12 -96 -85 -2 -92 -46 -91 -19 -11 -86\n47 61 78 87 65 83 38 30 35 44 17 58 47 71 69 43 29 16 95 74 36 72 53 62 26 15 76 8 59 88 49 9 10 56 100 25 94 13 42 39 55 24 75 51 41 84 14 22\n2 0 -37" }, { "input": "100\n-75 -60 -18 -92 -71 -9 -37 -34 -82 28 -54 93 -83 -76 -58 -88 -17 -97 64 -39 -96 -81 -10 -98 -47 -100 -22 27 14 -33 -19 -99 87 -66 57 -21 -90 -70 -32 -26 24 -77 -74 13 -44 16 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 69 0 -20 -79 59 -48 -4 -72 -67 -46 62 51 -52 -86 -40 56 -53 85 -35 -8 49 50 65 29 11 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 78 94 -23 -63 84 89 -61", "output": "73 -75 -60 -18 -92 -71 -9 -37 -34 -82 -54 -83 -76 -58 -88 -17 -97 -39 -96 -81 -10 -98 -47 -100 -22 -33 -19 -99 -66 -21 -90 -70 -32 -26 -77 -74 -44 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 -20 -79 -48 -4 -72 -67 -46 -52 -86 -40 -53 -35 -8 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 -23 -63\n25 28 93 64 27 14 87 57 24 13 16 69 59 62 51 56 85 49 50 65 29 11 78 94 84 89\n2 0 -61" }, { "input": "100\n-87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 49 38 -20 -45 -64 44 -96 -35 -74 -65 -41 -21 -75 37 -12 -67 0 -3 5 -80 -93 -81 -97 -47 -63 53 -100 95 -79 -83 -90 -32 88 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 60 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 8 -72 18 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 84 -86 -7 -57 -14 40 -33 51 -26 46 59 -31 -58 -66", "output": "83 -87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 -20 -45 -64 -96 -35 -74 -65 -41 -21 -75 -12 -67 -3 -80 -93 -81 -97 -47 -63 -100 -79 -83 -90 -32 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 -72 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 -86 -7 -57 -14 -33 -26 -31 -58 -66\n16 49 38 44 37 5 53 95 88 60 8 18 84 40 51 46 59\n1 0" }, { "input": "100\n-95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 77 -69 -10 -12 -78 -14 -52 -57 -40 -75 4 -98 -6 7 -53 -3 -90 -63 -8 -20 88 -91 -32 -76 -80 -97 -34 -27 -19 0 70 -38 -9 -49 -67 73 -36 2 81 -39 -65 -83 -64 -18 -94 -79 -58 -16 87 -22 -74 -25 -13 -46 -89 -47 5 -15 -54 -99 56 -30 -60 -21 -86 33 -1 -50 -68 -100 -85 -29 92 -48 -61 42 -84 -93 -41 -82", "output": "85 -95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 -69 -10 -12 -78 -14 -52 -57 -40 -75 -98 -6 -53 -3 -90 -63 -8 -20 -91 -32 -76 -80 -97 -34 -27 -19 -38 -9 -49 -67 -36 -39 -65 -83 -64 -18 -94 -79 -58 -16 -22 -74 -25 -13 -46 -89 -47 -15 -54 -99 -30 -60 -21 -86 -1 -50 -68 -100 -85 -29 -48 -61 -84 -93 -41 -82\n14 77 4 7 88 70 73 2 81 87 5 56 33 92 42\n1 0" }, { "input": "100\n-12 -41 57 13 83 -36 53 69 -6 86 -75 87 11 -5 -4 -14 -37 -84 70 2 -73 16 31 34 -45 94 -9 26 27 52 -42 46 96 21 32 7 -18 61 66 -51 95 -48 -76 90 80 -40 89 77 78 54 -30 8 88 33 -24 82 -15 19 1 59 44 64 -97 -60 43 56 35 47 39 50 29 28 -17 -67 74 23 85 -68 79 0 65 55 -3 92 -99 72 93 -71 38 -10 -100 -98 81 62 91 -63 -58 49 -20 22", "output": "35 -12 -41 -36 -6 -75 -5 -4 -14 -37 -84 -73 -45 -9 -42 -18 -51 -48 -76 -40 -30 -24 -15 -97 -60 -17 -67 -68 -3 -99 -71 -10 -100 -98 -63 -58\n63 57 13 83 53 69 86 87 11 70 2 16 31 34 94 26 27 52 46 96 21 32 7 61 66 95 90 80 89 77 78 54 8 88 33 82 19 1 59 44 64 43 56 35 47 39 50 29 28 74 23 85 79 65 55 92 72 93 38 81 62 91 49 22\n2 0 -20" }, { "input": "100\n-34 81 85 -96 50 20 54 86 22 10 -19 52 65 44 30 53 63 71 17 98 -92 4 5 -99 89 -23 48 9 7 33 75 2 47 -56 42 70 -68 57 51 83 82 94 91 45 46 25 95 11 -12 62 -31 -87 58 38 67 97 -60 66 73 -28 13 93 29 59 -49 77 37 -43 -27 0 -16 72 15 79 61 78 35 21 3 8 84 1 -32 36 74 -88 26 100 6 14 40 76 18 90 24 69 80 64 55 41", "output": "19 -34 -96 -19 -92 -99 -23 -56 -68 -12 -31 -87 -60 -28 -49 -43 -27 -16 -32 -88\n80 81 85 50 20 54 86 22 10 52 65 44 30 53 63 71 17 98 4 5 89 48 9 7 33 75 2 47 42 70 57 51 83 82 94 91 45 46 25 95 11 62 58 38 67 97 66 73 13 93 29 59 77 37 72 15 79 61 78 35 21 3 8 84 1 36 74 26 100 6 14 40 76 18 90 24 69 80 64 55 41\n1 0" }, { "input": "100\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952 -935", "output": "97 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983\n2 -935 -952\n1 0" }, { "input": "99\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952", "output": "95 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941\n2 -952 -983\n2 0 -961" }, { "input": "59\n-990 -876 -641 -726 718 -53 803 -954 894 -265 -587 -665 904 349 754 -978 441 794 -768 -428 -569 -476 188 -620 -290 -333 45 705 -201 109 165 446 13 122 714 -562 -15 -86 -960 43 329 578 287 -776 -14 -71 915 886 -259 337 -495 913 -498 -669 -673 818 225 647 0", "output": "29 -990 -876 -641 -726 -53 -954 -265 -587 -665 -978 -768 -428 -569 -476 -620 -290 -333 -201 -562 -15 -86 -960 -776 -14 -71 -259 -495 -498 -669\n28 718 803 894 904 349 754 441 794 188 45 705 109 165 446 13 122 714 43 329 578 287 915 886 337 913 818 225 647\n2 0 -673" }, { "input": "64\n502 885 -631 -906 735 687 642 -29 -696 -165 -524 15 -129 -663 -846 -501 -651 895 -341 -833 -142 33 -847 688 945 -192 -587 -930 603 849 736 676 788 256 863 -509 319 -49 -807 -158 218 -886 -143 -639 118 -156 -291 325 892 -916 -622 -960 -959 -731 -943 436 -535 861 745 589 -159 376 -182 0", "output": "35 -631 -906 -29 -696 -165 -524 -129 -663 -846 -501 -651 -341 -833 -142 -847 -192 -587 -930 -509 -49 -807 -158 -886 -143 -639 -156 -291 -916 -622 -960 -959 -731 -943 -535 -159\n27 502 885 735 687 642 15 895 33 688 945 603 849 736 676 788 256 863 319 218 118 325 892 436 861 745 589 376\n2 0 -182" }, { "input": "5\n-1 -2 -3 -4 0", "output": "1 -1\n2 -4 -3\n2 0 -2" }, { "input": "3\n-101 101 0", "output": "1 -101\n1 101\n1 0" }, { "input": "21\n-100 -200 -300 -400 -500 -600 -700 -800 -900 -1000 0 100 200 300 400 500 600 700 800 900 1000", "output": "9 -100 -200 -300 -400 -500 -600 -700 -800 -900\n10 100 200 300 400 500 600 700 800 900 1000\n2 0 -1000" }, { "input": "4\n0 -1 -2 -3", "output": "1 -1\n2 -3 -2\n1 0" } ]
1,675,623,618
2,147,483,647
Python 3
OK
TESTS
20
92
0
n = int(input()) num_arr = list(map(int, input().split())) arr_neg = [] arr_pos = [] arr_zero = [] num_neg = 1 ind = 0 while len(arr_neg)==0: if num_arr[ind]<0: arr_neg.append(num_arr[ind]) num_arr.pop(ind) ind+=1 num_pos = 0 for elem in num_arr: if elem > 0: arr_pos.append(elem) num_arr.remove(elem) num_pos+=1 if num_pos == 0: count_neg = 0 for elem in num_arr: if elem < 0 and count_neg!=2: arr_pos.append(elem) num_pos+=1 count_neg+=1 for elem in arr_pos: num_arr.remove(elem) num_zero = 0 for elem in num_arr: arr_zero.append(elem) num_zero+=1 print(num_neg, *arr_neg) print(num_pos, *arr_pos) print(num_zero, *arr_zero)
Title: Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold: 1. The product of all numbers in the first set is less than zero (<=&lt;<=0). 1. The product of all numbers in the second set is greater than zero (<=&gt;<=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set. Help Vitaly. Divide the given array. Input Specification: The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements. Output Specification: In the first line print integer *n*1 (*n*1<=&gt;<=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set. In the next line print integer *n*2 (*n*2<=&gt;<=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set. In the next line print integer *n*3 (*n*3<=&gt;<=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set. The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them. Demo Input: ['3\n-1 2 0\n', '4\n-1 -2 -3 0\n'] Demo Output: ['1 -1\n1 2\n1 0\n', '1 -1\n2 -3 -2\n1 0\n'] Note: none
```python n = int(input()) num_arr = list(map(int, input().split())) arr_neg = [] arr_pos = [] arr_zero = [] num_neg = 1 ind = 0 while len(arr_neg)==0: if num_arr[ind]<0: arr_neg.append(num_arr[ind]) num_arr.pop(ind) ind+=1 num_pos = 0 for elem in num_arr: if elem > 0: arr_pos.append(elem) num_arr.remove(elem) num_pos+=1 if num_pos == 0: count_neg = 0 for elem in num_arr: if elem < 0 and count_neg!=2: arr_pos.append(elem) num_pos+=1 count_neg+=1 for elem in arr_pos: num_arr.remove(elem) num_zero = 0 for elem in num_arr: arr_zero.append(elem) num_zero+=1 print(num_neg, *arr_neg) print(num_pos, *arr_pos) print(num_zero, *arr_zero) ```
3
155
A
I_love_\%username\%
PROGRAMMING
800
[ "brute force" ]
null
null
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him. One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously). Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated. The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
[ "5\n100 50 200 150 200\n", "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n" ]
[ "2\n", "4\n" ]
In the first sample the performances number 2 and 3 are amazing. In the second sample the performances number 2, 4, 9 and 10 are amazing.
500
[ { "input": "5\n100 50 200 150 200", "output": "2" }, { "input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242", "output": "4" }, { "input": "1\n6", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "5\n100 36 53 7 81", "output": "2" }, { "input": "5\n7 36 53 81 100", "output": "4" }, { "input": "5\n100 81 53 36 7", "output": "4" }, { "input": "10\n8 6 3 4 9 10 7 7 1 3", "output": "5" }, { "input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862", "output": "6" }, { "input": "10\n1 3 3 4 6 7 7 8 9 10", "output": "7" }, { "input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137", "output": "9" }, { "input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198", "output": "5" }, { "input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101", "output": "5" }, { "input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498", "output": "7" }, { "input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679", "output": "9" }, { "input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992", "output": "57" }, { "input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83", "output": "4" }, { "input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901", "output": "57" }, { "input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100", "output": "99" }, { "input": "2\n0 10000", "output": "1" }, { "input": "2\n5 5", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n10 10", "output": "0" }, { "input": "1\n0", "output": "0" } ]
1,692,710,193
2,147,483,647
Python 3
OK
TESTS
37
92
0
t = int(input()) arr = list(map(int, input().split())) min_ = arr[0] count_ = 0 max_ = arr[0] for i in range(0, t): if arr[i] > max_: count_ += 1 max_ = arr[i] elif arr[i] < min_: min_ = arr[i] count_ += 1 elif min_ <= arr[i] <= max_: continue print(count_)
Title: I_love_\%username\% Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him. One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously). Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him. Input Specification: The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated. The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000. Output Specification: Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests. Demo Input: ['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n'] Demo Output: ['2\n', '4\n'] Note: In the first sample the performances number 2 and 3 are amazing. In the second sample the performances number 2, 4, 9 and 10 are amazing.
```python t = int(input()) arr = list(map(int, input().split())) min_ = arr[0] count_ = 0 max_ = arr[0] for i in range(0, t): if arr[i] > max_: count_ += 1 max_ = arr[i] elif arr[i] < min_: min_ = arr[i] count_ += 1 elif min_ <= arr[i] <= max_: continue print(count_) ```
3
509
A
Maximum in Table
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
An *n*<=×<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Print a single line containing a positive integer *m* — the maximum value in the table.
[ "1\n", "5\n" ]
[ "1", "70" ]
In the second test the rows of the table look as follows:
0
[ { "input": "1", "output": "1" }, { "input": "5", "output": "70" }, { "input": "2", "output": "2" }, { "input": "3", "output": "6" }, { "input": "4", "output": "20" }, { "input": "6", "output": "252" }, { "input": "7", "output": "924" }, { "input": "9", "output": "12870" }, { "input": "10", "output": "48620" }, { "input": "8", "output": "3432" } ]
1,603,742,122
2,147,483,647
Python 3
OK
TESTS
10
93
0
n = int(input()) lst = [0, 1, 2, 6, 20, 70, 252, 924, 3432, 12870, 48620] print(lst[n])
Title: Maximum in Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: An *n*<=×<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above. Input Specification: The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table. Output Specification: Print a single line containing a positive integer *m* — the maximum value in the table. Demo Input: ['1\n', '5\n'] Demo Output: ['1', '70'] Note: In the second test the rows of the table look as follows:
```python n = int(input()) lst = [0, 1, 2, 6, 20, 70, 252, 924, 3432, 12870, 48620] print(lst[n]) ```
3
617
A
Elephant
PROGRAMMING
800
[ "math" ]
null
null
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
[ "5\n", "12\n" ]
[ "1\n", "3\n" ]
In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
500
[ { "input": "5", "output": "1" }, { "input": "12", "output": "3" }, { "input": "999999", "output": "200000" }, { "input": "41", "output": "9" }, { "input": "1000000", "output": "200000" }, { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "1" }, { "input": "4", "output": "1" }, { "input": "534204", "output": "106841" }, { "input": "469569", "output": "93914" }, { "input": "502877", "output": "100576" }, { "input": "942212", "output": "188443" }, { "input": "97", "output": "20" }, { "input": "53", "output": "11" }, { "input": "89", "output": "18" }, { "input": "574", "output": "115" }, { "input": "716", "output": "144" }, { "input": "729", "output": "146" }, { "input": "8901", "output": "1781" }, { "input": "3645", "output": "729" }, { "input": "4426", "output": "886" }, { "input": "46573", "output": "9315" }, { "input": "86380", "output": "17276" }, { "input": "94190", "output": "18838" }, { "input": "999990", "output": "199998" }, { "input": "999991", "output": "199999" }, { "input": "999992", "output": "199999" }, { "input": "999993", "output": "199999" }, { "input": "999994", "output": "199999" }, { "input": "999995", "output": "199999" }, { "input": "999996", "output": "200000" }, { "input": "999997", "output": "200000" }, { "input": "999998", "output": "200000" } ]
1,695,490,105
2,147,483,647
Python 3
OK
TESTS
34
46
0
a=int(input()) count=0 if (a%5)!=0: count=count+1 a=a/5 count=count+a print(int(count))
Title: Elephant Time Limit: None seconds Memory Limit: None megabytes Problem Description: An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house. Input Specification: The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house. Output Specification: Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*. Demo Input: ['5\n', '12\n'] Demo Output: ['1\n', '3\n'] Note: In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
```python a=int(input()) count=0 if (a%5)!=0: count=count+1 a=a/5 count=count+a print(int(count)) ```
3
535
B
Tavas and SaDDas
PROGRAMMING
1,100
[ "bitmasks", "brute force", "combinatorics", "implementation" ]
null
null
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Print the index of *n* among all lucky numbers.
[ "4\n", "7\n", "77\n" ]
[ "1\n", "2\n", "6\n" ]
none
1,000
[ { "input": "4", "output": "1" }, { "input": "7", "output": "2" }, { "input": "77", "output": "6" }, { "input": "4", "output": "1" }, { "input": "474744", "output": "83" }, { "input": "777774", "output": "125" }, { "input": "447", "output": "8" }, { "input": "774", "output": "13" }, { "input": "4", "output": "1" }, { "input": "4447747", "output": "140" }, { "input": "7747474", "output": "233" }, { "input": "4444", "output": "15" }, { "input": "4447", "output": "16" }, { "input": "7", "output": "2" }, { "input": "4", "output": "1" }, { "input": "4447744", "output": "139" }, { "input": "77474", "output": "57" }, { "input": "7747", "output": "28" }, { "input": "444", "output": "7" }, { "input": "7", "output": "2" }, { "input": "7774477", "output": "242" }, { "input": "4477774", "output": "157" }, { "input": "7444", "output": "23" }, { "input": "7474747", "output": "212" }, { "input": "77", "output": "6" }, { "input": "774477", "output": "114" }, { "input": "7", "output": "2" }, { "input": "47", "output": "4" }, { "input": "747777", "output": "110" }, { "input": "444444444", "output": "511" }, { "input": "777777777", "output": "1022" }, { "input": "477477447", "output": "728" }, { "input": "777744747", "output": "996" } ]
1,565,032,382
2,147,483,647
Python 3
OK
TESTS
33
109
0
''' Created on Aug 5, 2019 @author: Mohamed ''' #x=input() x=input().replace("4", "0").replace("7","1") z=len(x) index=2**z-1 index +=int(x,2) print(index)
Title: Tavas and SaDDas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. Input Specification: The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the index of *n* among all lucky numbers. Demo Input: ['4\n', '7\n', '77\n'] Demo Output: ['1\n', '2\n', '6\n'] Note: none
```python ''' Created on Aug 5, 2019 @author: Mohamed ''' #x=input() x=input().replace("4", "0").replace("7","1") z=len(x) index=2**z-1 index +=int(x,2) print(index) ```
3
760
B
Frodo and pillows
PROGRAMMING
1,500
[ "binary search", "greedy" ]
null
null
*n* hobbits are planning to spend the night at Frodo's house. Frodo has *n* beds standing in a row and *m* pillows (*n*<=≤<=*m*). Each hobbit needs a bed and at least one pillow to sleep, however, everyone wants as many pillows as possible. Of course, it's not always possible to share pillows equally, but any hobbit gets hurt if he has at least two pillows less than some of his neighbors have. Frodo will sleep on the *k*-th bed in the row. What is the maximum number of pillows he can have so that every hobbit has at least one pillow, every pillow is given to some hobbit and no one is hurt?
The only line contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=*m*<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of hobbits, the number of pillows and the number of Frodo's bed.
Print single integer — the maximum number of pillows Frodo can have so that no one is hurt.
[ "4 6 2\n", "3 10 3\n", "3 6 1\n" ]
[ "2\n", "4\n", "3\n" ]
In the first example Frodo can have at most two pillows. In this case, he can give two pillows to the hobbit on the first bed, and one pillow to each of the hobbits on the third and the fourth beds. In the second example Frodo can take at most four pillows, giving three pillows to each of the others. In the third example Frodo can take three pillows, giving two pillows to the hobbit in the middle and one pillow to the hobbit on the third bed.
1,000
[ { "input": "4 6 2", "output": "2" }, { "input": "3 10 3", "output": "4" }, { "input": "3 6 1", "output": "3" }, { "input": "3 3 3", "output": "1" }, { "input": "1 1 1", "output": "1" }, { "input": "1 1000000000 1", "output": "1000000000" }, { "input": "100 1000000000 20", "output": "10000034" }, { "input": "1000 1000 994", "output": "1" }, { "input": "100000000 200000000 54345", "output": "10001" }, { "input": "1000000000 1000000000 1", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 500000000", "output": "1" }, { "input": "1000 1000 3", "output": "1" }, { "input": "100000000 200020000 54345", "output": "10001" }, { "input": "100 108037 18", "output": "1115" }, { "input": "100000000 200020001 54345", "output": "10002" }, { "input": "200 6585 2", "output": "112" }, { "input": "30000 30593 5980", "output": "25" }, { "input": "40000 42107 10555", "output": "46" }, { "input": "50003 50921 192", "output": "31" }, { "input": "100000 113611 24910", "output": "117" }, { "input": "1000000 483447163 83104", "output": "21965" }, { "input": "10000000 10021505 600076", "output": "147" }, { "input": "100000000 102144805 2091145", "output": "1465" }, { "input": "1000000000 1000000000 481982093", "output": "1" }, { "input": "100 999973325 5", "output": "9999778" }, { "input": "200 999999109 61", "output": "5000053" }, { "input": "30000 999999384 5488", "output": "43849" }, { "input": "40000 999997662 8976", "output": "38038" }, { "input": "50003 999999649 405", "output": "44320" }, { "input": "100000 999899822 30885", "output": "31624" }, { "input": "1000000 914032367 528790", "output": "30217" }, { "input": "10000000 999617465 673112", "output": "31459" }, { "input": "100000000 993180275 362942", "output": "29887" }, { "input": "1000000000 1000000000 331431458", "output": "1" }, { "input": "100 10466 89", "output": "144" }, { "input": "200 5701 172", "output": "84" }, { "input": "30000 36932 29126", "output": "84" }, { "input": "40000 40771 22564", "output": "28" }, { "input": "50003 51705 49898", "output": "42" }, { "input": "100000 149408 74707", "output": "223" }, { "input": "1000000 194818222 998601", "output": "18389" }, { "input": "10000000 10748901 8882081", "output": "866" }, { "input": "100000000 106296029 98572386", "output": "2510" }, { "input": "1000000000 1000000000 193988157", "output": "1" }, { "input": "100 999981057 92", "output": "9999852" }, { "input": "200 999989691 199", "output": "5000046" }, { "input": "30000 999995411 24509", "output": "43846" }, { "input": "40000 999998466 30827", "output": "37930" }, { "input": "50003 999997857 48387", "output": "43163" }, { "input": "100000 999731886 98615", "output": "43371" }, { "input": "1000000 523220797 654341", "output": "22853" }, { "input": "10000000 999922591 8157724", "output": "31464" }, { "input": "100000000 999834114 93836827", "output": "29998" }, { "input": "1000000000 1000000000 912549504", "output": "1" }, { "input": "1000 97654978 234", "output": "97976" }, { "input": "1000 97654977 234", "output": "97975" }, { "input": "1000234 97653889 1", "output": "13903" }, { "input": "1000234 97653890 1", "output": "13904" }, { "input": "3450234 97656670 3000000", "output": "9707" }, { "input": "3450234 97656669 3000000", "output": "9706" }, { "input": "3 1000000000 2", "output": "333333334" }, { "input": "2 1000000000 1", "output": "500000000" }, { "input": "2 1000000000 2", "output": "500000000" }, { "input": "3 1000000000 1", "output": "333333334" }, { "input": "3 1000000000 3", "output": "333333334" }, { "input": "2 999999999 1", "output": "500000000" }, { "input": "2 999999999 2", "output": "500000000" }, { "input": "1 999999999 1", "output": "999999999" } ]
1,485,184,037
2,147,483,647
Python 3
OK
TESTS
69
77
4,608,000
n, m, k = list(map(int, input().split())) def cnt(n): return n * (n + 1) // 2 def sum(l, r): if l > r: return 0 d = 0 if l <= 0: d = abs(l) + 1 l = 1 return cnt(r) - cnt(l - 1) + d rt = int(1e9) + 2 lt = 1 while rt - lt > 1: mid = (lt + rt) // 2 total = sum(mid - k + 1, mid) + sum(mid - (n - k), mid - 1) if total <= m: lt = mid else: rt = mid print(lt)
Title: Frodo and pillows Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* hobbits are planning to spend the night at Frodo's house. Frodo has *n* beds standing in a row and *m* pillows (*n*<=≤<=*m*). Each hobbit needs a bed and at least one pillow to sleep, however, everyone wants as many pillows as possible. Of course, it's not always possible to share pillows equally, but any hobbit gets hurt if he has at least two pillows less than some of his neighbors have. Frodo will sleep on the *k*-th bed in the row. What is the maximum number of pillows he can have so that every hobbit has at least one pillow, every pillow is given to some hobbit and no one is hurt? Input Specification: The only line contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=*m*<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of hobbits, the number of pillows and the number of Frodo's bed. Output Specification: Print single integer — the maximum number of pillows Frodo can have so that no one is hurt. Demo Input: ['4 6 2\n', '3 10 3\n', '3 6 1\n'] Demo Output: ['2\n', '4\n', '3\n'] Note: In the first example Frodo can have at most two pillows. In this case, he can give two pillows to the hobbit on the first bed, and one pillow to each of the hobbits on the third and the fourth beds. In the second example Frodo can take at most four pillows, giving three pillows to each of the others. In the third example Frodo can take three pillows, giving two pillows to the hobbit in the middle and one pillow to the hobbit on the third bed.
```python n, m, k = list(map(int, input().split())) def cnt(n): return n * (n + 1) // 2 def sum(l, r): if l > r: return 0 d = 0 if l <= 0: d = abs(l) + 1 l = 1 return cnt(r) - cnt(l - 1) + d rt = int(1e9) + 2 lt = 1 while rt - lt > 1: mid = (lt + rt) // 2 total = sum(mid - k + 1, mid) + sum(mid - (n - k), mid - 1) if total <= m: lt = mid else: rt = mid print(lt) ```
3
431
A
Black Square
PROGRAMMING
800
[ "implementation" ]
null
null
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Print a single integer — the total number of calories that Jury wastes.
[ "1 2 3 4\n123214\n", "1 5 3 2\n11221\n" ]
[ "13\n", "13\n" ]
none
500
[ { "input": "1 2 3 4\n123214", "output": "13" }, { "input": "1 5 3 2\n11221", "output": "13" }, { "input": "5 5 5 1\n3422", "output": "16" }, { "input": "4 3 2 1\n2", "output": "3" }, { "input": "5651 6882 6954 4733\n2442313421", "output": "60055" }, { "input": "0 0 0 0\n4132", "output": "0" }, { "input": "3163 5778 83 7640\n11141442444", "output": "64270" }, { "input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442", "output": "420780" }, { "input": "0 0 0 0\n1", "output": "0" }, { "input": "1 2 3 4\n4", "output": "4" }, { "input": "2343 7653 1242 5432\n1", "output": "2343" }, { "input": "2343 7653 1242 5432\n2", "output": "7653" }, { "input": "2343 7653 1242 5432\n3", "output": "1242" }, { "input": "2343 7653 1242 5432\n4", "output": "5432" }, { "input": "1 2 3 4\n123412", "output": "13" }, { "input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111", "output": "2650" }, { "input": "1 2 3 4\n11111111111111111111111111111111111111111111111111", "output": "50" }, { "input": "1 2 3 4\n23123231321231231231231231221232123121312321", "output": "87" }, { "input": "1 2 3 4\n1111111111111222222222233333333333444444444444444", "output": "126" }, { "input": "2 3 1 4\n121321232412342112312313213123123412131231231232", "output": "105" } ]
1,692,830,056
2,147,483,647
Python 3
OK
TESTS
49
62
2,969,600
list_of_calories=list(map(int,input().split())) the_list=list(map(int,input())) calories=0 for i in the_list: calories+=list_of_calories[i-1] print(calories)
Title: Black Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares? Input Specification: The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip. Output Specification: Print a single integer — the total number of calories that Jury wastes. Demo Input: ['1 2 3 4\n123214\n', '1 5 3 2\n11221\n'] Demo Output: ['13\n', '13\n'] Note: none
```python list_of_calories=list(map(int,input().split())) the_list=list(map(int,input())) calories=0 for i in the_list: calories+=list_of_calories[i-1] print(calories) ```
3
177
A1
Good Matrix Elements
PROGRAMMING
800
[ "implementation" ]
null
null
The Smart Beaver from ABBYY got hooked on square matrices. Now he is busy studying an *n*<=×<=*n* size matrix, where *n* is odd. The Smart Beaver considers the following matrix elements good: - Elements of the main diagonal. - Elements of the secondary diagonal. - Elements of the "middle" row — the row which has exactly rows above it and the same number of rows below it. - Elements of the "middle" column — the column that has exactly columns to the left of it and the same number of columns to the right of it. Help the Smart Beaver count the sum of good elements of the given matrix.
The first line of input data contains a single odd integer *n*. Each of the next *n* lines contains *n* integers *a**ij* (0<=≤<=*a**ij*<=≤<=100) separated by single spaces — the elements of the given matrix. The input limitations for getting 30 points are: - 1<=≤<=*n*<=≤<=5 The input limitations for getting 100 points are: - 1<=≤<=*n*<=≤<=101
Print a single integer — the sum of good matrix elements.
[ "3\n1 2 3\n4 5 6\n7 8 9\n", "5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n" ]
[ "45\n", "17\n" ]
In the first sample all matrix elements will be good. Good elements in the second sample are shown on the figure.
30
[ { "input": "3\n1 2 3\n4 5 6\n7 8 9", "output": "45" }, { "input": "5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1", "output": "17" }, { "input": "1\n3", "output": "3" }, { "input": "5\n27 7 3 11 72\n19 49 68 19 59\n41 25 37 64 65\n8 39 96 62 90\n13 37 43 26 33", "output": "756" }, { "input": "3\n19 7 16\n12 15 5\n15 15 5", "output": "109" }, { "input": "3\n36 4 33\n11 46 32\n20 49 34", "output": "265" }, { "input": "3\n79 91 74\n33 82 22\n18 28 54", "output": "481" }, { "input": "5\n7 0 8 1 7\n5 1 1 0 4\n4 2 8 1 6\n1 2 3 2 7\n6 0 1 9 6", "output": "65" }, { "input": "5\n27 20 28 11 17\n25 21 1 20 14\n14 22 28 1 6\n1 2 23 2 7\n6 0 1 29 6", "output": "225" }, { "input": "5\n57 50 58 41 17\n25 21 1 50 44\n44 22 28 31 36\n31 32 23 32 37\n6 0 31 59 6", "output": "495" }, { "input": "5\n57 80 28 41 47\n85 51 61 50 74\n44 82 28 31 36\n31 32 23 32 37\n66 60 31 59 6", "output": "705" }, { "input": "5\n13 58 10 17 43\n61 73 100 0 9\n52 38 16 22 96\n11 4 14 67 62\n70 89 7 98 83", "output": "708" }, { "input": "5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "5\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "5\n0 1 0 1 0\n0 0 0 0 1\n0 0 5 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "5" }, { "input": "5\n0 0 0 0 1\n0 1 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "3\n0 0 0\n0 0 0\n0 0 0", "output": "0" } ]
1,698,382,344
2,147,483,647
Python 3
OK
TESTS1
17
92
0
a=int(input()) x=[] for i in range(a): y=list(map(int,input().split(" "))) x.append(y) y=0 for i in range(a): for j in range(a): if(i==j): y+=x[i][j] if i+j==a-1: y+=x[i][j] if i==(a-1)//2: y+=x[i][j] if j==(a-1)//2: y+=x[i][j] print(y-3*x[(a-1)//2][(a-1)//2])
Title: Good Matrix Elements Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Smart Beaver from ABBYY got hooked on square matrices. Now he is busy studying an *n*<=×<=*n* size matrix, where *n* is odd. The Smart Beaver considers the following matrix elements good: - Elements of the main diagonal. - Elements of the secondary diagonal. - Elements of the "middle" row — the row which has exactly rows above it and the same number of rows below it. - Elements of the "middle" column — the column that has exactly columns to the left of it and the same number of columns to the right of it. Help the Smart Beaver count the sum of good elements of the given matrix. Input Specification: The first line of input data contains a single odd integer *n*. Each of the next *n* lines contains *n* integers *a**ij* (0<=≤<=*a**ij*<=≤<=100) separated by single spaces — the elements of the given matrix. The input limitations for getting 30 points are: - 1<=≤<=*n*<=≤<=5 The input limitations for getting 100 points are: - 1<=≤<=*n*<=≤<=101 Output Specification: Print a single integer — the sum of good matrix elements. Demo Input: ['3\n1 2 3\n4 5 6\n7 8 9\n', '5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n'] Demo Output: ['45\n', '17\n'] Note: In the first sample all matrix elements will be good. Good elements in the second sample are shown on the figure.
```python a=int(input()) x=[] for i in range(a): y=list(map(int,input().split(" "))) x.append(y) y=0 for i in range(a): for j in range(a): if(i==j): y+=x[i][j] if i+j==a-1: y+=x[i][j] if i==(a-1)//2: y+=x[i][j] if j==(a-1)//2: y+=x[i][j] print(y-3*x[(a-1)//2][(a-1)//2]) ```
3
894
A
QAQ
PROGRAMMING
800
[ "brute force", "dp" ]
null
null
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Print a single integer — the number of subsequences "QAQ" in the string.
[ "QAQAQYSYIOIWIN\n", "QAQQQZZYNOIWIN\n" ]
[ "4\n", "3\n" ]
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
500
[ { "input": "QAQAQYSYIOIWIN", "output": "4" }, { "input": "QAQQQZZYNOIWIN", "output": "3" }, { "input": "QA", "output": "0" }, { "input": "IAQVAQZLQBQVQFTQQQADAQJA", "output": "24" }, { "input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ", "output": "378" }, { "input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ", "output": "1077" }, { "input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA", "output": "568" }, { "input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA", "output": "70" }, { "input": "W", "output": "0" }, { "input": "DBA", "output": "0" }, { "input": "RQAWNACASAAKAGAAAAQ", "output": "10" }, { "input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA", "output": "111" }, { "input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA", "output": "411" }, { "input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ", "output": "625" }, { "input": "QORZOYAQ", "output": "1" }, { "input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA", "output": "13174" }, { "input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT", "output": "10420" }, { "input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ", "output": "12488" }, { "input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA", "output": "9114" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "35937" }, { "input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE", "output": "254" }, { "input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE", "output": "2174" }, { "input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ", "output": "2962" }, { "input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA", "output": "2482" }, { "input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ", "output": "7768" }, { "input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA", "output": "5422" }, { "input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ", "output": "3024" }, { "input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ", "output": "4527" }, { "input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH", "output": "6416" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ", "output": "13136" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA", "output": "14231" }, { "input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "15296" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA", "output": "20825" }, { "input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ", "output": "20825" }, { "input": "Q", "output": "0" }, { "input": "A", "output": "0" }, { "input": "FFF", "output": "0" }, { "input": "AAAAAA", "output": "0" } ]
1,636,631,556
2,147,483,647
Python 3
OK
TESTS
43
46
4,300,800
s = input() q = 0 a = 0 ready = 0 for l in s: if l=="Q": q += 1 ready+=a elif l=="A": a+=q print(ready)
Title: QAQ Time Limit: None seconds Memory Limit: None megabytes Problem Description: "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. Input Specification: The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. Output Specification: Print a single integer — the number of subsequences "QAQ" in the string. Demo Input: ['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n'] Demo Output: ['4\n', '3\n'] Note: In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
```python s = input() q = 0 a = 0 ready = 0 for l in s: if l=="Q": q += 1 ready+=a elif l=="A": a+=q print(ready) ```
3
909
A
Generate Login
PROGRAMMING
1,000
[ "brute force", "greedy", "sortings" ]
null
null
The preferred way to generate user login in Polygon is to concatenate a prefix of the user's first name and a prefix of their last name, in that order. Each prefix must be non-empty, and any of the prefixes can be the full name. Typically there are multiple possible logins for each person. You are given the first and the last name of a user. Return the alphabetically earliest login they can get (regardless of other potential Polygon users). As a reminder, a prefix of a string *s* is its substring which occurs at the beginning of *s*: "a", "ab", "abc" etc. are prefixes of string "{abcdef}" but "b" and 'bc" are not. A string *a* is alphabetically earlier than a string *b*, if *a* is a prefix of *b*, or *a* and *b* coincide up to some position, and then *a* has a letter that is alphabetically earlier than the corresponding letter in *b*: "a" and "ab" are alphabetically earlier than "ac" but "b" and "ba" are alphabetically later than "ac".
The input consists of a single line containing two space-separated strings: the first and the last names. Each character of each string is a lowercase English letter. The length of each string is between 1 and 10, inclusive.
Output a single string — alphabetically earliest possible login formed from these names. The output should be given in lowercase as well.
[ "harry potter\n", "tom riddle\n" ]
[ "hap\n", "tomr\n" ]
none
500
[ { "input": "harry potter", "output": "hap" }, { "input": "tom riddle", "output": "tomr" }, { "input": "a qdpinbmcrf", "output": "aq" }, { "input": "wixjzniiub ssdfodfgap", "output": "wis" }, { "input": "z z", "output": "zz" }, { "input": "ertuyivhfg v", "output": "ertuv" }, { "input": "asdfghjkli ware", "output": "asdfghjkliw" }, { "input": "udggmyop ze", "output": "udggmyopz" }, { "input": "fapkdme rtzxovx", "output": "fapkdmer" }, { "input": "mybiqxmnqq l", "output": "ml" }, { "input": "dtbqya fyyymv", "output": "df" }, { "input": "fyclu zokbxiahao", "output": "fycluz" }, { "input": "qngatnviv rdych", "output": "qngar" }, { "input": "ttvnhrnng lqkfulhrn", "output": "tl" }, { "input": "fya fgx", "output": "ff" }, { "input": "nuis zvjjqlre", "output": "nuisz" }, { "input": "ly qtsmze", "output": "lq" }, { "input": "d kgfpjsurfw", "output": "dk" }, { "input": "lwli ewrpu", "output": "le" }, { "input": "rr wldsfubcs", "output": "rrw" }, { "input": "h qart", "output": "hq" }, { "input": "vugvblnzx kqdwdulm", "output": "vk" }, { "input": "xohesmku ef", "output": "xe" }, { "input": "twvvsl wtcyawv", "output": "tw" }, { "input": "obljndajv q", "output": "obljndajq" }, { "input": "jjxwj kxccwx", "output": "jjk" }, { "input": "sk fftzmv", "output": "sf" }, { "input": "cgpegngs aufzxkyyrw", "output": "ca" }, { "input": "reyjzjdvq skuch", "output": "res" }, { "input": "ardaae mxgdulijf", "output": "am" }, { "input": "bgopsdfji uaps", "output": "bgopsdfjiu" }, { "input": "amolfed pun", "output": "amolfedp" }, { "input": "badkiln yort", "output": "badkilny" }, { "input": "aaaaaaaaaz york", "output": "aaaaaaaaay" }, { "input": "bbbbcbbbbd c", "output": "bbbbc" }, { "input": "aa ab", "output": "aa" }, { "input": "ab b", "output": "ab" }, { "input": "aaaaa ab", "output": "aa" }, { "input": "aa a", "output": "aa" }, { "input": "aba b", "output": "ab" }, { "input": "aaaaaaa aaaaaa", "output": "aa" }, { "input": "a a", "output": "aa" }, { "input": "a aa", "output": "aa" }, { "input": "a b", "output": "ab" }, { "input": "b a", "output": "ba" }, { "input": "z a", "output": "za" }, { "input": "aaa a", "output": "aa" }, { "input": "aa aa", "output": "aa" }, { "input": "a aaa", "output": "aa" }, { "input": "aaaaaaaaaa aaaaaaaaaa", "output": "aa" }, { "input": "aaaaaaaaaa a", "output": "aa" }, { "input": "a aaaaaaaaaa", "output": "aa" }, { "input": "zzaa b", "output": "zb" }, { "input": "ca cf", "output": "cac" }, { "input": "abhi ia", "output": "abhi" }, { "input": "aaaa aaaab", "output": "aa" }, { "input": "aar raa", "output": "aar" }, { "input": "harry hotter", "output": "hah" }, { "input": "aaaaaaa a", "output": "aa" }, { "input": "apple pie", "output": "ap" }, { "input": "aaa aaa", "output": "aa" }, { "input": "kabc buba", "output": "kab" }, { "input": "asd ss", "output": "as" }, { "input": "bbb b", "output": "bb" } ]
1,514,968,655
2,147,483,647
Python 3
OK
TESTS
64
61
5,529,600
A, B = input().split() ans = "" ans+=A[0] for i in range(1,len(A)): if (A[i] < B[0]): ans+=A[i] else : break ; ans += B[0] print(ans)
Title: Generate Login Time Limit: None seconds Memory Limit: None megabytes Problem Description: The preferred way to generate user login in Polygon is to concatenate a prefix of the user's first name and a prefix of their last name, in that order. Each prefix must be non-empty, and any of the prefixes can be the full name. Typically there are multiple possible logins for each person. You are given the first and the last name of a user. Return the alphabetically earliest login they can get (regardless of other potential Polygon users). As a reminder, a prefix of a string *s* is its substring which occurs at the beginning of *s*: "a", "ab", "abc" etc. are prefixes of string "{abcdef}" but "b" and 'bc" are not. A string *a* is alphabetically earlier than a string *b*, if *a* is a prefix of *b*, or *a* and *b* coincide up to some position, and then *a* has a letter that is alphabetically earlier than the corresponding letter in *b*: "a" and "ab" are alphabetically earlier than "ac" but "b" and "ba" are alphabetically later than "ac". Input Specification: The input consists of a single line containing two space-separated strings: the first and the last names. Each character of each string is a lowercase English letter. The length of each string is between 1 and 10, inclusive. Output Specification: Output a single string — alphabetically earliest possible login formed from these names. The output should be given in lowercase as well. Demo Input: ['harry potter\n', 'tom riddle\n'] Demo Output: ['hap\n', 'tomr\n'] Note: none
```python A, B = input().split() ans = "" ans+=A[0] for i in range(1,len(A)): if (A[i] < B[0]): ans+=A[i] else : break ; ans += B[0] print(ans) ```
3
559
B
Equivalent Strings
PROGRAMMING
1,700
[ "divide and conquer", "hashing", "sortings", "strings" ]
null
null
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn!
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
[ "aaba\nabaa\n", "aabb\nabab\n" ]
[ "YES\n", "NO\n" ]
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
1,000
[ { "input": "aaba\nabaa", "output": "YES" }, { "input": "aabb\nabab", "output": "NO" }, { "input": "a\na", "output": "YES" }, { "input": "a\nb", "output": "NO" }, { "input": "ab\nab", "output": "YES" }, { "input": "ab\nba", "output": "YES" }, { "input": "ab\nbb", "output": "NO" }, { "input": "zzaa\naazz", "output": "YES" }, { "input": "azza\nzaaz", "output": "YES" }, { "input": "abc\nabc", "output": "YES" }, { "input": "abc\nacb", "output": "NO" }, { "input": "azzz\nzzaz", "output": "YES" }, { "input": "abcd\ndcab", "output": "YES" }, { "input": "abcd\ncdab", "output": "YES" }, { "input": "abcd\ndcba", "output": "YES" }, { "input": "abcd\nacbd", "output": "NO" }, { "input": "oloaxgddgujq\noloaxgujqddg", "output": "YES" }, { "input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta", "output": "YES" }, { "input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz", "output": "YES" }, { "input": "snyaydaeobufdg\nsnyaydaeobufdg", "output": "YES" }, { "input": "baaaaa\nabaaaa", "output": "NO" }, { "input": "hhiisug\nmzdjwju", "output": "NO" }, { "input": "bbbabbabaaab\naaaabbabbbbb", "output": "NO" }, { "input": "bbaaab\naababb", "output": "NO" }, { "input": "aabbaaaa\naaaaabab", "output": "NO" }, { "input": "aab\naba", "output": "NO" }, { "input": "abcddd\nbacddd", "output": "NO" }, { "input": "qgiufelsfhanx\naaaaaaaaaaaaa", "output": "NO" }, { "input": "aabaababaaba\naababaaababa", "output": "NO" }, { "input": "nocdqzdriyyil\naaaaaaaaaaaaa", "output": "NO" }, { "input": "zdmctxl\nkojqhgw", "output": "NO" }, { "input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw", "output": "NO" }, { "input": "abc\nbac", "output": "NO" }, { "input": "ottceez\npcstdvz", "output": "NO" } ]
1,696,598,327
2,147,483,647
Python 3
OK
TESTS
104
452
30,412,800
def generate_partition(s): length = len(s) return sorted([ generate_partition( s[:length//2] ), generate_partition( s[length//2:] ) ]) if length % 2 == 0 else s string1 = input() string2 = input() if generate_partition(string1) == generate_partition(string2): print('YES') else: print('NO')
Title: Equivalent Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn! Input Specification: The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length. Output Specification: Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise. Demo Input: ['aaba\nabaa\n', 'aabb\nabab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
```python def generate_partition(s): length = len(s) return sorted([ generate_partition( s[:length//2] ), generate_partition( s[length//2:] ) ]) if length % 2 == 0 else s string1 = input() string2 = input() if generate_partition(string1) == generate_partition(string2): print('YES') else: print('NO') ```
3
858
A
k-rounding
PROGRAMMING
1,100
[ "brute force", "math", "number theory" ]
null
null
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*. For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375. Write a program that will perform the *k*-rounding of *n*.
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Print the *k*-rounding of *n*.
[ "375 4\n", "10000 1\n", "38101 0\n", "123456789 8\n" ]
[ "30000\n", "10000\n", "38101\n", "12345678900000000\n" ]
none
750
[ { "input": "375 4", "output": "30000" }, { "input": "10000 1", "output": "10000" }, { "input": "38101 0", "output": "38101" }, { "input": "123456789 8", "output": "12345678900000000" }, { "input": "1 0", "output": "1" }, { "input": "2 0", "output": "2" }, { "input": "100 0", "output": "100" }, { "input": "1000000000 0", "output": "1000000000" }, { "input": "160 2", "output": "800" }, { "input": "3 0", "output": "3" }, { "input": "10 0", "output": "10" }, { "input": "1 1", "output": "10" }, { "input": "2 1", "output": "10" }, { "input": "3 1", "output": "30" }, { "input": "4 1", "output": "20" }, { "input": "5 1", "output": "10" }, { "input": "6 1", "output": "30" }, { "input": "7 1", "output": "70" }, { "input": "8 1", "output": "40" }, { "input": "9 1", "output": "90" }, { "input": "10 1", "output": "10" }, { "input": "11 1", "output": "110" }, { "input": "12 1", "output": "60" }, { "input": "16 2", "output": "400" }, { "input": "2 2", "output": "100" }, { "input": "1 2", "output": "100" }, { "input": "5 2", "output": "100" }, { "input": "15 2", "output": "300" }, { "input": "36 2", "output": "900" }, { "input": "1 8", "output": "100000000" }, { "input": "8 8", "output": "100000000" }, { "input": "96 8", "output": "300000000" }, { "input": "175 8", "output": "700000000" }, { "input": "9999995 8", "output": "199999900000000" }, { "input": "999999999 8", "output": "99999999900000000" }, { "input": "12345678 8", "output": "617283900000000" }, { "input": "78125 8", "output": "100000000" }, { "input": "390625 8", "output": "100000000" }, { "input": "1953125 8", "output": "500000000" }, { "input": "9765625 8", "output": "2500000000" }, { "input": "68359375 8", "output": "17500000000" }, { "input": "268435456 8", "output": "104857600000000" }, { "input": "125829120 8", "output": "9830400000000" }, { "input": "128000 8", "output": "400000000" }, { "input": "300000 8", "output": "300000000" }, { "input": "3711871 8", "output": "371187100000000" }, { "input": "55555 8", "output": "1111100000000" }, { "input": "222222222 8", "output": "11111111100000000" }, { "input": "479001600 8", "output": "7484400000000" }, { "input": "655360001 7", "output": "6553600010000000" }, { "input": "655360001 8", "output": "65536000100000000" }, { "input": "1000000000 1", "output": "1000000000" }, { "input": "1000000000 7", "output": "1000000000" }, { "input": "1000000000 8", "output": "1000000000" }, { "input": "100000000 8", "output": "100000000" }, { "input": "10000000 8", "output": "100000000" }, { "input": "1000000 8", "output": "100000000" }, { "input": "10000009 8", "output": "1000000900000000" }, { "input": "10000005 8", "output": "200000100000000" }, { "input": "10000002 8", "output": "500000100000000" }, { "input": "999999997 8", "output": "99999999700000000" }, { "input": "999999997 7", "output": "9999999970000000" }, { "input": "999999995 8", "output": "19999999900000000" }, { "input": "123 8", "output": "12300000000" }, { "input": "24 2", "output": "600" }, { "input": "16 4", "output": "10000" }, { "input": "123456787 8", "output": "12345678700000000" }, { "input": "100000000 8", "output": "100000000" }, { "input": "7 1", "output": "70" }, { "input": "101 1", "output": "1010" }, { "input": "50 2", "output": "100" }, { "input": "999999818 1", "output": "4999999090" }, { "input": "2 1", "output": "10" }, { "input": "123 1", "output": "1230" }, { "input": "16 1", "output": "80" }, { "input": "1 1", "output": "10" }, { "input": "1000000000 8", "output": "1000000000" }, { "input": "15304 6", "output": "1913000000" }, { "input": "3 8", "output": "300000000" }, { "input": "4 2", "output": "100" }, { "input": "100000 7", "output": "10000000" }, { "input": "5 8", "output": "100000000" }, { "input": "16724 6", "output": "4181000000" }, { "input": "999999999 1", "output": "9999999990" }, { "input": "999999990 8", "output": "9999999900000000" }, { "input": "999999999 8", "output": "99999999900000000" }, { "input": "100000 1", "output": "100000" }, { "input": "8 3", "output": "1000" }, { "input": "16768 6", "output": "262000000" }, { "input": "123456789 1", "output": "1234567890" }, { "input": "2 8", "output": "100000000" }, { "input": "999999937 8", "output": "99999993700000000" }, { "input": "5 1", "output": "10" }, { "input": "2000000 7", "output": "10000000" }, { "input": "1999998 2", "output": "99999900" }, { "input": "125 3", "output": "1000" } ]
1,532,239,337
2,147,483,647
Python 3
OK
TESTS
96
124
0
n, k = map(int,input().split()) cnt=0 while cnt<k: if n%10==0: n/=10 cnt+=1 elif n%5==0: n*=2 elif n%2==0: n*=5 else: n*=10 n*=pow(10,cnt) print(int(n))
Title: k-rounding Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*. For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375. Write a program that will perform the *k*-rounding of *n*. Input Specification: The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8). Output Specification: Print the *k*-rounding of *n*. Demo Input: ['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n'] Demo Output: ['30000\n', '10000\n', '38101\n', '12345678900000000\n'] Note: none
```python n, k = map(int,input().split()) cnt=0 while cnt<k: if n%10==0: n/=10 cnt+=1 elif n%5==0: n*=2 elif n%2==0: n*=5 else: n*=10 n*=pow(10,cnt) print(int(n)) ```
3
991
B
Getting an A
PROGRAMMING
900
[ "greedy", "sortings" ]
null
null
Translator's note: in Russia's most widespread grading system, there are four grades: 5, 4, 3, 2, the higher the better, roughly corresponding to A, B, C and F respectively in American grading system. The term is coming to an end and students start thinking about their grades. Today, a professor told his students that the grades for his course would be given out automatically  — he would calculate the simple average (arithmetic mean) of all grades given out for lab works this term and round to the nearest integer. The rounding would be done in favour of the student — $4.5$ would be rounded up to $5$ (as in example 3), but $4.4$ would be rounded down to $4$. This does not bode well for Vasya who didn't think those lab works would influence anything, so he may receive a grade worse than $5$ (maybe even the dreaded $2$). However, the professor allowed him to redo some of his works of Vasya's choosing to increase his average grade. Vasya wants to redo as as few lab works as possible in order to get $5$ for the course. Of course, Vasya will get $5$ for the lab works he chooses to redo. Help Vasya — calculate the minimum amount of lab works Vasya has to redo.
The first line contains a single integer $n$ — the number of Vasya's grades ($1 \leq n \leq 100$). The second line contains $n$ integers from $2$ to $5$ — Vasya's grades for his lab works.
Output a single integer — the minimum amount of lab works that Vasya has to redo. It can be shown that Vasya can always redo enough lab works to get a $5$.
[ "3\n4 4 4\n", "4\n5 4 5 5\n", "4\n5 3 3 5\n" ]
[ "2\n", "0\n", "1\n" ]
In the first sample, it is enough to redo two lab works to make two $4$s into $5$s. In the second sample, Vasya's average is already $4.75$ so he doesn't have to redo anything to get a $5$. In the second sample Vasya has to redo one lab work to get rid of one of the $3$s, that will make the average exactly $4.5$ so the final grade would be $5$.
1,000
[ { "input": "3\n4 4 4", "output": "2" }, { "input": "4\n5 4 5 5", "output": "0" }, { "input": "4\n5 3 3 5", "output": "1" }, { "input": "1\n5", "output": "0" }, { "input": "4\n3 2 5 4", "output": "2" }, { "input": "5\n5 4 3 2 5", "output": "2" }, { "input": "8\n5 4 2 5 5 2 5 5", "output": "1" }, { "input": "5\n5 5 2 5 5", "output": "1" }, { "input": "6\n5 5 5 5 5 2", "output": "0" }, { "input": "6\n2 2 2 2 2 2", "output": "5" }, { "input": "100\n3 2 4 3 3 3 4 2 3 5 5 2 5 2 3 2 4 4 4 5 5 4 2 5 4 3 2 5 3 4 3 4 2 4 5 4 2 4 3 4 5 2 5 3 3 4 2 2 4 4 4 5 4 3 3 3 2 5 2 2 2 3 5 4 3 2 4 5 5 5 2 2 4 2 3 3 3 5 3 2 2 4 5 5 4 5 5 4 2 3 2 2 2 2 5 3 5 2 3 4", "output": "40" }, { "input": "1\n2", "output": "1" }, { "input": "1\n3", "output": "1" }, { "input": "1\n4", "output": "1" }, { "input": "4\n3 2 5 5", "output": "1" }, { "input": "6\n4 3 3 3 3 4", "output": "4" }, { "input": "8\n3 3 5 3 3 3 5 5", "output": "3" }, { "input": "10\n2 4 5 5 5 5 2 3 3 2", "output": "3" }, { "input": "20\n5 2 5 2 2 2 2 2 5 2 2 5 2 5 5 2 2 5 2 2", "output": "10" }, { "input": "25\n4 4 4 4 3 4 3 3 3 3 3 4 4 3 4 4 4 4 4 3 3 3 4 3 4", "output": "13" }, { "input": "30\n4 2 4 2 4 2 2 4 4 4 4 2 4 4 4 2 2 2 2 4 2 4 4 4 2 4 2 4 2 2", "output": "15" }, { "input": "52\n5 3 4 4 4 3 5 3 4 5 3 4 4 3 5 5 4 3 3 3 4 5 4 4 5 3 5 3 5 4 5 5 4 3 4 5 3 4 3 3 4 4 4 3 5 3 4 5 3 5 4 5", "output": "14" }, { "input": "77\n5 3 2 3 2 3 2 3 5 2 2 3 3 3 3 5 3 3 2 2 2 5 5 5 5 3 2 2 5 2 3 2 2 5 2 5 3 3 2 2 5 5 2 3 3 2 3 3 3 2 5 5 2 2 3 3 5 5 2 2 5 5 3 3 5 5 2 2 5 2 2 5 5 5 2 5 2", "output": "33" }, { "input": "55\n3 4 2 3 3 2 4 4 3 3 4 2 4 4 3 3 2 3 2 2 3 3 2 3 2 3 2 4 4 3 2 3 2 3 3 2 2 4 2 4 4 3 4 3 2 4 3 2 4 2 2 3 2 3 4", "output": "34" }, { "input": "66\n5 4 5 5 4 4 4 4 4 2 5 5 2 4 2 2 2 5 4 4 4 4 5 2 2 5 5 2 2 4 4 2 4 2 2 5 2 5 4 5 4 5 4 4 2 5 2 4 4 4 2 2 5 5 5 5 4 4 4 4 4 2 4 5 5 5", "output": "16" }, { "input": "99\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "83" }, { "input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "84" }, { "input": "99\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "75" }, { "input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "75" }, { "input": "99\n2 2 3 3 3 3 3 2 2 3 2 3 2 3 2 2 3 2 3 2 3 3 3 3 2 2 2 2 3 2 3 3 3 3 3 2 3 3 3 3 2 3 2 3 3 3 2 3 2 3 3 3 3 2 2 3 2 3 2 3 2 3 2 2 2 3 3 2 3 2 2 2 2 2 2 2 2 3 3 3 3 2 3 2 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3", "output": "75" }, { "input": "100\n3 2 3 3 2 2 3 2 2 3 3 2 3 2 2 2 2 2 3 2 2 2 3 2 3 3 2 2 3 2 2 2 2 3 2 3 3 2 2 3 2 2 3 2 3 2 2 3 2 3 2 2 3 2 2 3 3 3 3 3 2 2 3 2 3 3 2 2 3 2 2 2 3 2 2 3 3 2 2 3 3 3 3 2 3 2 2 2 3 3 2 2 3 2 2 2 2 3 2 2", "output": "75" }, { "input": "99\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "50" }, { "input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "50" }, { "input": "99\n2 2 2 2 4 2 2 2 2 4 4 4 4 2 4 4 2 2 4 4 2 2 2 4 4 2 4 4 2 4 4 2 2 2 4 4 2 2 2 2 4 4 4 2 2 2 4 4 2 4 2 4 2 2 4 2 4 4 4 4 4 2 2 4 4 4 2 2 2 2 4 2 4 2 2 2 2 2 2 4 4 2 4 2 2 4 2 2 2 2 2 4 2 4 2 2 4 4 4", "output": "54" }, { "input": "100\n4 2 4 4 2 4 2 2 4 4 4 4 4 4 4 4 4 2 4 4 2 2 4 4 2 2 4 4 2 2 2 4 4 2 4 4 2 4 2 2 4 4 2 4 2 4 4 4 2 2 2 2 2 2 2 4 2 2 2 4 4 4 2 2 2 2 4 2 2 2 2 2 2 2 4 4 4 4 4 4 4 4 4 2 2 2 2 2 2 2 2 4 4 4 4 2 4 2 2 4", "output": "50" }, { "input": "99\n4 3 4 4 4 4 4 3 4 3 3 4 3 3 4 4 3 3 3 4 3 4 3 3 4 3 3 3 3 4 3 4 4 3 4 4 3 3 4 4 4 3 3 3 4 4 3 3 4 3 4 3 4 3 4 3 3 3 3 4 3 4 4 4 4 4 4 3 4 4 3 3 3 3 3 3 3 3 4 3 3 3 4 4 4 4 4 4 3 3 3 3 4 4 4 3 3 4 3", "output": "51" }, { "input": "100\n3 3 4 4 4 4 4 3 4 4 3 3 3 3 4 4 4 4 4 4 3 3 3 4 3 4 3 4 3 3 4 3 3 3 3 3 3 3 3 4 3 4 3 3 4 3 3 3 4 4 3 4 4 3 3 4 4 4 4 4 4 3 4 4 3 4 3 3 3 4 4 3 3 4 4 3 4 4 4 3 3 4 3 3 4 3 4 3 4 3 3 4 4 4 3 3 4 3 3 4", "output": "51" }, { "input": "99\n3 3 4 4 4 2 4 4 3 2 3 4 4 4 2 2 2 3 2 4 4 2 4 3 2 2 2 4 2 3 4 3 4 2 3 3 4 2 3 3 2 3 4 4 3 2 4 3 4 3 3 3 3 3 4 4 3 3 4 4 2 4 3 4 3 2 3 3 3 4 4 2 4 4 2 3 4 2 3 3 3 4 2 2 3 2 4 3 2 3 3 2 3 4 2 3 3 2 3", "output": "58" }, { "input": "100\n2 2 4 2 2 3 2 3 4 4 3 3 4 4 4 2 3 2 2 3 4 2 3 2 4 3 4 2 3 3 3 2 4 3 3 2 2 3 2 4 4 2 4 3 4 4 3 3 3 2 4 2 2 2 2 2 2 3 2 3 2 3 4 4 4 2 2 3 4 4 3 4 3 3 2 3 3 3 4 3 2 3 3 2 4 2 3 3 4 4 3 3 4 3 4 3 3 4 3 3", "output": "61" }, { "input": "99\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "99\n2 2 2 2 2 5 2 2 5 2 5 2 5 2 2 2 2 2 5 2 2 2 5 2 2 5 2 2 2 5 5 2 5 2 2 5 2 5 2 2 5 5 2 2 2 2 5 5 2 2 2 5 2 2 5 2 2 2 2 2 5 5 5 5 2 2 5 2 5 2 2 2 2 2 5 2 2 5 5 2 2 2 2 2 5 5 2 2 5 5 2 2 2 2 5 5 5 2 5", "output": "48" }, { "input": "100\n5 5 2 2 2 2 2 2 5 5 2 5 2 2 2 2 5 2 5 2 5 5 2 5 5 2 2 2 2 2 2 5 2 2 2 5 2 2 5 2 2 5 5 5 2 5 5 5 5 5 5 2 2 5 2 2 5 5 5 5 5 2 5 2 5 2 2 2 5 2 5 2 5 5 2 5 5 2 2 5 2 5 5 2 5 2 2 5 2 2 2 5 2 2 2 2 5 5 2 5", "output": "38" }, { "input": "99\n5 3 3 3 5 3 3 3 3 3 3 3 3 5 3 3 3 3 3 3 3 3 5 3 3 3 5 5 3 5 5 3 3 5 5 5 3 5 3 3 3 3 5 3 3 5 5 3 5 5 5 3 5 3 5 3 5 5 5 5 3 3 3 5 3 5 3 3 3 5 5 5 5 5 3 5 5 3 3 5 5 3 5 5 3 5 5 3 3 5 5 5 3 3 3 5 3 3 3", "output": "32" }, { "input": "100\n3 3 3 5 3 3 3 3 3 3 5 5 5 5 3 3 3 3 5 3 3 3 3 3 5 3 5 3 3 5 5 5 5 5 5 3 3 5 3 3 5 3 5 5 5 3 5 3 3 3 3 3 3 3 3 3 3 3 5 5 3 5 3 5 5 3 5 3 3 5 3 5 5 5 5 3 5 3 3 3 5 5 5 3 3 3 5 3 5 5 5 3 3 3 5 3 5 5 3 5", "output": "32" }, { "input": "99\n5 3 5 5 3 3 3 2 2 5 2 5 3 2 5 2 5 2 3 5 3 2 3 2 5 5 2 2 3 3 5 5 3 5 5 2 3 3 5 2 2 5 3 2 5 2 3 5 5 2 5 2 2 5 3 3 5 3 3 5 3 2 3 5 3 2 3 2 3 2 2 2 2 5 2 2 3 2 5 5 5 3 3 2 5 3 5 5 5 2 3 2 5 5 2 5 2 5 3", "output": "39" }, { "input": "100\n3 5 3 3 5 5 3 3 2 5 5 3 3 3 2 2 3 2 5 3 2 2 3 3 3 3 2 5 3 2 3 3 5 2 2 2 3 2 3 5 5 3 2 5 2 2 5 5 3 5 5 5 2 2 5 5 3 3 2 2 2 5 3 3 2 2 3 5 3 2 3 5 5 3 2 3 5 5 3 3 2 3 5 2 5 5 5 5 5 5 3 5 3 2 3 3 2 5 2 2", "output": "42" }, { "input": "99\n4 4 4 5 4 4 5 5 4 4 5 5 5 4 5 4 5 5 5 4 4 5 5 5 5 4 5 5 5 4 4 5 5 4 5 4 4 4 5 5 5 5 4 4 5 4 4 5 4 4 4 4 5 5 5 4 5 4 5 5 5 5 5 4 5 4 5 4 4 4 4 5 5 5 4 5 5 4 4 5 5 5 4 5 4 4 5 5 4 5 5 5 5 4 5 5 4 4 4", "output": "0" }, { "input": "100\n4 4 5 5 5 5 5 5 4 4 5 5 4 4 5 5 4 5 4 4 4 4 4 4 4 4 5 5 5 5 5 4 4 4 4 4 5 4 4 5 4 4 4 5 5 5 4 5 5 5 5 5 5 4 4 4 4 4 4 5 5 4 5 4 4 5 4 4 4 4 5 5 4 5 5 4 4 4 5 5 5 5 4 5 5 5 4 4 5 5 5 4 5 4 5 4 4 5 5 4", "output": "1" }, { "input": "99\n2 2 2 5 2 2 2 2 2 4 4 5 5 2 2 4 2 5 2 2 2 5 2 2 5 5 5 4 5 5 4 4 2 2 5 2 2 2 2 5 5 2 2 4 4 4 2 2 2 5 2 4 4 2 4 2 4 2 5 4 2 2 5 2 4 4 4 2 5 2 2 5 4 2 2 5 5 5 2 4 5 4 5 5 4 4 4 5 4 5 4 5 4 2 5 2 2 2 4", "output": "37" }, { "input": "100\n4 4 5 2 2 5 4 5 2 2 2 4 2 5 4 4 2 2 4 5 2 4 2 5 5 4 2 4 4 2 2 5 4 2 5 4 5 2 5 2 4 2 5 4 5 2 2 2 5 2 5 2 5 2 2 4 4 5 5 5 5 5 5 5 4 2 2 2 4 2 2 4 5 5 4 5 4 2 2 2 2 4 2 2 5 5 4 2 2 5 4 5 5 5 4 5 5 5 2 2", "output": "31" }, { "input": "99\n5 3 4 4 5 4 4 4 3 5 4 3 3 4 3 5 5 5 5 4 3 3 5 3 4 5 3 5 4 4 3 5 5 4 4 4 4 3 5 3 3 5 5 5 5 5 4 3 4 4 3 5 5 3 3 4 4 4 5 4 4 5 4 4 4 4 5 5 4 3 3 4 3 5 3 3 3 3 4 4 4 4 3 4 5 4 4 5 5 5 3 4 5 3 4 5 4 3 3", "output": "24" }, { "input": "100\n5 4 4 4 5 5 5 4 5 4 4 3 3 4 4 4 5 4 5 5 3 5 5 4 5 5 5 4 4 5 3 5 3 5 3 3 5 4 4 5 5 4 5 5 3 4 5 4 4 3 4 4 3 3 5 4 5 4 5 3 4 5 3 4 5 4 3 5 4 5 4 4 4 3 4 5 3 4 3 5 3 4 4 4 3 4 4 5 3 3 4 4 5 5 4 3 4 4 3 5", "output": "19" }, { "input": "99\n2 2 5 2 5 3 4 2 3 5 4 3 4 2 5 3 2 2 4 2 4 4 5 4 4 5 2 5 5 3 2 3 2 2 3 4 5 3 5 2 5 4 4 5 4 2 2 3 2 3 3 3 4 4 3 2 2 4 4 2 5 3 5 3 5 4 4 4 5 4 5 2 2 5 4 4 4 3 3 2 5 2 5 2 3 2 5 2 2 5 5 3 4 5 3 4 4 4 4", "output": "37" }, { "input": "2\n5 2", "output": "1" }, { "input": "5\n2 2 2 2 2", "output": "5" }, { "input": "100\n2 3 2 2 2 3 2 3 3 3 3 3 2 3 3 2 2 3 3 2 3 2 3 2 3 4 4 4 3 3 3 3 3 4 4 3 3 4 3 2 3 4 3 3 3 3 2 3 4 3 4 3 3 2 4 4 2 4 4 3 3 3 3 4 3 2 3 4 3 4 4 4 4 4 3 2 2 3 4 2 4 4 4 2 2 4 2 2 3 2 2 4 4 3 4 2 3 3 2 2", "output": "61" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "1" }, { "input": "100\n5 4 3 5 3 5 4 2 3 3 4 5 4 5 5 4 2 4 2 2 5 2 5 3 4 4 4 5 5 5 3 4 4 4 3 5 3 2 5 4 3 3 3 5 2 3 4 2 5 4 3 4 5 2 2 3 4 4 2 3 3 3 2 5 2 3 4 3 3 3 2 5 4 3 4 5 4 2 5 4 5 2 2 4 2 2 5 5 4 5 2 2 2 2 5 2 4 4 4 5", "output": "35" }, { "input": "2\n2 2", "output": "2" }, { "input": "20\n4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5", "output": "1" } ]
1,560,872,386
2,147,483,647
Python 3
OK
TESTS
61
124
0
n = int(input()) lis = sorted(map(int,input().split())) s = sum(lis);c=0 if s/n>=4.5: print("0") else: for i in range(n): s+=(5-lis[i]) c+=1 if s/n>=4.5: print(c) break;
Title: Getting an A Time Limit: None seconds Memory Limit: None megabytes Problem Description: Translator's note: in Russia's most widespread grading system, there are four grades: 5, 4, 3, 2, the higher the better, roughly corresponding to A, B, C and F respectively in American grading system. The term is coming to an end and students start thinking about their grades. Today, a professor told his students that the grades for his course would be given out automatically  — he would calculate the simple average (arithmetic mean) of all grades given out for lab works this term and round to the nearest integer. The rounding would be done in favour of the student — $4.5$ would be rounded up to $5$ (as in example 3), but $4.4$ would be rounded down to $4$. This does not bode well for Vasya who didn't think those lab works would influence anything, so he may receive a grade worse than $5$ (maybe even the dreaded $2$). However, the professor allowed him to redo some of his works of Vasya's choosing to increase his average grade. Vasya wants to redo as as few lab works as possible in order to get $5$ for the course. Of course, Vasya will get $5$ for the lab works he chooses to redo. Help Vasya — calculate the minimum amount of lab works Vasya has to redo. Input Specification: The first line contains a single integer $n$ — the number of Vasya's grades ($1 \leq n \leq 100$). The second line contains $n$ integers from $2$ to $5$ — Vasya's grades for his lab works. Output Specification: Output a single integer — the minimum amount of lab works that Vasya has to redo. It can be shown that Vasya can always redo enough lab works to get a $5$. Demo Input: ['3\n4 4 4\n', '4\n5 4 5 5\n', '4\n5 3 3 5\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first sample, it is enough to redo two lab works to make two $4$s into $5$s. In the second sample, Vasya's average is already $4.75$ so he doesn't have to redo anything to get a $5$. In the second sample Vasya has to redo one lab work to get rid of one of the $3$s, that will make the average exactly $4.5$ so the final grade would be $5$.
```python n = int(input()) lis = sorted(map(int,input().split())) s = sum(lis);c=0 if s/n>=4.5: print("0") else: for i in range(n): s+=(5-lis[i]) c+=1 if s/n>=4.5: print(c) break; ```
3
0
none
none
none
0
[ "none" ]
null
null
Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*). They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula . The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=&lt;<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs.
The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen. Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109). Some positions may coincide.
Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel.
[ "3\n1 1\n7 5\n1 5\n", "6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n" ]
[ "2\n", "11\n" ]
In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances.
0
[ { "input": "3\n1 1\n7 5\n1 5", "output": "2" }, { "input": "6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1", "output": "11" }, { "input": "10\n46 -55\n46 45\n46 45\n83 -55\n46 45\n83 -55\n46 45\n83 45\n83 45\n46 -55", "output": "33" }, { "input": "1\n-5 -90", "output": "0" }, { "input": "2\n315 845\n-669 -762", "output": "0" }, { "input": "3\n8911 7861\n-6888 7861\n8911 7861", "output": "3" }, { "input": "2\n-1 1000000000\n0 -1", "output": "0" }, { "input": "2\n1000000000 0\n-7 1", "output": "0" }, { "input": "2\n1 4\n2 1", "output": "0" }, { "input": "2\n1 0\n0 2333333", "output": "0" }, { "input": "2\n2 1\n1 2", "output": "0" }, { "input": "2\n1 1000000000\n2 -1000000000", "output": "0" }, { "input": "2\n0 1000000000\n1 -7", "output": "0" }, { "input": "2\n1 0\n0 19990213", "output": "0" } ]
1,655,888,462
2,147,483,647
PyPy 3-64
OK
TESTS
71
1,107
50,073,600
from collections import defaultdict as DD import sys input = sys.stdin.readline n, = map(int, input().split()) seen_x = DD(int) seen_y = DD(int) seen = DD(int) same = 0 for _ in range(n): x,y = map(int, input().split()) same += seen_x[x] same += seen_y[y] same -= seen[x,y] seen_x[x] += 1 seen_y[y] += 1 seen[x,y] += 1 print(same)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*). They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula . The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=&lt;<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs. Input Specification: The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen. Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109). Some positions may coincide. Output Specification: Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel. Demo Input: ['3\n1 1\n7 5\n1 5\n', '6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n'] Demo Output: ['2\n', '11\n'] Note: In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances.
```python from collections import defaultdict as DD import sys input = sys.stdin.readline n, = map(int, input().split()) seen_x = DD(int) seen_y = DD(int) seen = DD(int) same = 0 for _ in range(n): x,y = map(int, input().split()) same += seen_x[x] same += seen_y[y] same -= seen[x,y] seen_x[x] += 1 seen_y[y] += 1 seen[x,y] += 1 print(same) ```
3