Unnamed: 0 int64 0 832k | id float64 2.49B 32.1B | type stringclasses 1 value | created_at stringlengths 19 19 | repo stringlengths 5 112 | repo_url stringlengths 34 141 | action stringclasses 3 values | title stringlengths 1 757 | labels stringlengths 4 664 | body stringlengths 3 261k | index stringclasses 10 values | text_combine stringlengths 96 261k | label stringclasses 2 values | text stringlengths 96 232k | binary_label int64 0 1 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
50,584 | 13,187,600,111 | IssuesEvent | 2020-08-13 03:57:05 | icecube-trac/tix3 | https://api.github.com/repos/icecube-trac/tix3 | closed | sim-services - missing sphinx docs (Trac #996) | Migrated from Trac combo simulation defect | `sim-services/resources/docs/sanity_checkers/sanity_checkers.rst` isn't picked up by sphinx on `make docs`
<details>
<summary><em>Migrated from https://code.icecube.wisc.edu/ticket/996
, reported by nega and owned by nega</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2015-05-26T21:51:48",
"description": "`sim-services/resources/docs/sanity_checkers/sanity_checkers.rst` isn't picked up by sphinx on `make docs`",
"reporter": "nega",
"cc": "olivas",
"resolution": "fixed",
"_ts": "1432677108464162",
"component": "combo simulation",
"summary": "sim-services - missing sphinx docs",
"priority": "normal",
"keywords": "documentation",
"time": "2015-05-26T20:41:22",
"milestone": "",
"owner": "nega",
"type": "defect"
}
```
</p>
</details>
| 1.0 | sim-services - missing sphinx docs (Trac #996) - `sim-services/resources/docs/sanity_checkers/sanity_checkers.rst` isn't picked up by sphinx on `make docs`
<details>
<summary><em>Migrated from https://code.icecube.wisc.edu/ticket/996
, reported by nega and owned by nega</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2015-05-26T21:51:48",
"description": "`sim-services/resources/docs/sanity_checkers/sanity_checkers.rst` isn't picked up by sphinx on `make docs`",
"reporter": "nega",
"cc": "olivas",
"resolution": "fixed",
"_ts": "1432677108464162",
"component": "combo simulation",
"summary": "sim-services - missing sphinx docs",
"priority": "normal",
"keywords": "documentation",
"time": "2015-05-26T20:41:22",
"milestone": "",
"owner": "nega",
"type": "defect"
}
```
</p>
</details>
| defect | sim services missing sphinx docs trac sim services resources docs sanity checkers sanity checkers rst isn t picked up by sphinx on make docs migrated from reported by nega and owned by nega json status closed changetime description sim services resources docs sanity checkers sanity checkers rst isn t picked up by sphinx on make docs reporter nega cc olivas resolution fixed ts component combo simulation summary sim services missing sphinx docs priority normal keywords documentation time milestone owner nega type defect | 1 |
55,739 | 30,925,944,430 | IssuesEvent | 2023-08-06 13:32:00 | tensorflow/tensorflow | https://api.github.com/repos/tensorflow/tensorflow | reopened | gradient returns `None` | stat:awaiting response stale comp:keras type:performance TF 2.7 | ### Issue type
Performance
### Have you reproduced the bug with TensorFlow Nightly?
No
### Source
source
### TensorFlow version
2.7.1
### Custom code
Yes
### OS platform and distribution
CentOS Linux 7 (Core)
### Mobile device
_No response_
### Python version
3.8.12
### Bazel version
_No response_
### GCC/compiler version
_No response_
### CUDA/cuDNN version
_No response_
### GPU model and memory
Running on CPU only
### Current behavior?
In the code below I don't understand why `test_tape` which is a `tf.GradientTape()` returns an empty (`None`) gradient. I have made sure to call the models so weights are initialized, checked that losses are actual tensors, redefined inputs as `tf.Variable()` and alternatively attempted using `tape.watch()`. My intuition is that the first call to `train_optimizer.apply_gradients()` somehow breaks the computational graph which is why `test_tape` does not track variables associated with `model_copy` but I am not sure how to fix the issue.
### Standalone code to reproduce the issue
```shell
import tensorflow as tf
import tensorflow.keras as keras
import tensorflow.keras.backend as keras_backend
import numpy as np
def sineGenerator(amplitude=None, phase=None):
if amplitude is None:
amplitude = tf.random.uniform(shape=[], minval=0.1, maxval=5.0)
if phase is None:
phase = tf.random.uniform(shape=[], minval=0.0, maxval=np.pi)
def _gen(x):
return amplitude*tf.math.sin(x+phase)
return _gen
def genX(sample, minval=-5.0, maxval=5.0):
return tf.expand_dims(tf.random.uniform(shape=[sample], minval=minval, maxval=maxval), 1)
class sineModel(keras.Model):
def __init__(self):
super().__init__()
self.hidden1 = keras.layers.Dense(40, input_shape=(1,))
self.hidden2 = keras.layers.Dense(40)
self.out = keras.layers.Dense(1)
def call(self, x):
x = keras.activations.relu(self.hidden1(x))
x = keras.activations.relu(self.hidden2(x))
x = self.out(x)
return x
def copyModel(model, x):
model_copy = sineModel()
output = model_copy(x)
output = model(x) # should not be necessary since model(train_x) is called before model_copy = copyModel(model,x) in maml_train()
model_copy.set_weights(model.get_weights())
return model_copy
def maml_train(model, total_iterations=10, meta_train_steps=10, meta_test_steps=100):
log_step = total_iterations //10 if total_iterations > 10 else 1
test_optimizer = keras.optimizers.Adam(learning_rate=0.001)
train_optimizer = keras.optimizers.Adam(learning_rate=0.001)
losses, total_loss = [], 0.
for step in range(total_iterations):
sineGen = sineGenerator()
test_x = genX(meta_test_steps)
test_y = sineGen(test_x)
train_x = genX(meta_train_steps)
train_y = sineGen(train_x)
# test_x, test_y, train_x, train_y = tf.Variable(test_x), tf.Variable(test_y), tf.Variable(train_x), tf.Variable(train_y)
# test_x, test_y, train_x, train_y = tf.convert_to_tensor(test_x), tf.convert_to_tensor(test_y), tf.convert_to_tensor(train_x), tf.convert_to_tensor(train_y)
model(train_x)
model_copy = copyModel(model, train_x)
with tf.GradientTape() as test_tape:
# test_tape.watch([test_x, test_y, train_x, train_y])
with tf.GradientTape() as train_tape:
# train_tape.watch([test_x, test_y, train_x, train_y])
train_loss = tf.reduce_mean(keras.losses.mean_squared_error(train_y, model(train_x)))
# print('train_loss type', type(train_loss))
gradients = train_tape.gradient(train_loss, model.trainable_variables)
train_optimizer.apply_gradients(zip(gradients, model_copy.trainable_variables))
test_loss = tf.reduce_mean(keras.losses.mean_squared_error(test_y, model_copy(test_x)))
# print('test_loss type', type(test_loss))
gradients = test_tape.gradient(test_loss, model.trainable_variables)
print(gradients)
test_optimizer.apply_gradients(zip(gradients, model.trainable_variables))
total_loss += test_loss
losses += [total_loss/(step+1)]
if step % log_step == 0:
print('Training loss (total) at step %d: \t %.4f' % (step, total_loss/(step+1)))
return losses
sModel_maml = sineModel()
maml_train(sModel_maml)
```
### Relevant log output
```shell
[None, None, None, None, None, None]
---------------------------------------------------------------------------
ValueError Traceback (most recent call last)
<ipython-input-402-4ed8f16df6b0> in <module>
76
77 sModel_maml = sineModel2()
---> 78 maml_train(sModel_maml)
<ipython-input-402-4ed8f16df6b0> in maml_train(model, total_iterations, meta_train_steps, meta_test_steps)
65 gradients = test_tape.gradient(test_loss, model.trainable_variables)
66 print(gradients)
---> 67 test_optimizer.apply_gradients(zip(gradients, model.trainable_variables))
68
69 total_loss += test_loss
~/pyenvs/tensorflow2/lib/python3.8/site-packages/keras/optimizer_v2/optimizer_v2.py in apply_gradients(self, grads_and_vars, name, experimental_aggregate_gradients)
631 RuntimeError: If called in a cross-replica context.
632 """
--> 633 grads_and_vars = optimizer_utils.filter_empty_gradients(grads_and_vars)
634 var_list = [v for (_, v) in grads_and_vars]
635
~/pyenvs/tensorflow2/lib/python3.8/site-packages/keras/optimizer_v2/utils.py in filter_empty_gradients(grads_and_vars)
71 if not filtered:
72 variable = ([v.name for _, v in grads_and_vars],)
---> 73 raise ValueError(f"No gradients provided for any variable: {variable}. "
74 f"Provided `grads_and_vars` is {grads_and_vars}.")
75 if vars_with_empty_grads:
ValueError: No gradients provided for any variable: (['sine_model2_59/dense_555/kernel:0', 'sine_model2_59/dense_555/bias:0', 'sine_model2_59/dense_556/kernel:0', 'sine_model2_59/dense_556/bias:0', 'sine_model2_59/dense_557/kernel:0', 'sine_model2_59/dense_557/bias:0'],). Provided `grads_and_vars` is ((None, <tf.Variable 'sine_model2_59/dense_555/kernel:0' shape=(1, 40) dtype=float32, numpy=....
```
| True | gradient returns `None` - ### Issue type
Performance
### Have you reproduced the bug with TensorFlow Nightly?
No
### Source
source
### TensorFlow version
2.7.1
### Custom code
Yes
### OS platform and distribution
CentOS Linux 7 (Core)
### Mobile device
_No response_
### Python version
3.8.12
### Bazel version
_No response_
### GCC/compiler version
_No response_
### CUDA/cuDNN version
_No response_
### GPU model and memory
Running on CPU only
### Current behavior?
In the code below I don't understand why `test_tape` which is a `tf.GradientTape()` returns an empty (`None`) gradient. I have made sure to call the models so weights are initialized, checked that losses are actual tensors, redefined inputs as `tf.Variable()` and alternatively attempted using `tape.watch()`. My intuition is that the first call to `train_optimizer.apply_gradients()` somehow breaks the computational graph which is why `test_tape` does not track variables associated with `model_copy` but I am not sure how to fix the issue.
### Standalone code to reproduce the issue
```shell
import tensorflow as tf
import tensorflow.keras as keras
import tensorflow.keras.backend as keras_backend
import numpy as np
def sineGenerator(amplitude=None, phase=None):
if amplitude is None:
amplitude = tf.random.uniform(shape=[], minval=0.1, maxval=5.0)
if phase is None:
phase = tf.random.uniform(shape=[], minval=0.0, maxval=np.pi)
def _gen(x):
return amplitude*tf.math.sin(x+phase)
return _gen
def genX(sample, minval=-5.0, maxval=5.0):
return tf.expand_dims(tf.random.uniform(shape=[sample], minval=minval, maxval=maxval), 1)
class sineModel(keras.Model):
def __init__(self):
super().__init__()
self.hidden1 = keras.layers.Dense(40, input_shape=(1,))
self.hidden2 = keras.layers.Dense(40)
self.out = keras.layers.Dense(1)
def call(self, x):
x = keras.activations.relu(self.hidden1(x))
x = keras.activations.relu(self.hidden2(x))
x = self.out(x)
return x
def copyModel(model, x):
model_copy = sineModel()
output = model_copy(x)
output = model(x) # should not be necessary since model(train_x) is called before model_copy = copyModel(model,x) in maml_train()
model_copy.set_weights(model.get_weights())
return model_copy
def maml_train(model, total_iterations=10, meta_train_steps=10, meta_test_steps=100):
log_step = total_iterations //10 if total_iterations > 10 else 1
test_optimizer = keras.optimizers.Adam(learning_rate=0.001)
train_optimizer = keras.optimizers.Adam(learning_rate=0.001)
losses, total_loss = [], 0.
for step in range(total_iterations):
sineGen = sineGenerator()
test_x = genX(meta_test_steps)
test_y = sineGen(test_x)
train_x = genX(meta_train_steps)
train_y = sineGen(train_x)
# test_x, test_y, train_x, train_y = tf.Variable(test_x), tf.Variable(test_y), tf.Variable(train_x), tf.Variable(train_y)
# test_x, test_y, train_x, train_y = tf.convert_to_tensor(test_x), tf.convert_to_tensor(test_y), tf.convert_to_tensor(train_x), tf.convert_to_tensor(train_y)
model(train_x)
model_copy = copyModel(model, train_x)
with tf.GradientTape() as test_tape:
# test_tape.watch([test_x, test_y, train_x, train_y])
with tf.GradientTape() as train_tape:
# train_tape.watch([test_x, test_y, train_x, train_y])
train_loss = tf.reduce_mean(keras.losses.mean_squared_error(train_y, model(train_x)))
# print('train_loss type', type(train_loss))
gradients = train_tape.gradient(train_loss, model.trainable_variables)
train_optimizer.apply_gradients(zip(gradients, model_copy.trainable_variables))
test_loss = tf.reduce_mean(keras.losses.mean_squared_error(test_y, model_copy(test_x)))
# print('test_loss type', type(test_loss))
gradients = test_tape.gradient(test_loss, model.trainable_variables)
print(gradients)
test_optimizer.apply_gradients(zip(gradients, model.trainable_variables))
total_loss += test_loss
losses += [total_loss/(step+1)]
if step % log_step == 0:
print('Training loss (total) at step %d: \t %.4f' % (step, total_loss/(step+1)))
return losses
sModel_maml = sineModel()
maml_train(sModel_maml)
```
### Relevant log output
```shell
[None, None, None, None, None, None]
---------------------------------------------------------------------------
ValueError Traceback (most recent call last)
<ipython-input-402-4ed8f16df6b0> in <module>
76
77 sModel_maml = sineModel2()
---> 78 maml_train(sModel_maml)
<ipython-input-402-4ed8f16df6b0> in maml_train(model, total_iterations, meta_train_steps, meta_test_steps)
65 gradients = test_tape.gradient(test_loss, model.trainable_variables)
66 print(gradients)
---> 67 test_optimizer.apply_gradients(zip(gradients, model.trainable_variables))
68
69 total_loss += test_loss
~/pyenvs/tensorflow2/lib/python3.8/site-packages/keras/optimizer_v2/optimizer_v2.py in apply_gradients(self, grads_and_vars, name, experimental_aggregate_gradients)
631 RuntimeError: If called in a cross-replica context.
632 """
--> 633 grads_and_vars = optimizer_utils.filter_empty_gradients(grads_and_vars)
634 var_list = [v for (_, v) in grads_and_vars]
635
~/pyenvs/tensorflow2/lib/python3.8/site-packages/keras/optimizer_v2/utils.py in filter_empty_gradients(grads_and_vars)
71 if not filtered:
72 variable = ([v.name for _, v in grads_and_vars],)
---> 73 raise ValueError(f"No gradients provided for any variable: {variable}. "
74 f"Provided `grads_and_vars` is {grads_and_vars}.")
75 if vars_with_empty_grads:
ValueError: No gradients provided for any variable: (['sine_model2_59/dense_555/kernel:0', 'sine_model2_59/dense_555/bias:0', 'sine_model2_59/dense_556/kernel:0', 'sine_model2_59/dense_556/bias:0', 'sine_model2_59/dense_557/kernel:0', 'sine_model2_59/dense_557/bias:0'],). Provided `grads_and_vars` is ((None, <tf.Variable 'sine_model2_59/dense_555/kernel:0' shape=(1, 40) dtype=float32, numpy=....
```
| non_defect | gradient returns none issue type performance have you reproduced the bug with tensorflow nightly no source source tensorflow version custom code yes os platform and distribution centos linux core mobile device no response python version bazel version no response gcc compiler version no response cuda cudnn version no response gpu model and memory running on cpu only current behavior in the code below i don t understand why test tape which is a tf gradienttape returns an empty none gradient i have made sure to call the models so weights are initialized checked that losses are actual tensors redefined inputs as tf variable and alternatively attempted using tape watch my intuition is that the first call to train optimizer apply gradients somehow breaks the computational graph which is why test tape does not track variables associated with model copy but i am not sure how to fix the issue standalone code to reproduce the issue shell import tensorflow as tf import tensorflow keras as keras import tensorflow keras backend as keras backend import numpy as np def sinegenerator amplitude none phase none if amplitude is none amplitude tf random uniform shape minval maxval if phase is none phase tf random uniform shape minval maxval np pi def gen x return amplitude tf math sin x phase return gen def genx sample minval maxval return tf expand dims tf random uniform shape minval minval maxval maxval class sinemodel keras model def init self super init self keras layers dense input shape self keras layers dense self out keras layers dense def call self x x keras activations relu self x x keras activations relu self x x self out x return x def copymodel model x model copy sinemodel output model copy x output model x should not be necessary since model train x is called before model copy copymodel model x in maml train model copy set weights model get weights return model copy def maml train model total iterations meta train steps meta test steps log step total iterations if total iterations else test optimizer keras optimizers adam learning rate train optimizer keras optimizers adam learning rate losses total loss for step in range total iterations sinegen sinegenerator test x genx meta test steps test y sinegen test x train x genx meta train steps train y sinegen train x test x test y train x train y tf variable test x tf variable test y tf variable train x tf variable train y test x test y train x train y tf convert to tensor test x tf convert to tensor test y tf convert to tensor train x tf convert to tensor train y model train x model copy copymodel model train x with tf gradienttape as test tape test tape watch with tf gradienttape as train tape train tape watch train loss tf reduce mean keras losses mean squared error train y model train x print train loss type type train loss gradients train tape gradient train loss model trainable variables train optimizer apply gradients zip gradients model copy trainable variables test loss tf reduce mean keras losses mean squared error test y model copy test x print test loss type type test loss gradients test tape gradient test loss model trainable variables print gradients test optimizer apply gradients zip gradients model trainable variables total loss test loss losses if step log step print training loss total at step d t step total loss step return losses smodel maml sinemodel maml train smodel maml relevant log output shell valueerror traceback most recent call last in smodel maml maml train smodel maml in maml train model total iterations meta train steps meta test steps gradients test tape gradient test loss model trainable variables print gradients test optimizer apply gradients zip gradients model trainable variables total loss test loss pyenvs lib site packages keras optimizer optimizer py in apply gradients self grads and vars name experimental aggregate gradients runtimeerror if called in a cross replica context grads and vars optimizer utils filter empty gradients grads and vars var list pyenvs lib site packages keras optimizer utils py in filter empty gradients grads and vars if not filtered variable raise valueerror f no gradients provided for any variable variable f provided grads and vars is grads and vars if vars with empty grads valueerror no gradients provided for any variable provided grads and vars is none tf variable sine dense kernel shape dtype numpy | 0 |
27,252 | 4,952,295,905 | IssuesEvent | 2016-12-01 11:29:16 | rbei-etas/busmaster | https://api.github.com/repos/rbei-etas/busmaster | opened | Error in editing Utility function | 1.3 patch (defect) 3.3 low priority (EC3) | Create a utility function with void return type and try to edit the same function to change return type to int. Error 'function already exists' is displayed. | 1.0 | Error in editing Utility function - Create a utility function with void return type and try to edit the same function to change return type to int. Error 'function already exists' is displayed. | defect | error in editing utility function create a utility function with void return type and try to edit the same function to change return type to int error function already exists is displayed | 1 |
157,084 | 12,345,949,436 | IssuesEvent | 2020-05-15 09:51:38 | gluster/glusterfs | https://api.github.com/repos/gluster/glusterfs | closed | [RFE] Keep all the trace and debug level logs in memory in a circular buffer | FA: Debug-ability & Quality FA: Testing Improvements FA: Usability & Supportability Prio: Medium wontfix | By keeping debug and trace logs in memory, we can get more debug friendly feature.
This would help developers to debug the issue faster, and there is no need to restart the process. | 1.0 | [RFE] Keep all the trace and debug level logs in memory in a circular buffer - By keeping debug and trace logs in memory, we can get more debug friendly feature.
This would help developers to debug the issue faster, and there is no need to restart the process. | non_defect | keep all the trace and debug level logs in memory in a circular buffer by keeping debug and trace logs in memory we can get more debug friendly feature this would help developers to debug the issue faster and there is no need to restart the process | 0 |
489,968 | 14,114,051,224 | IssuesEvent | 2020-11-07 14:17:00 | python/mypy | https://api.github.com/repos/python/mypy | closed | Forcefully follow import to site-package, despite no py.typed file | feature needs discussion priority-2-low | If I manually do a
`touch .tox/mypy/lib/python3.6/site-packages/kubernetes/py.typed`
I can
1. increase my testing coverage and
2. remove mypy's
```ini
[mypy-kubernetes.*]
ignore_missing_imports=True
```
I'm missing a way to force following the import to `kubernetes`.
Right now, my super ugly workaround in tox is:
```ini
[testenv:mypy]
basepython = python3
deps =
-r requirements.txt
mypy
whitelist_externals = touch
commands = touch {envsitepackagesdir}/kubernetes/py.typed
mypy --config-file=../../mypy.ini \
-m ... \
``` | 1.0 | Forcefully follow import to site-package, despite no py.typed file - If I manually do a
`touch .tox/mypy/lib/python3.6/site-packages/kubernetes/py.typed`
I can
1. increase my testing coverage and
2. remove mypy's
```ini
[mypy-kubernetes.*]
ignore_missing_imports=True
```
I'm missing a way to force following the import to `kubernetes`.
Right now, my super ugly workaround in tox is:
```ini
[testenv:mypy]
basepython = python3
deps =
-r requirements.txt
mypy
whitelist_externals = touch
commands = touch {envsitepackagesdir}/kubernetes/py.typed
mypy --config-file=../../mypy.ini \
-m ... \
``` | non_defect | forcefully follow import to site package despite no py typed file if i manually do a touch tox mypy lib site packages kubernetes py typed i can increase my testing coverage and remove mypy s ini ignore missing imports true i m missing a way to force following the import to kubernetes right now my super ugly workaround in tox is ini basepython deps r requirements txt mypy whitelist externals touch commands touch envsitepackagesdir kubernetes py typed mypy config file mypy ini m | 0 |
71,253 | 23,508,335,500 | IssuesEvent | 2022-08-18 14:24:37 | scoutplan/scoutplan | https://api.github.com/repos/scoutplan/scoutplan | closed | [Scoutplan Production/production] NameError: undefined local variable or method `payment_amount' for #<Event id: 87409, unit_id: 32098, title: "Committee / Parent Meeting", description: nil, starts_at: "2022-09-01 19:00:00.000000000 -0400", ends_at: "2022-09-01 20:00:00.000000000 -0400", location: "Zoom", created_at: "2022-05-29 06:41:09.420250000 -0400", updated_at: "2022-08-06 16:23:35.774337000 -0400", requires_rsvp: false, max_total_attendees: nil, rsvp_opens_at: nil, event_category_id: 22, series_pa... | defect | ## Backtrace
line 78 of [PROJECT_ROOT]/app/models/event.rb: requires_payment?
line 47 of [PROJECT_ROOT]/app/views/events/show.html.slim: block in _app_views_events_show_html_slim__3704642992670495319_8440500
line 5 of [PROJECT_ROOT]/app/views/events/show.html.slim: _app_views_events_show_html_slim__3704642992670495319_8440500
[View full backtrace and more info at honeybadger.io](https://app.honeybadger.io/projects/97676/faults/87522239) | 1.0 | [Scoutplan Production/production] NameError: undefined local variable or method `payment_amount' for #<Event id: 87409, unit_id: 32098, title: "Committee / Parent Meeting", description: nil, starts_at: "2022-09-01 19:00:00.000000000 -0400", ends_at: "2022-09-01 20:00:00.000000000 -0400", location: "Zoom", created_at: "2022-05-29 06:41:09.420250000 -0400", updated_at: "2022-08-06 16:23:35.774337000 -0400", requires_rsvp: false, max_total_attendees: nil, rsvp_opens_at: nil, event_category_id: 22, series_pa... - ## Backtrace
line 78 of [PROJECT_ROOT]/app/models/event.rb: requires_payment?
line 47 of [PROJECT_ROOT]/app/views/events/show.html.slim: block in _app_views_events_show_html_slim__3704642992670495319_8440500
line 5 of [PROJECT_ROOT]/app/views/events/show.html.slim: _app_views_events_show_html_slim__3704642992670495319_8440500
[View full backtrace and more info at honeybadger.io](https://app.honeybadger.io/projects/97676/faults/87522239) | defect | nameerror undefined local variable or method payment amount for event id unit id title committee parent meeting description nil starts at ends at location zoom created at updated at requires rsvp false max total attendees nil rsvp opens at nil event category id series pa backtrace line of app models event rb requires payment line of app views events show html slim block in app views events show html slim line of app views events show html slim app views events show html slim | 1 |
206,418 | 23,384,836,961 | IssuesEvent | 2022-08-11 12:56:46 | H-459/exam_baragon_gal | https://api.github.com/repos/H-459/exam_baragon_gal | opened | jackson-databind-2.9.9.jar: 50 vulnerabilities (highest severity is: 9.8) | security vulnerability | <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p></summary>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p></details>
## Vulnerabilities
| CVE | Severity | <img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS | Dependency | Type | Fixed in | Remediation Available |
| ------------- | ------------- | ----- | ----- | ----- | --- | --- |
| [CVE-2019-14540](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14540) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.2 | ✅ |
| [CVE-2019-17531](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17531) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.1 | ✅ |
| [CVE-2019-16335](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16335) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2019-17267](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17267) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2019-16942](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16942) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.1 | ✅ |
| [CVE-2020-8840](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-8840) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.3 | ✅ |
| [CVE-2019-16943](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16943) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.1 | ✅ |
| [CVE-2019-14893](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14893) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2019-14892](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14892) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2020-9546](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9546) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-9547](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9547) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2019-14379](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14379) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.9.2 | ✅ |
| [CVE-2020-9548](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9548) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2019-20330](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-20330) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.2 | ✅ |
| [CVE-2020-10968](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10968) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10969](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10969) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11111](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11111) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11113](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11113) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11112](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11112) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10672](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10672) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10673](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10673) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11619](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11619) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-35728](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-35728) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36189](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36189) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36188](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36188) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-11620](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11620) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10650](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10650) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-36181](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36181) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36180](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36180) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36183](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36183) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-35490](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-35490) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-36182](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36182) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36185](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36185) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-35491](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-35491) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-36184](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36184) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36187](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36187) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36186](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36186) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2021-20190](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-20190) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.7 | ✅ |
| [CVE-2020-36179](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36179) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-24616](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-24616) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14060](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14060) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14061](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14061) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14062](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14062) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-24750](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-24750) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14195](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14195) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-25649](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-25649) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | jackson-databind-2.9.9.jar | Direct | 2.9.10.7 | ✅ |
| [CVE-2019-14439](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14439) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | jackson-databind-2.9.9.jar | Direct | 2.9.9.2 | ✅ |
| [CVE-2020-36518](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36518) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | jackson-databind-2.9.9.jar | Direct | 2.12.6.1 | ✅ |
| [CVE-2019-12814](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-12814) | <img src='https://whitesource-resources.whitesourcesoftware.com/medium_vul.png' width=19 height=20> Medium | 5.9 | jackson-databind-2.9.9.jar | Direct | 2.9.9.1 | ✅ |
| [CVE-2019-12384](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-12384) | <img src='https://whitesource-resources.whitesourcesoftware.com/medium_vul.png' width=19 height=20> Medium | 5.9 | jackson-databind-2.9.9.jar | Direct | 2.9.9.1 | ✅ |
## Details
> Partial details (19 vulnerabilities) are displayed below due to a content size limitation in GitHub. To view information on the remaining vulnerabilities, navigate to the Mend Application.<br>
<details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14540</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind before 2.9.10. It is related to com.zaxxer.hikari.HikariConfig.
<p>Publish Date: 2019-09-15
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14540>CVE-2019-14540</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14540">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14540</a></p>
<p>Release Date: 2019-09-15</p>
<p>Fix Resolution: 2.9.10.2</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-17531</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind 2.0.0 through 2.9.10. When Default Typing is enabled (either globally or for a specific property) for an externally exposed JSON endpoint and the service has the apache-log4j-extra (version 1.2.x) jar in the classpath, and an attacker can provide a JNDI service to access, it is possible to make the service execute a malicious payload.
<p>Publish Date: 2019-10-12
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17531>CVE-2019-17531</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-17531">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-17531</a></p>
<p>Release Date: 2019-10-12</p>
<p>Fix Resolution: 2.9.10.1</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-16335</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind before 2.9.10. It is related to com.zaxxer.hikari.HikariDataSource. This is a different vulnerability than CVE-2019-14540.
<p>Publish Date: 2019-09-15
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16335>CVE-2019-16335</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2019-09-15</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-17267</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind before 2.9.10. It is related to net.sf.ehcache.hibernate.EhcacheJtaTransactionManagerLookup.
<p>Publish Date: 2019-10-07
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17267>CVE-2019-17267</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2019-10-07</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-16942</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind 2.0.0 through 2.9.10. When Default Typing is enabled (either globally or for a specific property) for an externally exposed JSON endpoint and the service has the commons-dbcp (1.4) jar in the classpath, and an attacker can find an RMI service endpoint to access, it is possible to make the service execute a malicious payload. This issue exists because of org.apache.commons.dbcp.datasources.SharedPoolDataSource and org.apache.commons.dbcp.datasources.PerUserPoolDataSource mishandling.
<p>Publish Date: 2019-10-01
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16942>CVE-2019-16942</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16942">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16942</a></p>
<p>Release Date: 2019-10-01</p>
<p>Fix Resolution: 2.9.10.1</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-8840</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.0.0 through 2.9.10.2 lacks certain xbean-reflect/JNDI blocking, as demonstrated by org.apache.xbean.propertyeditor.JndiConverter.
<p>Publish Date: 2020-02-10
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-8840>CVE-2020-8840</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2020-02-10</p>
<p>Fix Resolution: 2.9.10.3</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-16943</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind 2.0.0 through 2.9.10. When Default Typing is enabled (either globally or for a specific property) for an externally exposed JSON endpoint and the service has the p6spy (3.8.6) jar in the classpath, and an attacker can find an RMI service endpoint to access, it is possible to make the service execute a malicious payload. This issue exists because of com.p6spy.engine.spy.P6DataSource mishandling.
<p>Publish Date: 2019-10-01
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16943>CVE-2019-16943</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16943">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16943</a></p>
<p>Release Date: 2019-10-01</p>
<p>Fix Resolution: 2.9.10.1</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14893</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A flaw was discovered in FasterXML jackson-databind in all versions before 2.9.10 and 2.10.0, where it would permit polymorphic deserialization of malicious objects using the xalan JNDI gadget when used in conjunction with polymorphic type handling methods such as `enableDefaultTyping()` or when @JsonTypeInfo is using `Id.CLASS` or `Id.MINIMAL_CLASS` or in any other way which ObjectMapper.readValue might instantiate objects from unsafe sources. An attacker could use this flaw to execute arbitrary code.
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14893>CVE-2019-14893</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14893">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14893</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14892</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A flaw was discovered in jackson-databind in versions before 2.9.10, 2.8.11.5 and 2.6.7.3, where it would permit polymorphic deserialization of a malicious object using commons-configuration 1 and 2 JNDI classes. An attacker could use this flaw to execute arbitrary code.
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14892>CVE-2019-14892</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2020-09-04</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-9546</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.hadoop.shaded.com.zaxxer.hikari.HikariConfig (aka shaded hikari-config).
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9546>CVE-2020-9546</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9546">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9546</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-9547</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to com.ibatis.sqlmap.engine.transaction.jta.JtaTransactionConfig (aka ibatis-sqlmap).
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9547>CVE-2020-9547</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9547">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9547</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14379</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
SubTypeValidator.java in FasterXML jackson-databind before 2.9.9.2 mishandles default typing when ehcache is used (because of net.sf.ehcache.transaction.manager.DefaultTransactionManagerLookup), leading to remote code execution.
<p>Publish Date: 2019-07-29
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14379>CVE-2019-14379</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14379">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14379</a></p>
<p>Release Date: 2019-07-29</p>
<p>Fix Resolution: 2.9.9.2</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-9548</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to br.com.anteros.dbcp.AnterosDBCPConfig (aka anteros-core).
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9548>CVE-2020-9548</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9548">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9548</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-20330</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.2 lacks certain net.sf.ehcache blocking.
<p>Publish Date: 2020-01-03
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-20330>CVE-2019-20330</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2020-01-03</p>
<p>Fix Resolution: 2.9.10.2</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-10968</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.aoju.bus.proxy.provider.remoting.RmiProvider (aka bus-proxy).
<p>Publish Date: 2020-03-26
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10968>CVE-2020-10968</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://nvd.nist.gov/vuln/detail/CVE-2020-10968">https://nvd.nist.gov/vuln/detail/CVE-2020-10968</a></p>
<p>Release Date: 2020-03-26</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-10969</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to javax.swing.JEditorPane.
<p>Publish Date: 2020-03-26
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10969>CVE-2020-10969</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-10969">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-10969</a></p>
<p>Release Date: 2020-03-26</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-11111</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.activemq.* (aka activemq-jms, activemq-core, activemq-pool, and activemq-pool-jms).
<p>Publish Date: 2020-03-31
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11111>CVE-2020-11111</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113</a></p>
<p>Release Date: 2020-03-31</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-11113</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.openjpa.ee.WASRegistryManagedRuntime (aka openjpa).
<p>Publish Date: 2020-03-31
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11113>CVE-2020-11113</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113</a></p>
<p>Release Date: 2020-03-31</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-11112</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.commons.proxy.provider.remoting.RmiProvider (aka apache/commons-proxy).
<p>Publish Date: 2020-03-31
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11112>CVE-2020-11112</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11112">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11112</a></p>
<p>Release Date: 2020-03-31</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details>
***
<p>:rescue_worker_helmet: Automatic Remediation is available for this issue.</p> | True | jackson-databind-2.9.9.jar: 50 vulnerabilities (highest severity is: 9.8) - <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p></summary>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p></details>
## Vulnerabilities
| CVE | Severity | <img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS | Dependency | Type | Fixed in | Remediation Available |
| ------------- | ------------- | ----- | ----- | ----- | --- | --- |
| [CVE-2019-14540](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14540) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.2 | ✅ |
| [CVE-2019-17531](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17531) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.1 | ✅ |
| [CVE-2019-16335](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16335) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2019-17267](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17267) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2019-16942](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16942) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.1 | ✅ |
| [CVE-2020-8840](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-8840) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.3 | ✅ |
| [CVE-2019-16943](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16943) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.1 | ✅ |
| [CVE-2019-14893](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14893) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2019-14892](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14892) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10 | ✅ |
| [CVE-2020-9546](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9546) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-9547](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9547) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2019-14379](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14379) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.9.2 | ✅ |
| [CVE-2020-9548](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9548) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2019-20330](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-20330) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 9.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.2 | ✅ |
| [CVE-2020-10968](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10968) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10969](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10969) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11111](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11111) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11113](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11113) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11112](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11112) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10672](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10672) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10673](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10673) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.8 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-11619](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11619) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-35728](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-35728) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36189](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36189) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36188](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36188) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-11620](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11620) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-10650](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10650) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.4 | ✅ |
| [CVE-2020-36181](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36181) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36180](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36180) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36183](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36183) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-35490](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-35490) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-36182](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36182) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36185](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36185) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-35491](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-35491) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-36184](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36184) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36187](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36187) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-36186](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36186) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2021-20190](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-20190) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.7 | ✅ |
| [CVE-2020-36179](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36179) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.8 | ✅ |
| [CVE-2020-24616](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-24616) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14060](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14060) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14061](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14061) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14062](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14062) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-24750](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-24750) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-14195](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-14195) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | jackson-databind-2.9.9.jar | Direct | 2.9.10.5 | ✅ |
| [CVE-2020-25649](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-25649) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | jackson-databind-2.9.9.jar | Direct | 2.9.10.7 | ✅ |
| [CVE-2019-14439](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14439) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | jackson-databind-2.9.9.jar | Direct | 2.9.9.2 | ✅ |
| [CVE-2020-36518](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-36518) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | jackson-databind-2.9.9.jar | Direct | 2.12.6.1 | ✅ |
| [CVE-2019-12814](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-12814) | <img src='https://whitesource-resources.whitesourcesoftware.com/medium_vul.png' width=19 height=20> Medium | 5.9 | jackson-databind-2.9.9.jar | Direct | 2.9.9.1 | ✅ |
| [CVE-2019-12384](https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-12384) | <img src='https://whitesource-resources.whitesourcesoftware.com/medium_vul.png' width=19 height=20> Medium | 5.9 | jackson-databind-2.9.9.jar | Direct | 2.9.9.1 | ✅ |
## Details
> Partial details (19 vulnerabilities) are displayed below due to a content size limitation in GitHub. To view information on the remaining vulnerabilities, navigate to the Mend Application.<br>
<details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14540</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind before 2.9.10. It is related to com.zaxxer.hikari.HikariConfig.
<p>Publish Date: 2019-09-15
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14540>CVE-2019-14540</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14540">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14540</a></p>
<p>Release Date: 2019-09-15</p>
<p>Fix Resolution: 2.9.10.2</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-17531</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind 2.0.0 through 2.9.10. When Default Typing is enabled (either globally or for a specific property) for an externally exposed JSON endpoint and the service has the apache-log4j-extra (version 1.2.x) jar in the classpath, and an attacker can provide a JNDI service to access, it is possible to make the service execute a malicious payload.
<p>Publish Date: 2019-10-12
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17531>CVE-2019-17531</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-17531">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-17531</a></p>
<p>Release Date: 2019-10-12</p>
<p>Fix Resolution: 2.9.10.1</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-16335</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind before 2.9.10. It is related to com.zaxxer.hikari.HikariDataSource. This is a different vulnerability than CVE-2019-14540.
<p>Publish Date: 2019-09-15
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16335>CVE-2019-16335</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2019-09-15</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-17267</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind before 2.9.10. It is related to net.sf.ehcache.hibernate.EhcacheJtaTransactionManagerLookup.
<p>Publish Date: 2019-10-07
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-17267>CVE-2019-17267</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2019-10-07</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-16942</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind 2.0.0 through 2.9.10. When Default Typing is enabled (either globally or for a specific property) for an externally exposed JSON endpoint and the service has the commons-dbcp (1.4) jar in the classpath, and an attacker can find an RMI service endpoint to access, it is possible to make the service execute a malicious payload. This issue exists because of org.apache.commons.dbcp.datasources.SharedPoolDataSource and org.apache.commons.dbcp.datasources.PerUserPoolDataSource mishandling.
<p>Publish Date: 2019-10-01
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16942>CVE-2019-16942</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16942">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16942</a></p>
<p>Release Date: 2019-10-01</p>
<p>Fix Resolution: 2.9.10.1</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-8840</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.0.0 through 2.9.10.2 lacks certain xbean-reflect/JNDI blocking, as demonstrated by org.apache.xbean.propertyeditor.JndiConverter.
<p>Publish Date: 2020-02-10
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-8840>CVE-2020-8840</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2020-02-10</p>
<p>Fix Resolution: 2.9.10.3</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-16943</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A Polymorphic Typing issue was discovered in FasterXML jackson-databind 2.0.0 through 2.9.10. When Default Typing is enabled (either globally or for a specific property) for an externally exposed JSON endpoint and the service has the p6spy (3.8.6) jar in the classpath, and an attacker can find an RMI service endpoint to access, it is possible to make the service execute a malicious payload. This issue exists because of com.p6spy.engine.spy.P6DataSource mishandling.
<p>Publish Date: 2019-10-01
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-16943>CVE-2019-16943</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16943">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-16943</a></p>
<p>Release Date: 2019-10-01</p>
<p>Fix Resolution: 2.9.10.1</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14893</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A flaw was discovered in FasterXML jackson-databind in all versions before 2.9.10 and 2.10.0, where it would permit polymorphic deserialization of malicious objects using the xalan JNDI gadget when used in conjunction with polymorphic type handling methods such as `enableDefaultTyping()` or when @JsonTypeInfo is using `Id.CLASS` or `Id.MINIMAL_CLASS` or in any other way which ObjectMapper.readValue might instantiate objects from unsafe sources. An attacker could use this flaw to execute arbitrary code.
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14893>CVE-2019-14893</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14893">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14893</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14892</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
A flaw was discovered in jackson-databind in versions before 2.9.10, 2.8.11.5 and 2.6.7.3, where it would permit polymorphic deserialization of a malicious object using commons-configuration 1 and 2 JNDI classes. An attacker could use this flaw to execute arbitrary code.
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14892>CVE-2019-14892</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2020-09-04</p>
<p>Fix Resolution: 2.9.10</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-9546</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.hadoop.shaded.com.zaxxer.hikari.HikariConfig (aka shaded hikari-config).
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9546>CVE-2020-9546</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9546">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9546</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-9547</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to com.ibatis.sqlmap.engine.transaction.jta.JtaTransactionConfig (aka ibatis-sqlmap).
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9547>CVE-2020-9547</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9547">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9547</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-14379</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
SubTypeValidator.java in FasterXML jackson-databind before 2.9.9.2 mishandles default typing when ehcache is used (because of net.sf.ehcache.transaction.manager.DefaultTransactionManagerLookup), leading to remote code execution.
<p>Publish Date: 2019-07-29
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-14379>CVE-2019-14379</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14379">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2019-14379</a></p>
<p>Release Date: 2019-07-29</p>
<p>Fix Resolution: 2.9.9.2</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-9548</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to br.com.anteros.dbcp.AnterosDBCPConfig (aka anteros-core).
<p>Publish Date: 2020-03-02
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-9548>CVE-2020-9548</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9548">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-9548</a></p>
<p>Release Date: 2020-03-02</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2019-20330</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.2 lacks certain net.sf.ehcache blocking.
<p>Publish Date: 2020-01-03
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2019-20330>CVE-2019-20330</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>9.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: 2020-01-03</p>
<p>Fix Resolution: 2.9.10.2</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-10968</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.aoju.bus.proxy.provider.remoting.RmiProvider (aka bus-proxy).
<p>Publish Date: 2020-03-26
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10968>CVE-2020-10968</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://nvd.nist.gov/vuln/detail/CVE-2020-10968">https://nvd.nist.gov/vuln/detail/CVE-2020-10968</a></p>
<p>Release Date: 2020-03-26</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-10969</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to javax.swing.JEditorPane.
<p>Publish Date: 2020-03-26
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-10969>CVE-2020-10969</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-10969">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-10969</a></p>
<p>Release Date: 2020-03-26</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-11111</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.activemq.* (aka activemq-jms, activemq-core, activemq-pool, and activemq-pool-jms).
<p>Publish Date: 2020-03-31
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11111>CVE-2020-11111</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113</a></p>
<p>Release Date: 2020-03-31</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-11113</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.openjpa.ee.WASRegistryManagedRuntime (aka openjpa).
<p>Publish Date: 2020-03-31
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11113>CVE-2020-11113</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11113</a></p>
<p>Release Date: 2020-03-31</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-11112</summary>
### Vulnerable Library - <b>jackson-databind-2.9.9.jar</b></p>
<p>General data-binding functionality for Jackson: works on core streaming API</p>
<p>Library home page: <a href="http://github.com/FasterXML/jackson">http://github.com/FasterXML/jackson</a></p>
<p>Path to dependency file: /BaragonData/pom.xml</p>
<p>Path to vulnerable library: /tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/home/wss-scanner/.m2/repository/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar,/tory/com/fasterxml/jackson/core/jackson-databind/2.9.9/jackson-databind-2.9.9.jar</p>
<p>
Dependency Hierarchy:
- :x: **jackson-databind-2.9.9.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/H-459/exam_baragon_gal/commit/5197786c3a215a8403e870300e6cbf1f66a4f11c">5197786c3a215a8403e870300e6cbf1f66a4f11c</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
FasterXML jackson-databind 2.x before 2.9.10.4 mishandles the interaction between serialization gadgets and typing, related to org.apache.commons.proxy.provider.remoting.RmiProvider (aka apache/commons-proxy).
<p>Publish Date: 2020-03-31
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11112>CVE-2020-11112</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.8</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: Required
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11112">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2020-11112</a></p>
<p>Release Date: 2020-03-31</p>
<p>Fix Resolution: 2.9.10.4</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details>
***
<p>:rescue_worker_helmet: Automatic Remediation is available for this issue.</p> | non_defect | jackson databind jar vulnerabilities highest severity is vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar found in head commit a href vulnerabilities cve severity cvss dependency type fixed in remediation available high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct high jackson databind jar direct medium jackson databind jar direct medium jackson databind jar direct details partial details vulnerabilities are displayed below due to a content size limitation in github to view information on the remaining vulnerabilities navigate to the mend application cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a polymorphic typing issue was discovered in fasterxml jackson databind before it is related to com zaxxer hikari hikariconfig publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a polymorphic typing issue was discovered in fasterxml jackson databind through when default typing is enabled either globally or for a specific property for an externally exposed json endpoint and the service has the apache extra version x jar in the classpath and an attacker can provide a jndi service to access it is possible to make the service execute a malicious payload publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a polymorphic typing issue was discovered in fasterxml jackson databind before it is related to com zaxxer hikari hikaridatasource this is a different vulnerability than cve publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a polymorphic typing issue was discovered in fasterxml jackson databind before it is related to net sf ehcache hibernate ehcachejtatransactionmanagerlookup publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a polymorphic typing issue was discovered in fasterxml jackson databind through when default typing is enabled either globally or for a specific property for an externally exposed json endpoint and the service has the commons dbcp jar in the classpath and an attacker can find an rmi service endpoint to access it is possible to make the service execute a malicious payload this issue exists because of org apache commons dbcp datasources sharedpooldatasource and org apache commons dbcp datasources peruserpooldatasource mishandling publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind through lacks certain xbean reflect jndi blocking as demonstrated by org apache xbean propertyeditor jndiconverter publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a polymorphic typing issue was discovered in fasterxml jackson databind through when default typing is enabled either globally or for a specific property for an externally exposed json endpoint and the service has the jar in the classpath and an attacker can find an rmi service endpoint to access it is possible to make the service execute a malicious payload this issue exists because of com engine spy mishandling publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a flaw was discovered in fasterxml jackson databind in all versions before and where it would permit polymorphic deserialization of malicious objects using the xalan jndi gadget when used in conjunction with polymorphic type handling methods such as enabledefaulttyping or when jsontypeinfo is using id class or id minimal class or in any other way which objectmapper readvalue might instantiate objects from unsafe sources an attacker could use this flaw to execute arbitrary code publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details a flaw was discovered in jackson databind in versions before and where it would permit polymorphic deserialization of a malicious object using commons configuration and jndi classes an attacker could use this flaw to execute arbitrary code publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to org apache hadoop shaded com zaxxer hikari hikariconfig aka shaded hikari config publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to com ibatis sqlmap engine transaction jta jtatransactionconfig aka ibatis sqlmap publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details subtypevalidator java in fasterxml jackson databind before mishandles default typing when ehcache is used because of net sf ehcache transaction manager defaulttransactionmanagerlookup leading to remote code execution publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to br com anteros dbcp anterosdbcpconfig aka anteros core publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before lacks certain net sf ehcache blocking publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to org aoju bus proxy provider remoting rmiprovider aka bus proxy publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction required scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to javax swing jeditorpane publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction required scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to org apache activemq aka activemq jms activemq core activemq pool and activemq pool jms publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction required scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to org apache openjpa ee wasregistrymanagedruntime aka openjpa publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction required scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue cve vulnerable library jackson databind jar general data binding functionality for jackson works on core streaming api library home page a href path to dependency file baragondata pom xml path to vulnerable library tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar home wss scanner repository com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar tory com fasterxml jackson core jackson databind jackson databind jar dependency hierarchy x jackson databind jar vulnerable library found in head commit a href found in base branch master vulnerability details fasterxml jackson databind x before mishandles the interaction between serialization gadgets and typing related to org apache commons proxy provider remoting rmiprovider aka apache commons proxy publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction required scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution rescue worker helmet automatic remediation is available for this issue rescue worker helmet automatic remediation is available for this issue | 0 |
3,083 | 2,607,983,225 | IssuesEvent | 2015-02-26 00:50:31 | chrsmithdemos/zen-coding | https://api.github.com/repos/chrsmithdemos/zen-coding | closed | Notepad++ Ctrl-Y Keybind | auto-migrated Priority-Medium Type-Defect | ```
What steps will reproduce the problem?
1.Open any file, type something
2.press ctrl-z (undo)
3.press ctrl-y (redo effect - native command expected)
What is the expected output? What do you see instead?
Redo expected, nothing happens.
What version of the product are you using? On what operating system?
ZC 0.7 / Np 5.8.6 / WinXP professional sp3 x32
Please provide any additional information below.
Keyboard binding for Evaluate Math Expression could be changed. I just disabled
this enhancement by commenting it out in ZC script.
```
-----
Original issue reported on code.google.com by `insom...@gmail.com` on 14 Apr 2011 at 12:32
* Merged into: #246 | 1.0 | Notepad++ Ctrl-Y Keybind - ```
What steps will reproduce the problem?
1.Open any file, type something
2.press ctrl-z (undo)
3.press ctrl-y (redo effect - native command expected)
What is the expected output? What do you see instead?
Redo expected, nothing happens.
What version of the product are you using? On what operating system?
ZC 0.7 / Np 5.8.6 / WinXP professional sp3 x32
Please provide any additional information below.
Keyboard binding for Evaluate Math Expression could be changed. I just disabled
this enhancement by commenting it out in ZC script.
```
-----
Original issue reported on code.google.com by `insom...@gmail.com` on 14 Apr 2011 at 12:32
* Merged into: #246 | defect | notepad ctrl y keybind what steps will reproduce the problem open any file type something press ctrl z undo press ctrl y redo effect native command expected what is the expected output what do you see instead redo expected nothing happens what version of the product are you using on what operating system zc np winxp professional please provide any additional information below keyboard binding for evaluate math expression could be changed i just disabled this enhancement by commenting it out in zc script original issue reported on code google com by insom gmail com on apr at merged into | 1 |
28,631 | 5,314,537,917 | IssuesEvent | 2017-02-13 15:17:43 | BOINC/boinc | https://api.github.com/repos/BOINC/boinc | closed | BOINC BSODs on Win10 at 7.6.33 | C: Client - Screen Saver E: to be determined T: Defect | Seeing a BSOD which I thought was being caused by MilkyWay GPU s/w I now think is a BOINC issue. I have several Win10 minidumps of the issue (I hope), or whatever windows takes when it goes blue. The reason why I think its GPU is I have that set only to run when I am away from the computer and when screensaver is running, that's when it always happens. I confirmed its nothing MilkyWay is doing specifically by disabling that project and installing a new project that uses GPU and same BSOD occurred.
CPU = AMD FX-8370 Eight-Core Processor, 4013 MHz, 4 Kern, 8 logische Prozessors
Mem = 16GB
Graphics = GeForce GTX 1080
Driver = Nvidia 376.33
OS = Microsoft Windows 10 Pro, 10.0.14393 Build 14393
Boinc = 7.6.33 (x64), wxWidgets = 3.0.1
Not sure if you get informed by Microsoft on issues related to your product or not. Please advise what you need next. I have MS DMP files if you know how to look at those, I could zip them up and attach here. | 1.0 | BOINC BSODs on Win10 at 7.6.33 - Seeing a BSOD which I thought was being caused by MilkyWay GPU s/w I now think is a BOINC issue. I have several Win10 minidumps of the issue (I hope), or whatever windows takes when it goes blue. The reason why I think its GPU is I have that set only to run when I am away from the computer and when screensaver is running, that's when it always happens. I confirmed its nothing MilkyWay is doing specifically by disabling that project and installing a new project that uses GPU and same BSOD occurred.
CPU = AMD FX-8370 Eight-Core Processor, 4013 MHz, 4 Kern, 8 logische Prozessors
Mem = 16GB
Graphics = GeForce GTX 1080
Driver = Nvidia 376.33
OS = Microsoft Windows 10 Pro, 10.0.14393 Build 14393
Boinc = 7.6.33 (x64), wxWidgets = 3.0.1
Not sure if you get informed by Microsoft on issues related to your product or not. Please advise what you need next. I have MS DMP files if you know how to look at those, I could zip them up and attach here. | defect | boinc bsods on at seeing a bsod which i thought was being caused by milkyway gpu s w i now think is a boinc issue i have several minidumps of the issue i hope or whatever windows takes when it goes blue the reason why i think its gpu is i have that set only to run when i am away from the computer and when screensaver is running that s when it always happens i confirmed its nothing milkyway is doing specifically by disabling that project and installing a new project that uses gpu and same bsod occurred cpu amd fx eight core processor mhz kern logische prozessors mem graphics geforce gtx driver nvidia os microsoft windows pro build boinc wxwidgets not sure if you get informed by microsoft on issues related to your product or not please advise what you need next i have ms dmp files if you know how to look at those i could zip them up and attach here | 1 |
47,892 | 12,132,446,693 | IssuesEvent | 2020-04-23 07:17:27 | kwk/test-llvm-bz-import-5 | https://api.github.com/repos/kwk/test-llvm-bz-import-5 | closed | hard-wired assumption that shared-library extension is ".so" | BZ-BUG-STATUS: RESOLVED BZ-RESOLUTION: FIXED Build scripts/Makefiles dummy import from bugzilla | This issue was imported from Bugzilla https://bugs.llvm.org/show_bug.cgi?id=214. | 1.0 | hard-wired assumption that shared-library extension is ".so" - This issue was imported from Bugzilla https://bugs.llvm.org/show_bug.cgi?id=214. | non_defect | hard wired assumption that shared library extension is so this issue was imported from bugzilla | 0 |
645,407 | 21,004,107,550 | IssuesEvent | 2022-03-29 20:32:22 | trufflesuite/truffle | https://api.github.com/repos/trufflesuite/truffle | closed | Error: Deployer._preFlightCheck when deploying | Migrations needs investigated priority2 ⚠️ | - [ ] I've asked for help in the [Truffle Gitter](http://gitter.im/Consensys/truffle) before filing this issue.
---------------------------
## Issue
When trying to deploy a smart contract which is using some interfaces, it returns the following error:
```
"MyContract" is an abstract contract or an interface and cannot be deployed.
Deployer._preFlightCheck
```
This is probably a bug cause when removing interfaces and adding them again it works
## Steps to Reproduce
Clone repo:
https://github.com/naszam/maker-badges
Run:
```
$ npm i
$ ganache-cli
$ truffle migrate
```
## Expected Behavior
Deploy the contracts on ganache-cli
## Actual Results
```
"MyContract" is an abstract contract or an interface and cannot be deployed.
Deployer._preFlightCheck
```
## Environment
* Operating System: Ubuntu 18.04
* Ethereum client:
* Truffle version (`truffle version`): v5.1.26
* node version (`node --version`): v13.13.0
* npm version (`npm --version`): 6.14.5
| 1.0 | Error: Deployer._preFlightCheck when deploying - - [ ] I've asked for help in the [Truffle Gitter](http://gitter.im/Consensys/truffle) before filing this issue.
---------------------------
## Issue
When trying to deploy a smart contract which is using some interfaces, it returns the following error:
```
"MyContract" is an abstract contract or an interface and cannot be deployed.
Deployer._preFlightCheck
```
This is probably a bug cause when removing interfaces and adding them again it works
## Steps to Reproduce
Clone repo:
https://github.com/naszam/maker-badges
Run:
```
$ npm i
$ ganache-cli
$ truffle migrate
```
## Expected Behavior
Deploy the contracts on ganache-cli
## Actual Results
```
"MyContract" is an abstract contract or an interface and cannot be deployed.
Deployer._preFlightCheck
```
## Environment
* Operating System: Ubuntu 18.04
* Ethereum client:
* Truffle version (`truffle version`): v5.1.26
* node version (`node --version`): v13.13.0
* npm version (`npm --version`): 6.14.5
| non_defect | error deployer preflightcheck when deploying i ve asked for help in the before filing this issue issue when trying to deploy a smart contract which is using some interfaces it returns the following error mycontract is an abstract contract or an interface and cannot be deployed deployer preflightcheck this is probably a bug cause when removing interfaces and adding them again it works steps to reproduce clone repo run npm i ganache cli truffle migrate expected behavior deploy the contracts on ganache cli actual results mycontract is an abstract contract or an interface and cannot be deployed deployer preflightcheck environment operating system ubuntu ethereum client truffle version truffle version node version node version npm version npm version | 0 |
71,141 | 23,467,821,227 | IssuesEvent | 2022-08-16 18:32:34 | vector-im/element-web | https://api.github.com/repos/vector-im/element-web | opened | Sidebar doesn't stay collapsed | T-Defect | ### Steps to reproduce
1. Collapse the sidebar
2. Make the window narrower
3. Make the window wider again
### Outcome
#### What did you expect?
Sidebar stays as big as it is, even if that means keeping it collapsed.
#### What happened instead?
Sidebar un-collapses.
### Operating system
Windows 10
### Application version
Element version: 1.11.3 Olm version: 3.2.12
### How did you install the app?
_No response_
### Homeserver
_No response_
### Will you send logs?
No | 1.0 | Sidebar doesn't stay collapsed - ### Steps to reproduce
1. Collapse the sidebar
2. Make the window narrower
3. Make the window wider again
### Outcome
#### What did you expect?
Sidebar stays as big as it is, even if that means keeping it collapsed.
#### What happened instead?
Sidebar un-collapses.
### Operating system
Windows 10
### Application version
Element version: 1.11.3 Olm version: 3.2.12
### How did you install the app?
_No response_
### Homeserver
_No response_
### Will you send logs?
No | defect | sidebar doesn t stay collapsed steps to reproduce collapse the sidebar make the window narrower make the window wider again outcome what did you expect sidebar stays as big as it is even if that means keeping it collapsed what happened instead sidebar un collapses operating system windows application version element version olm version how did you install the app no response homeserver no response will you send logs no | 1 |
9,725 | 3,068,674,499 | IssuesEvent | 2015-08-18 16:41:59 | websharks/html-compressor | https://api.github.com/repos/websharks/html-compressor | closed | Letters are missing, when use final HTML compression | bug tested/reproduced | When enable "Yes, compress (remove extra whitespace) in the final HTML code too." some Russian letters (like "Р") are missing. Please fix it.
 | 1.0 | Letters are missing, when use final HTML compression - When enable "Yes, compress (remove extra whitespace) in the final HTML code too." some Russian letters (like "Р") are missing. Please fix it.
 | non_defect | letters are missing when use final html compression when enable yes compress remove extra whitespace in the final html code too some russian letters like р are missing please fix it | 0 |
84,443 | 10,532,483,802 | IssuesEvent | 2019-10-01 10:51:25 | SharePoint/sp-dev-docs | https://api.github.com/repos/SharePoint/sp-dev-docs | closed | Are you able to set the URL as well as the list name using Site Scripts? | area:docs-comment area:site-design type:uservoice-request | Loving the Site Scripts but would be great if you can create a separate URL for the list to the name, especially with the aim to not have spaces in the URL that you would want in the description.
---
#### Document Details
⚠ *Do not edit this section. It is required for docs.microsoft.com ➟ GitHub issue linking.*
* ID: 68267476-ee8d-7b95-446b-711ddb683da2
* Version Independent ID: aa099b9d-48db-5513-11c7-32c49a27e5be
* Content: [Site design JSON schema](https://docs.microsoft.com/en-us/sharepoint/dev/declarative-customization/site-design-json-schema#see-also)
* Content Source: [docs/declarative-customization/site-design-json-schema.md](https://github.com/SharePoint/sp-dev-docs/blob/master/docs/declarative-customization/site-design-json-schema.md)
* Product: **sharepoint**
* GitHub Login: @spdevdocs
* Microsoft Alias: **spdevdocs** | 1.0 | Are you able to set the URL as well as the list name using Site Scripts? - Loving the Site Scripts but would be great if you can create a separate URL for the list to the name, especially with the aim to not have spaces in the URL that you would want in the description.
---
#### Document Details
⚠ *Do not edit this section. It is required for docs.microsoft.com ➟ GitHub issue linking.*
* ID: 68267476-ee8d-7b95-446b-711ddb683da2
* Version Independent ID: aa099b9d-48db-5513-11c7-32c49a27e5be
* Content: [Site design JSON schema](https://docs.microsoft.com/en-us/sharepoint/dev/declarative-customization/site-design-json-schema#see-also)
* Content Source: [docs/declarative-customization/site-design-json-schema.md](https://github.com/SharePoint/sp-dev-docs/blob/master/docs/declarative-customization/site-design-json-schema.md)
* Product: **sharepoint**
* GitHub Login: @spdevdocs
* Microsoft Alias: **spdevdocs** | non_defect | are you able to set the url as well as the list name using site scripts loving the site scripts but would be great if you can create a separate url for the list to the name especially with the aim to not have spaces in the url that you would want in the description document details ⚠ do not edit this section it is required for docs microsoft com ➟ github issue linking id version independent id content content source product sharepoint github login spdevdocs microsoft alias spdevdocs | 0 |
24,776 | 4,103,739,507 | IssuesEvent | 2016-06-04 21:59:52 | google/google-api-dotnet-client | https://api.github.com/repos/google/google-api-dotnet-client | closed | Support GZip encoding for a batch request | auto-migrated Component-Api Priority-Medium Type-Defect | ```
Currently a batch request doesn't support GZip because the server didn't
implement that feature. After the server will support that, we should add
support in that behavior in the client.
```
Original issue reported on code.google.com by `pele...@google.com` on 5 Nov 2013 at 4:19 | 1.0 | Support GZip encoding for a batch request - ```
Currently a batch request doesn't support GZip because the server didn't
implement that feature. After the server will support that, we should add
support in that behavior in the client.
```
Original issue reported on code.google.com by `pele...@google.com` on 5 Nov 2013 at 4:19 | defect | support gzip encoding for a batch request currently a batch request doesn t support gzip because the server didn t implement that feature after the server will support that we should add support in that behavior in the client original issue reported on code google com by pele google com on nov at | 1 |
369,599 | 10,915,223,233 | IssuesEvent | 2019-11-21 10:43:39 | incognitochain/incognito-wallet | https://api.github.com/repos/incognitochain/incognito-wallet | opened | App is crashed when going to previous state | Priority: Low Type: Bug | With an iPhone, you can go back to a previous window by swiping your finger from left to right, it forces the app to be crashed.
---
Device: iPhone 8 iOS 13.2.2
Device: iPhone 8 iOS 12.1.4
App version: 12.1.4
---
Please help to investigate. | 1.0 | App is crashed when going to previous state - With an iPhone, you can go back to a previous window by swiping your finger from left to right, it forces the app to be crashed.
---
Device: iPhone 8 iOS 13.2.2
Device: iPhone 8 iOS 12.1.4
App version: 12.1.4
---
Please help to investigate. | non_defect | app is crashed when going to previous state with an iphone you can go back to a previous window by swiping your finger from left to right it forces the app to be crashed device iphone ios device iphone ios app version please help to investigate | 0 |
16,657 | 2,922,174,964 | IssuesEvent | 2015-06-25 08:40:15 | simonwhelan/modelomatic | https://api.github.com/repos/simonwhelan/modelomatic | closed | Broken Prob() error | auto-migrated Priority-Medium Type-Defect | ```
What steps will reproduce the problem?
#running a large data set with either "fast" or "normal"
>modelomatic_OSX Phyllos_OR137_Funct_tAlign.phylip bionj
Phyllos_OR137_Funct_tAlign_mOm_results_fast.txt 0 fast
#or "normal"
>modelomatic_OSX Phyllos_OR137_Funct_tAlign.phylip bionj
Phyllos_OR137_Funct_tAlign_mOm_results_fast.txt 0 normal
What is the expected output? What do you see instead?
#Expected (using smaller data set):
--------------------------------------------------------------------------------
-------------
ModelOMatic (v1.01 (release)).
A program for choosing substitutions models for phylogenetic inference.
Written by Simon Whelan.
Contributions from James Allen, Ben Blackburne and David Talavera.
--------------------------------------------------------------------------------
-------------
Data:
</Volumes/Yango/Hayden_batORs/OR_alignments/Phyllos_OR4_Funct_tAlign.phylip>:
127 sequences of length 753 (DataMatrix: 127 x 666)
Checking for sparse (>85% gaps) sequences
Starting with 127 ... after removal there are 127 sequences
Creating start tree ... estimated using bionj (1.32627s)
Optimisation settings: normal
Scanning for modelomatic.ini file ... done
Working with genetic code: Universal
>>> Doing model analysis <<<
RY Done (26.7797s)
NT Done (124.74s)
AA Done (903.174s).........
Codon Done (2785.52s)
Outputting results to
</Volumes/Yango/Hayden_batORs/model_o_matic/Phyllos_OR4_Funct_tAlign_mOm_result_
normal.txt>
Successful exit
#What I got:
--------------------------------------------------------------------------------
-------------
ModelOMatic (v1.01 (release)).
A program for choosing substitutions models for phylogenetic inference.
Written by Simon Whelan.
Contributions from James Allen, Ben Blackburne and David Talavera.
--------------------------------------------------------------------------------
-------------
Data:
</Volumes/Yango/Hayden_batORs/OR_alignments/Phyllos_OR137_Funct_tAlign.phylip>:
452 sequences of length 804 (DataMatrix: 452 x 766)
Checking for sparse (>85% gaps) sequences
Starting with 452 ... after removal there are 452 sequences
Creating start tree ... estimated using bionj (5.02254s)
Optimisation settings: fast
Scanning for modelomatic.ini file ... done
Working with genetic code: Universal
>>> Doing model analysis <<<
RY Done (7.94116s)
NT Done (44.6001s)
Broken Prob(): -40.8111
What version of the product are you using? On what operating system?
I am using the macOSX binary. I am running Yosemite 10.10.3
Please provide any additional information below.
I attached the input both nexus file. The OR4 is working, while the OR137 is
not working.
What does the Broken Prob(): error mean and how can I address it?
Thanks for your help!
```
Original issue reported on code.google.com by `loloy...@gmail.com` on 3 May 2015 at 5:41
Attachments:
* [Phyllos_OR137_Funct_tAlign.phylip](https://storage.googleapis.com/google-code-attachments/modelomatic/issue-1/comment-0/Phyllos_OR137_Funct_tAlign.phylip)
* [Phyllos_OR4_Funct_tAlign.phylip](https://storage.googleapis.com/google-code-attachments/modelomatic/issue-1/comment-0/Phyllos_OR4_Funct_tAlign.phylip)
| 1.0 | Broken Prob() error - ```
What steps will reproduce the problem?
#running a large data set with either "fast" or "normal"
>modelomatic_OSX Phyllos_OR137_Funct_tAlign.phylip bionj
Phyllos_OR137_Funct_tAlign_mOm_results_fast.txt 0 fast
#or "normal"
>modelomatic_OSX Phyllos_OR137_Funct_tAlign.phylip bionj
Phyllos_OR137_Funct_tAlign_mOm_results_fast.txt 0 normal
What is the expected output? What do you see instead?
#Expected (using smaller data set):
--------------------------------------------------------------------------------
-------------
ModelOMatic (v1.01 (release)).
A program for choosing substitutions models for phylogenetic inference.
Written by Simon Whelan.
Contributions from James Allen, Ben Blackburne and David Talavera.
--------------------------------------------------------------------------------
-------------
Data:
</Volumes/Yango/Hayden_batORs/OR_alignments/Phyllos_OR4_Funct_tAlign.phylip>:
127 sequences of length 753 (DataMatrix: 127 x 666)
Checking for sparse (>85% gaps) sequences
Starting with 127 ... after removal there are 127 sequences
Creating start tree ... estimated using bionj (1.32627s)
Optimisation settings: normal
Scanning for modelomatic.ini file ... done
Working with genetic code: Universal
>>> Doing model analysis <<<
RY Done (26.7797s)
NT Done (124.74s)
AA Done (903.174s).........
Codon Done (2785.52s)
Outputting results to
</Volumes/Yango/Hayden_batORs/model_o_matic/Phyllos_OR4_Funct_tAlign_mOm_result_
normal.txt>
Successful exit
#What I got:
--------------------------------------------------------------------------------
-------------
ModelOMatic (v1.01 (release)).
A program for choosing substitutions models for phylogenetic inference.
Written by Simon Whelan.
Contributions from James Allen, Ben Blackburne and David Talavera.
--------------------------------------------------------------------------------
-------------
Data:
</Volumes/Yango/Hayden_batORs/OR_alignments/Phyllos_OR137_Funct_tAlign.phylip>:
452 sequences of length 804 (DataMatrix: 452 x 766)
Checking for sparse (>85% gaps) sequences
Starting with 452 ... after removal there are 452 sequences
Creating start tree ... estimated using bionj (5.02254s)
Optimisation settings: fast
Scanning for modelomatic.ini file ... done
Working with genetic code: Universal
>>> Doing model analysis <<<
RY Done (7.94116s)
NT Done (44.6001s)
Broken Prob(): -40.8111
What version of the product are you using? On what operating system?
I am using the macOSX binary. I am running Yosemite 10.10.3
Please provide any additional information below.
I attached the input both nexus file. The OR4 is working, while the OR137 is
not working.
What does the Broken Prob(): error mean and how can I address it?
Thanks for your help!
```
Original issue reported on code.google.com by `loloy...@gmail.com` on 3 May 2015 at 5:41
Attachments:
* [Phyllos_OR137_Funct_tAlign.phylip](https://storage.googleapis.com/google-code-attachments/modelomatic/issue-1/comment-0/Phyllos_OR137_Funct_tAlign.phylip)
* [Phyllos_OR4_Funct_tAlign.phylip](https://storage.googleapis.com/google-code-attachments/modelomatic/issue-1/comment-0/Phyllos_OR4_Funct_tAlign.phylip)
| defect | broken prob error what steps will reproduce the problem running a large data set with either fast or normal modelomatic osx phyllos funct talign phylip bionj phyllos funct talign mom results fast txt fast or normal modelomatic osx phyllos funct talign phylip bionj phyllos funct talign mom results fast txt normal what is the expected output what do you see instead expected using smaller data set modelomatic release a program for choosing substitutions models for phylogenetic inference written by simon whelan contributions from james allen ben blackburne and david talavera data sequences of length datamatrix x checking for sparse gaps sequences starting with after removal there are sequences creating start tree estimated using bionj optimisation settings normal scanning for modelomatic ini file done working with genetic code universal doing model analysis ry done nt done aa done codon done outputting results to volumes yango hayden bators model o matic phyllos funct talign mom result normal txt successful exit what i got modelomatic release a program for choosing substitutions models for phylogenetic inference written by simon whelan contributions from james allen ben blackburne and david talavera data sequences of length datamatrix x checking for sparse gaps sequences starting with after removal there are sequences creating start tree estimated using bionj optimisation settings fast scanning for modelomatic ini file done working with genetic code universal doing model analysis ry done nt done broken prob what version of the product are you using on what operating system i am using the macosx binary i am running yosemite please provide any additional information below i attached the input both nexus file the is working while the is not working what does the broken prob error mean and how can i address it thanks for your help original issue reported on code google com by loloy gmail com on may at attachments | 1 |
29,786 | 5,891,534,592 | IssuesEvent | 2017-05-17 17:17:47 | CocoaPods/CocoaPods | https://api.github.com/repos/CocoaPods/CocoaPods | closed | "Unable to find host target(s)" with static library target | s2:confirmed t2:defect | ## What did you do?
Run `pod install` to install dependencies on a project StaticLib containing a single **Cocoa Touch Static Library** target.
## What did you expect to happen?
Install all pod dependencies correctly.
Note that if I had a project containing a single **Cocoa Touch Dynamic Framework target**, `pod install` would **just log a warning** about missing host target instead of failing.
I think that the **same should happen for static library** targets.
## What happened instead?
Installation fails with the following error message:
```
[!] Unable to find host target(s) for StaticLib. Please add the host targets for the embedded targets to the Podfile.
Certain kinds of targets require a host target. A host target is a "parent" target which embeds a "child" target. These are example types of targets that need a host target:
- Framework
- App Extension
- Watch OS 1 Extension
- Messages Extension (except when used with a Messages Application)
```
## CocoaPods Environment
### Stack
```
CocoaPods : 1.2.1
Ruby : ruby 2.0.0p648 (2015-12-16 revision 53162) [universal.x86_64-darwin16]
RubyGems : 2.0.14.1
Host : Mac OS X 10.12.4 (16E195)
Xcode : 8.3.1 (8E1000a)
Git : git version 2.11.0 (Apple Git-81)
Ruby lib dir : /System/Library/Frameworks/Ruby.framework/Versions/2.0/usr/lib
master - https://github.com/CocoaPods/Specs.git @ a91d4fe9993eea485f42845382746218dcaf38a9
```
### Installation Source
```
Executable Path: /usr/local/bin/pod
```
### Plugins
```
cocoapods-art : 1.0.0
cocoapods-deintegrate : 1.0.1
cocoapods-dependencies : 1.0.0
cocoapods-plugins : 1.0.0
cocoapods-search : 1.0.0
cocoapods-stats : 1.0.0
cocoapods-trunk : 1.2.0
cocoapods-try : 1.1.0
slather : 2.3.0
```
### Podfile
```ruby
platform :ios, 10
target 'StaticLib'
pod 'AFNetworking'
project 'StaticLib/StaticLib.xcodeproj'
```
## Project that demonstrates the issue
See project at https://bitbucket.org/mirkoluchi/cocoapods-issues (folder issue-6673)
| 1.0 | "Unable to find host target(s)" with static library target - ## What did you do?
Run `pod install` to install dependencies on a project StaticLib containing a single **Cocoa Touch Static Library** target.
## What did you expect to happen?
Install all pod dependencies correctly.
Note that if I had a project containing a single **Cocoa Touch Dynamic Framework target**, `pod install` would **just log a warning** about missing host target instead of failing.
I think that the **same should happen for static library** targets.
## What happened instead?
Installation fails with the following error message:
```
[!] Unable to find host target(s) for StaticLib. Please add the host targets for the embedded targets to the Podfile.
Certain kinds of targets require a host target. A host target is a "parent" target which embeds a "child" target. These are example types of targets that need a host target:
- Framework
- App Extension
- Watch OS 1 Extension
- Messages Extension (except when used with a Messages Application)
```
## CocoaPods Environment
### Stack
```
CocoaPods : 1.2.1
Ruby : ruby 2.0.0p648 (2015-12-16 revision 53162) [universal.x86_64-darwin16]
RubyGems : 2.0.14.1
Host : Mac OS X 10.12.4 (16E195)
Xcode : 8.3.1 (8E1000a)
Git : git version 2.11.0 (Apple Git-81)
Ruby lib dir : /System/Library/Frameworks/Ruby.framework/Versions/2.0/usr/lib
master - https://github.com/CocoaPods/Specs.git @ a91d4fe9993eea485f42845382746218dcaf38a9
```
### Installation Source
```
Executable Path: /usr/local/bin/pod
```
### Plugins
```
cocoapods-art : 1.0.0
cocoapods-deintegrate : 1.0.1
cocoapods-dependencies : 1.0.0
cocoapods-plugins : 1.0.0
cocoapods-search : 1.0.0
cocoapods-stats : 1.0.0
cocoapods-trunk : 1.2.0
cocoapods-try : 1.1.0
slather : 2.3.0
```
### Podfile
```ruby
platform :ios, 10
target 'StaticLib'
pod 'AFNetworking'
project 'StaticLib/StaticLib.xcodeproj'
```
## Project that demonstrates the issue
See project at https://bitbucket.org/mirkoluchi/cocoapods-issues (folder issue-6673)
| defect | unable to find host target s with static library target what did you do run pod install to install dependencies on a project staticlib containing a single cocoa touch static library target what did you expect to happen install all pod dependencies correctly note that if i had a project containing a single cocoa touch dynamic framework target pod install would just log a warning about missing host target instead of failing i think that the same should happen for static library targets what happened instead installation fails with the following error message unable to find host target s for staticlib please add the host targets for the embedded targets to the podfile certain kinds of targets require a host target a host target is a parent target which embeds a child target these are example types of targets that need a host target framework app extension watch os extension messages extension except when used with a messages application cocoapods environment stack cocoapods ruby ruby revision rubygems host mac os x xcode git git version apple git ruby lib dir system library frameworks ruby framework versions usr lib master installation source executable path usr local bin pod plugins cocoapods art cocoapods deintegrate cocoapods dependencies cocoapods plugins cocoapods search cocoapods stats cocoapods trunk cocoapods try slather podfile ruby platform ios target staticlib pod afnetworking project staticlib staticlib xcodeproj project that demonstrates the issue see project at folder issue | 1 |
275,149 | 8,575,038,036 | IssuesEvent | 2018-11-12 16:15:37 | poanetwork/blockscout | https://api.github.com/repos/poanetwork/blockscout | closed | Transaction Details 404 page | enhancement in progress priority: high team: developer | If a transaction does not exist yet, we should not show a standard 404 page. Instead, we should show the TX details page but with a message stating that our node hasn't picked up the transaction yet and the page will update automatically when it does.
1. If the user is on the correct route for the transaction details page but the tx hash is not found in the DB, we should show the normal transaction details page but with a message stating to please be patient while our nodes search for the transaction.
2. We should subscribe to both pending transactions and incoming blocks to find the transaction hash.
3. If the tx hash is found, refresh the page to show either the pending state or collated state.
### Aceptance Criterias
- Verify the TxHash in order to identify if the hash is or not valid and show to the user the correct page behavior:
- For invalid hashes:
- Show a warning message when the TxHash is invalid;
- Message example: [Etherscan](https://etherscan.io/tx/0x0959bc78373b6c206728c3f6eff6ffd3b85b0838aa60628d6df27a53971);
- For pending transactions:
- Show the TxDetails Page when it's valid but doesn't exist. Suggested sentence: ```Please be patient while our nodes search for the transaction.```
- Show a spinner for the pending transactions;
- Show complementary information about the pending transaction process;
- Information Example: [Etherscan](https://etherscan.io/tx/0x0959bc78373b6c206728c3f6eff6ffd3b85b0838aa60628d6df9121827a53971)
- As soon as the txHash get processed the Hash's TxDetail Page needs to be refreshed with it's current state.
### Tasks
- [x] Change controller to not redirect to the 404 page and insert the transaction hash when it is valid;
- [x] Send the hash to the `realtime` indexer to be indexed;
- [x] Alter view to show message of "Transaction not indexed yet."
- [x] Subscribe to pending "transactions" and "incoming blocks" websockets so when the transaction is indexed show in the view;
- [x] When the transaction hash is invalid show message: "Transaction hash invalid."
| 1.0 | Transaction Details 404 page - If a transaction does not exist yet, we should not show a standard 404 page. Instead, we should show the TX details page but with a message stating that our node hasn't picked up the transaction yet and the page will update automatically when it does.
1. If the user is on the correct route for the transaction details page but the tx hash is not found in the DB, we should show the normal transaction details page but with a message stating to please be patient while our nodes search for the transaction.
2. We should subscribe to both pending transactions and incoming blocks to find the transaction hash.
3. If the tx hash is found, refresh the page to show either the pending state or collated state.
### Aceptance Criterias
- Verify the TxHash in order to identify if the hash is or not valid and show to the user the correct page behavior:
- For invalid hashes:
- Show a warning message when the TxHash is invalid;
- Message example: [Etherscan](https://etherscan.io/tx/0x0959bc78373b6c206728c3f6eff6ffd3b85b0838aa60628d6df27a53971);
- For pending transactions:
- Show the TxDetails Page when it's valid but doesn't exist. Suggested sentence: ```Please be patient while our nodes search for the transaction.```
- Show a spinner for the pending transactions;
- Show complementary information about the pending transaction process;
- Information Example: [Etherscan](https://etherscan.io/tx/0x0959bc78373b6c206728c3f6eff6ffd3b85b0838aa60628d6df9121827a53971)
- As soon as the txHash get processed the Hash's TxDetail Page needs to be refreshed with it's current state.
### Tasks
- [x] Change controller to not redirect to the 404 page and insert the transaction hash when it is valid;
- [x] Send the hash to the `realtime` indexer to be indexed;
- [x] Alter view to show message of "Transaction not indexed yet."
- [x] Subscribe to pending "transactions" and "incoming blocks" websockets so when the transaction is indexed show in the view;
- [x] When the transaction hash is invalid show message: "Transaction hash invalid."
| non_defect | transaction details page if a transaction does not exist yet we should not show a standard page instead we should show the tx details page but with a message stating that our node hasn t picked up the transaction yet and the page will update automatically when it does if the user is on the correct route for the transaction details page but the tx hash is not found in the db we should show the normal transaction details page but with a message stating to please be patient while our nodes search for the transaction we should subscribe to both pending transactions and incoming blocks to find the transaction hash if the tx hash is found refresh the page to show either the pending state or collated state aceptance criterias verify the txhash in order to identify if the hash is or not valid and show to the user the correct page behavior for invalid hashes show a warning message when the txhash is invalid message example for pending transactions show the txdetails page when it s valid but doesn t exist suggested sentence please be patient while our nodes search for the transaction show a spinner for the pending transactions show complementary information about the pending transaction process information example as soon as the txhash get processed the hash s txdetail page needs to be refreshed with it s current state tasks change controller to not redirect to the page and insert the transaction hash when it is valid send the hash to the realtime indexer to be indexed alter view to show message of transaction not indexed yet subscribe to pending transactions and incoming blocks websockets so when the transaction is indexed show in the view when the transaction hash is invalid show message transaction hash invalid | 0 |
19,392 | 3,198,773,653 | IssuesEvent | 2015-10-01 14:00:38 | compomics/searchgui | https://api.github.com/repos/compomics/searchgui | closed | Database import failed | auto-migrated Priority-Medium Type-Defect | ```
I tried to import a self-made database which apperently worked well, as all
sequences were read in and search-GUI (like usually) asks if I alsol want to
add the decoys to the DB. Answering with yes, it does so.
But, after this step the message occurs:
"FASTA Import Error
File D:\\..."
I do not get a specific error message (Eg. non-unique accession number).
However, after clicking ok, searchGUI shows to have 140560 sequences importet:
Generic header 138137, NCBI 1541, User Defined 882.
Still, when I want to open the searchGUI result folder with the peptide shaker,
it fails.
A typical DB entry of my fasta looks like this:
>generic|frv2_1|franssen_1_1 RecName: Full=Calnexin homolog; Flags: Precursor
[Pisum sativum] (gi_388497580, identical cov:74%, e-value:9e-26)
PVKPPVTIPPIFRHKNPKTGKHVEHHLKFPPSVPSDKLSHVYTAVLKDDNEVSILMMAKEKKKAKFLILLKYFEPRP
I tried to stick to the recommendations of your fasta parsing rules.
Is there anything wrong with my fasta. Could I upload my fasta somewhere so you
might check whats has gone wrong here?
Cheers,
Reinhard Turetschek
PS: Thanks for introducing Peptide Shaker to me at Semmering. I really love it!
I hope more and more people are going to use it.
```
Original issue reported on code.google.com by `reinhard...@gmail.com` on 7 Aug 2015 at 5:29 | 1.0 | Database import failed - ```
I tried to import a self-made database which apperently worked well, as all
sequences were read in and search-GUI (like usually) asks if I alsol want to
add the decoys to the DB. Answering with yes, it does so.
But, after this step the message occurs:
"FASTA Import Error
File D:\\..."
I do not get a specific error message (Eg. non-unique accession number).
However, after clicking ok, searchGUI shows to have 140560 sequences importet:
Generic header 138137, NCBI 1541, User Defined 882.
Still, when I want to open the searchGUI result folder with the peptide shaker,
it fails.
A typical DB entry of my fasta looks like this:
>generic|frv2_1|franssen_1_1 RecName: Full=Calnexin homolog; Flags: Precursor
[Pisum sativum] (gi_388497580, identical cov:74%, e-value:9e-26)
PVKPPVTIPPIFRHKNPKTGKHVEHHLKFPPSVPSDKLSHVYTAVLKDDNEVSILMMAKEKKKAKFLILLKYFEPRP
I tried to stick to the recommendations of your fasta parsing rules.
Is there anything wrong with my fasta. Could I upload my fasta somewhere so you
might check whats has gone wrong here?
Cheers,
Reinhard Turetschek
PS: Thanks for introducing Peptide Shaker to me at Semmering. I really love it!
I hope more and more people are going to use it.
```
Original issue reported on code.google.com by `reinhard...@gmail.com` on 7 Aug 2015 at 5:29 | defect | database import failed i tried to import a self made database which apperently worked well as all sequences were read in and search gui like usually asks if i alsol want to add the decoys to the db answering with yes it does so but after this step the message occurs fasta import error file d i do not get a specific error message eg non unique accession number however after clicking ok searchgui shows to have sequences importet generic header ncbi user defined still when i want to open the searchgui result folder with the peptide shaker it fails a typical db entry of my fasta looks like this generic franssen recname full calnexin homolog flags precursor gi identical cov e value pvkppvtippifrhknpktgkhvehhlkfppsvpsdklshvytavlkddnevsilmmakekkkakflillkyfeprp i tried to stick to the recommendations of your fasta parsing rules is there anything wrong with my fasta could i upload my fasta somewhere so you might check whats has gone wrong here cheers reinhard turetschek ps thanks for introducing peptide shaker to me at semmering i really love it i hope more and more people are going to use it original issue reported on code google com by reinhard gmail com on aug at | 1 |
53,226 | 13,261,216,324 | IssuesEvent | 2020-08-20 19:29:39 | icecube-trac/tix4 | https://api.github.com/repos/icecube-trac/tix4 | closed | Steamshovel in Python 3 (Trac #1005) | Migrated from Trac combo core defect |
```text
[ 86%] Building CXX object steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In
static member function ‘static void * scripting::shovelart
::QStringConversion::convertible(PyObject *)’:
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:210:
error: ‘PyString_Check’ was not declared in this scope
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In
static member function ‘static void scripting::shovelart
::QStringConversion::construct(
PyObject *, boost::python::converter::rvalue_from_python_stage1_data
*)’:
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:215:
error: ‘PyString_AsString’ was not declared in this scope
make[3]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o] Error 1
make[2]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/all] Error 2
make[1]: *** [steamshovel/CMakeFiles/steamshovel.dir/rule] Error 2
make: *** [steamshovel] Error 2
```
<details>
<summary><em>Migrated from <a href="https://code.icecube.wisc.edu/projects/icecube/ticket/1005">https://code.icecube.wisc.edu/projects/icecube/ticket/1005</a>, reported by moriah.tobinand owned by hdembinski</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2015-10-12T14:11:44",
"_ts": "1444659104505675",
"description": "{{{\n[ 86%] Building CXX object steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In\n static member function \u2018static void * scripting::shovelart\n ::QStringConversion::convertible(PyObject *)\u2019:\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:210:\n error: \u2018PyString_Check\u2019 was not declared in this scope\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In\n static member function \u2018static void scripting::shovelart\n ::QStringConversion::construct(\n PyObject *, boost::python::converter::rvalue_from_python_stage1_data\n *)\u2019:\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:215:\n error: \u2018PyString_AsString\u2019 was not declared in this scope\nmake[3]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o] Error 1\nmake[2]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/all] Error 2\nmake[1]: *** [steamshovel/CMakeFiles/steamshovel.dir/rule] Error 2\nmake: *** [steamshovel] Error 2\n}}}",
"reporter": "moriah.tobin",
"cc": "david.schultz",
"resolution": "fixed",
"time": "2015-05-28T20:57:28",
"component": "combo core",
"summary": "Steamshovel in Python 3",
"priority": "blocker",
"keywords": "",
"milestone": "Long-Term Future",
"owner": "hdembinski",
"type": "defect"
}
```
</p>
</details>
| 1.0 | Steamshovel in Python 3 (Trac #1005) -
```text
[ 86%] Building CXX object steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In
static member function ‘static void * scripting::shovelart
::QStringConversion::convertible(PyObject *)’:
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:210:
error: ‘PyString_Check’ was not declared in this scope
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In
static member function ‘static void scripting::shovelart
::QStringConversion::construct(
PyObject *, boost::python::converter::rvalue_from_python_stage1_data
*)’:
/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:215:
error: ‘PyString_AsString’ was not declared in this scope
make[3]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o] Error 1
make[2]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/all] Error 2
make[1]: *** [steamshovel/CMakeFiles/steamshovel.dir/rule] Error 2
make: *** [steamshovel] Error 2
```
<details>
<summary><em>Migrated from <a href="https://code.icecube.wisc.edu/projects/icecube/ticket/1005">https://code.icecube.wisc.edu/projects/icecube/ticket/1005</a>, reported by moriah.tobinand owned by hdembinski</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2015-10-12T14:11:44",
"_ts": "1444659104505675",
"description": "{{{\n[ 86%] Building CXX object steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In\n static member function \u2018static void * scripting::shovelart\n ::QStringConversion::convertible(PyObject *)\u2019:\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:210:\n error: \u2018PyString_Check\u2019 was not declared in this scope\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp: In\n static member function \u2018static void scripting::shovelart\n ::QStringConversion::construct(\n PyObject *, boost::python::converter::rvalue_from_python_stage1_data\n *)\u2019:\n/home/mntobin/IceRec/src/steamshovel/private/shovelart/pybindings/Types.cpp:215:\n error: \u2018PyString_AsString\u2019 was not declared in this scope\nmake[3]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/private/shovelart/pybindings/Types.cpp.o] Error 1\nmake[2]: *** [steamshovel/CMakeFiles/shovelart-pybindings.dir/all] Error 2\nmake[1]: *** [steamshovel/CMakeFiles/steamshovel.dir/rule] Error 2\nmake: *** [steamshovel] Error 2\n}}}",
"reporter": "moriah.tobin",
"cc": "david.schultz",
"resolution": "fixed",
"time": "2015-05-28T20:57:28",
"component": "combo core",
"summary": "Steamshovel in Python 3",
"priority": "blocker",
"keywords": "",
"milestone": "Long-Term Future",
"owner": "hdembinski",
"type": "defect"
}
```
</p>
</details>
| defect | steamshovel in python trac text building cxx object steamshovel cmakefiles shovelart pybindings dir private shovelart pybindings types cpp o home mntobin icerec src steamshovel private shovelart pybindings types cpp in static member function ‘static void scripting shovelart qstringconversion convertible pyobject ’ home mntobin icerec src steamshovel private shovelart pybindings types cpp error ‘pystring check’ was not declared in this scope home mntobin icerec src steamshovel private shovelart pybindings types cpp in static member function ‘static void scripting shovelart qstringconversion construct pyobject boost python converter rvalue from python data ’ home mntobin icerec src steamshovel private shovelart pybindings types cpp error ‘pystring asstring’ was not declared in this scope make error make error make error make error migrated from json status closed changetime ts description n building cxx object steamshovel cmakefiles shovelart pybindings dir private shovelart pybindings types cpp o n home mntobin icerec src steamshovel private shovelart pybindings types cpp in n static member function void scripting shovelart n qstringconversion convertible pyobject n home mntobin icerec src steamshovel private shovelart pybindings types cpp n error check was not declared in this scope n home mntobin icerec src steamshovel private shovelart pybindings types cpp in n static member function void scripting shovelart n qstringconversion construct n pyobject boost python converter rvalue from python data n n home mntobin icerec src steamshovel private shovelart pybindings types cpp n error asstring was not declared in this scope nmake error nmake error nmake error nmake error n reporter moriah tobin cc david schultz resolution fixed time component combo core summary steamshovel in python priority blocker keywords milestone long term future owner hdembinski type defect | 1 |
327,037 | 28,038,809,496 | IssuesEvent | 2023-03-28 16:53:33 | paradigmxyz/reth | https://api.github.com/repos/paradigmxyz/reth | opened | Improve network with txpool test coverage | C-enhancement A-tx-pool C-test A-networking | ### Describe the feature
https://github.com/paradigmxyz/reth/pull/1901 surfaced several bugs in the network <-> pool integration that went unnoticed until #2004
to catch these, test coverage with installed txpool service needs to be improved
## TODO
* add new `network` integration tests with txpool task
* ensure transactions can be exchanged properly
### Additional context
_No response_ | 1.0 | Improve network with txpool test coverage - ### Describe the feature
https://github.com/paradigmxyz/reth/pull/1901 surfaced several bugs in the network <-> pool integration that went unnoticed until #2004
to catch these, test coverage with installed txpool service needs to be improved
## TODO
* add new `network` integration tests with txpool task
* ensure transactions can be exchanged properly
### Additional context
_No response_ | non_defect | improve network with txpool test coverage describe the feature surfaced several bugs in the network pool integration that went unnoticed until to catch these test coverage with installed txpool service needs to be improved todo add new network integration tests with txpool task ensure transactions can be exchanged properly additional context no response | 0 |
25,745 | 4,440,041,423 | IssuesEvent | 2016-08-19 00:48:37 | FoldingAtHome/fah-client-pub | https://api.github.com/repos/FoldingAtHome/fah-client-pub | closed | GPU "not configured" still downloads WUs and repeatedly fails | defect | Trac | Data
---: | :---
Ticket | 1133
Reported by | @bb30994
Status | new
Component | FAHClient
Priority | 5
In certain rare instances, a GPU can be classified as "not configured" but it's still attached to a slot and can be started, resulting in a series of dumped WUs. The slot needs to be smart enough to disable itself and prevent the downloads. | 1.0 | GPU "not configured" still downloads WUs and repeatedly fails - Trac | Data
---: | :---
Ticket | 1133
Reported by | @bb30994
Status | new
Component | FAHClient
Priority | 5
In certain rare instances, a GPU can be classified as "not configured" but it's still attached to a slot and can be started, resulting in a series of dumped WUs. The slot needs to be smart enough to disable itself and prevent the downloads. | defect | gpu not configured still downloads wus and repeatedly fails trac data ticket reported by status new component fahclient priority in certain rare instances a gpu can be classified as not configured but it s still attached to a slot and can be started resulting in a series of dumped wus the slot needs to be smart enough to disable itself and prevent the downloads | 1 |
6,998 | 2,610,321,283 | IssuesEvent | 2015-02-26 19:43:37 | chrsmith/republic-at-war | https://api.github.com/repos/chrsmith/republic-at-war | closed | CRASH | auto-migrated Priority-Medium Type-Defect | ```
Stolen AAT available at the merc center without the upgrade. (probably causes
crash if built anyway)
```
-----
Original issue reported on code.google.com by `z3r0...@gmail.com` on 9 May 2011 at 12:08 | 1.0 | CRASH - ```
Stolen AAT available at the merc center without the upgrade. (probably causes
crash if built anyway)
```
-----
Original issue reported on code.google.com by `z3r0...@gmail.com` on 9 May 2011 at 12:08 | defect | crash stolen aat available at the merc center without the upgrade probably causes crash if built anyway original issue reported on code google com by gmail com on may at | 1 |
19,653 | 4,428,447,353 | IssuesEvent | 2016-08-17 02:21:42 | Automattic/facebook-instant-articles-wp | https://api.github.com/repos/Automattic/facebook-instant-articles-wp | closed | Using separate front/back-end URLs | Documentation | Following on from #325 we should document the need for the Facebook app to use the backend URL in order to authenticate the plugin. Including;
* App can only have one app domain
* That app domain must be the backend URL
* If an app is used for frontend things, a separate app will be needed for the backend | 1.0 | Using separate front/back-end URLs - Following on from #325 we should document the need for the Facebook app to use the backend URL in order to authenticate the plugin. Including;
* App can only have one app domain
* That app domain must be the backend URL
* If an app is used for frontend things, a separate app will be needed for the backend | non_defect | using separate front back end urls following on from we should document the need for the facebook app to use the backend url in order to authenticate the plugin including app can only have one app domain that app domain must be the backend url if an app is used for frontend things a separate app will be needed for the backend | 0 |
34,043 | 7,330,106,636 | IssuesEvent | 2018-03-05 08:44:52 | primefaces/primeng | https://api.github.com/repos/primefaces/primeng | closed | PanelMenu ignores the visible attribute | defect | ### There is no guarantee in receiving a response in GitHub Issue Tracker, If you'd like to secure our response, you may consider *PrimeNG PRO Support* where support is provided within 4 business hours
**I'm submitting a ...** (check one with "x")
```
[x ] bug report => Search github for a similar issue or PR before submitting
[ ] feature request => Please check if request is not on the roadmap already https://github.com/primefaces/primeng/wiki/Roadmap
[ ] support request => Please do not submit support request here, instead see http://forum.primefaces.org/viewforum.php?f=35
```
**Plunkr Case (Bug Reports)**
Please fork the plunkr below and create a case demonstrating your bug report. Issues without a plunkr have much less possibility to be reviewed.
http://plnkr.co/edit/qoGVXTaRPAQ0ZpWtS0SA?p=preview
**Current behavior**
The visible attribute in the p-panelMenu is ignored.
The same behavior existed for tieredMenu and was fixed with issue #4502
**Expected behavior**
If visible property is set to false, menu item must be hidden.
**Minimal reproduction of the problem with instructions**
<!--
If the current behavior is a bug or you can illustrate your feature request better with an example,
please provide the *STEPS TO REPRODUCE* and if possible a *MINIMAL DEMO* of the problem via
https://plnkr.co or similar (you can use this template as a starting point: http://plnkr.co/edit/tpl:AvJOMERrnz94ekVua0u5).
-->
**What is the motivation / use case for changing the behavior?**
Without visible support I will have to find another way to hide menu items based on user role. Potentially building a separate menu list for every role in the system, which is not ideal.
**Please tell us about your environment:**
Windows 7, Angluar CLI 1.6.3, Node 8.8.1
* **Angular version:** 5.1.3
<!-- Check whether this is still an issue in the most recent Angular version -->
* **PrimeNG version:** 5.0.2
* **Browser:** Firefox 57, Chrome 63
* **Language:** [all | TypeScript X.X | ES6/7 | ES5]
* **Node (for AoT issues):** `node --version` =
| 1.0 | PanelMenu ignores the visible attribute - ### There is no guarantee in receiving a response in GitHub Issue Tracker, If you'd like to secure our response, you may consider *PrimeNG PRO Support* where support is provided within 4 business hours
**I'm submitting a ...** (check one with "x")
```
[x ] bug report => Search github for a similar issue or PR before submitting
[ ] feature request => Please check if request is not on the roadmap already https://github.com/primefaces/primeng/wiki/Roadmap
[ ] support request => Please do not submit support request here, instead see http://forum.primefaces.org/viewforum.php?f=35
```
**Plunkr Case (Bug Reports)**
Please fork the plunkr below and create a case demonstrating your bug report. Issues without a plunkr have much less possibility to be reviewed.
http://plnkr.co/edit/qoGVXTaRPAQ0ZpWtS0SA?p=preview
**Current behavior**
The visible attribute in the p-panelMenu is ignored.
The same behavior existed for tieredMenu and was fixed with issue #4502
**Expected behavior**
If visible property is set to false, menu item must be hidden.
**Minimal reproduction of the problem with instructions**
<!--
If the current behavior is a bug or you can illustrate your feature request better with an example,
please provide the *STEPS TO REPRODUCE* and if possible a *MINIMAL DEMO* of the problem via
https://plnkr.co or similar (you can use this template as a starting point: http://plnkr.co/edit/tpl:AvJOMERrnz94ekVua0u5).
-->
**What is the motivation / use case for changing the behavior?**
Without visible support I will have to find another way to hide menu items based on user role. Potentially building a separate menu list for every role in the system, which is not ideal.
**Please tell us about your environment:**
Windows 7, Angluar CLI 1.6.3, Node 8.8.1
* **Angular version:** 5.1.3
<!-- Check whether this is still an issue in the most recent Angular version -->
* **PrimeNG version:** 5.0.2
* **Browser:** Firefox 57, Chrome 63
* **Language:** [all | TypeScript X.X | ES6/7 | ES5]
* **Node (for AoT issues):** `node --version` =
| defect | panelmenu ignores the visible attribute there is no guarantee in receiving a response in github issue tracker if you d like to secure our response you may consider primeng pro support where support is provided within business hours i m submitting a check one with x bug report search github for a similar issue or pr before submitting feature request please check if request is not on the roadmap already support request please do not submit support request here instead see plunkr case bug reports please fork the plunkr below and create a case demonstrating your bug report issues without a plunkr have much less possibility to be reviewed current behavior the visible attribute in the p panelmenu is ignored the same behavior existed for tieredmenu and was fixed with issue expected behavior if visible property is set to false menu item must be hidden minimal reproduction of the problem with instructions if the current behavior is a bug or you can illustrate your feature request better with an example please provide the steps to reproduce and if possible a minimal demo of the problem via or similar you can use this template as a starting point what is the motivation use case for changing the behavior without visible support i will have to find another way to hide menu items based on user role potentially building a separate menu list for every role in the system which is not ideal please tell us about your environment windows angluar cli node angular version primeng version browser firefox chrome language node for aot issues node version | 1 |
42,519 | 11,099,239,142 | IssuesEvent | 2019-12-16 16:37:55 | hazelcast/hazelcast | https://api.github.com/repos/hazelcast/hazelcast | closed | RingBuffer ReadManyOperation fails to set `NextSequenceToReadFrom` on ResultSet | Module: Ringbuffer Source: Internal Team: Core Type: Defect | This [PR](https://github.com/hazelcast/hazelcast/pull/12429) introduced a [new method](https://github.com/hazelcast/hazelcast/pull/12429/files#diff-3b1753cbdb6e6b21b7ecd707c83b8897R106) on `ReadResultSet`.
However it's currently only usable when used to read from [event journal](https://github.com/hazelcast/hazelcast/blob/c7700c26915756d3c67476b0a278fdc04eeb0f95/hazelcast/src/main/java/com/hazelcast/internal/journal/EventJournalReadOperation.java#L140-L143)
When you use ringbuffer then the `getNextSequenceToReadFrom()` always return 0.
I suspect it's because the [`ReadManyOperation`](https://github.com/jerrinot/hazelcast/blob/c7700c26915756d3c67476b0a278fdc04eeb0f95/hazelcast/src/main/java/com/hazelcast/ringbuffer/impl/operations/ReadManyOperation.java#L62) fails to call `resultSet.setNextSequenceToReadFrom()` | 1.0 | RingBuffer ReadManyOperation fails to set `NextSequenceToReadFrom` on ResultSet - This [PR](https://github.com/hazelcast/hazelcast/pull/12429) introduced a [new method](https://github.com/hazelcast/hazelcast/pull/12429/files#diff-3b1753cbdb6e6b21b7ecd707c83b8897R106) on `ReadResultSet`.
However it's currently only usable when used to read from [event journal](https://github.com/hazelcast/hazelcast/blob/c7700c26915756d3c67476b0a278fdc04eeb0f95/hazelcast/src/main/java/com/hazelcast/internal/journal/EventJournalReadOperation.java#L140-L143)
When you use ringbuffer then the `getNextSequenceToReadFrom()` always return 0.
I suspect it's because the [`ReadManyOperation`](https://github.com/jerrinot/hazelcast/blob/c7700c26915756d3c67476b0a278fdc04eeb0f95/hazelcast/src/main/java/com/hazelcast/ringbuffer/impl/operations/ReadManyOperation.java#L62) fails to call `resultSet.setNextSequenceToReadFrom()` | defect | ringbuffer readmanyoperation fails to set nextsequencetoreadfrom on resultset this introduced a on readresultset however it s currently only usable when used to read from when you use ringbuffer then the getnextsequencetoreadfrom always return i suspect it s because the fails to call resultset setnextsequencetoreadfrom | 1 |
9,219 | 2,615,139,863 | IssuesEvent | 2015-03-01 06:14:06 | chrsmith/reaver-wps | https://api.github.com/repos/chrsmith/reaver-wps | closed | failed association warnings error message | auto-migrated Priority-Medium Type-Defect | ```
What steps will reproduce the problem?
1. failed association warnings
What version of the product are you using? On what operating system?
Most current reaver-1.2.tar.gz Reaver v1.2
Please provide any additional information below.
I have tried everything from uninstalling and reinstalling.
I keep getting the failed association error message. Can't figure out what I'm
doing wrong. I have wifi usb alfa card. Any idea why this would happen?
```
Original issue reported on code.google.com by `Malachai...@gmail.com` on 2 Jan 2012 at 4:13
* Merged into: #43
Attachments:
* [Bssid.jpg](https://storage.googleapis.com/google-code-attachments/reaver-wps/issue-47/comment-0/Bssid.jpg)
* [reaver.jpg](https://storage.googleapis.com/google-code-attachments/reaver-wps/issue-47/comment-0/reaver.jpg)
| 1.0 | failed association warnings error message - ```
What steps will reproduce the problem?
1. failed association warnings
What version of the product are you using? On what operating system?
Most current reaver-1.2.tar.gz Reaver v1.2
Please provide any additional information below.
I have tried everything from uninstalling and reinstalling.
I keep getting the failed association error message. Can't figure out what I'm
doing wrong. I have wifi usb alfa card. Any idea why this would happen?
```
Original issue reported on code.google.com by `Malachai...@gmail.com` on 2 Jan 2012 at 4:13
* Merged into: #43
Attachments:
* [Bssid.jpg](https://storage.googleapis.com/google-code-attachments/reaver-wps/issue-47/comment-0/Bssid.jpg)
* [reaver.jpg](https://storage.googleapis.com/google-code-attachments/reaver-wps/issue-47/comment-0/reaver.jpg)
| defect | failed association warnings error message what steps will reproduce the problem failed association warnings what version of the product are you using on what operating system most current reaver tar gz reaver please provide any additional information below i have tried everything from uninstalling and reinstalling i keep getting the failed association error message can t figure out what i m doing wrong i have wifi usb alfa card any idea why this would happen original issue reported on code google com by malachai gmail com on jan at merged into attachments | 1 |
281,336 | 24,384,982,383 | IssuesEvent | 2022-10-04 10:58:12 | Kuadrant/testsuite | https://api.github.com/repos/Kuadrant/testsuite | closed | Add test for Auth credentials | good first issue test-case Kuadrant | You can override where Authorino expects the authentication details
https://github.com/Kuadrant/authorino/blob/main/docs/features.md#extra-auth-credentials-credentials
- [ ] Authorization header
- [ ] Custom header
- [ ] Cookie
- [ ] Query | 1.0 | Add test for Auth credentials - You can override where Authorino expects the authentication details
https://github.com/Kuadrant/authorino/blob/main/docs/features.md#extra-auth-credentials-credentials
- [ ] Authorization header
- [ ] Custom header
- [ ] Cookie
- [ ] Query | non_defect | add test for auth credentials you can override where authorino expects the authentication details authorization header custom header cookie query | 0 |
1,019 | 2,594,446,789 | IssuesEvent | 2015-02-20 03:31:33 | BALL-Project/ball | https://api.github.com/repos/BALL-Project/ball | closed | energyminimization changes bondingorder | C: BALL Core P: major R: invalid T: defect | **Reported by mkonietzko on 30 Jun 42616200 03:02 UTC**
energyminimization changes aromatic bondings in single bondings. | 1.0 | energyminimization changes bondingorder - **Reported by mkonietzko on 30 Jun 42616200 03:02 UTC**
energyminimization changes aromatic bondings in single bondings. | defect | energyminimization changes bondingorder reported by mkonietzko on jun utc energyminimization changes aromatic bondings in single bondings | 1 |
134,195 | 18,439,659,470 | IssuesEvent | 2021-10-14 16:29:38 | Verseghy/website_backend | https://api.github.com/repos/Verseghy/website_backend | opened | CVE-2021-33623 (High) detected in trim-newlines-1.0.0.tgz | security vulnerability | ## CVE-2021-33623 - High Severity Vulnerability
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>trim-newlines-1.0.0.tgz</b></p></summary>
<p>Trim newlines from the start and/or end of a string</p>
<p>Library home page: <a href="https://registry.npmjs.org/trim-newlines/-/trim-newlines-1.0.0.tgz">https://registry.npmjs.org/trim-newlines/-/trim-newlines-1.0.0.tgz</a></p>
<p>Path to dependency file: website_backend/package.json</p>
<p>Path to vulnerable library: website_backend/node_modules/trim-newlines/package.json</p>
<p>
Dependency Hierarchy:
- laravel-mix-2.1.14.tgz (Root Library)
- node-sass-4.14.1.tgz
- meow-3.7.0.tgz
- :x: **trim-newlines-1.0.0.tgz** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/Verseghy/website_backend/commit/00bd63ce3ad5a7ef0bc12007ecae9e018058f2ac">00bd63ce3ad5a7ef0bc12007ecae9e018058f2ac</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
</details>
<p></p>
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> Vulnerability Details</summary>
<p>
The trim-newlines package before 3.0.1 and 4.x before 4.0.1 for Node.js has an issue related to regular expression denial-of-service (ReDoS) for the .end() method.
<p>Publish Date: 2021-05-28
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-33623>CVE-2021-33623</a></p>
</p>
</details>
<p></p>
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>7.5</b>)</summary>
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: None
- Integrity Impact: None
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
</details>
<p></p>
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary>
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-33623">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-33623</a></p>
<p>Release Date: 2021-05-28</p>
<p>Fix Resolution: trim-newlines - 3.0.1, 4.0.1</p>
</p>
</details>
<p></p>
***
Step up your Open Source Security Game with WhiteSource [here](https://www.whitesourcesoftware.com/full_solution_bolt_github) | True | CVE-2021-33623 (High) detected in trim-newlines-1.0.0.tgz - ## CVE-2021-33623 - High Severity Vulnerability
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>trim-newlines-1.0.0.tgz</b></p></summary>
<p>Trim newlines from the start and/or end of a string</p>
<p>Library home page: <a href="https://registry.npmjs.org/trim-newlines/-/trim-newlines-1.0.0.tgz">https://registry.npmjs.org/trim-newlines/-/trim-newlines-1.0.0.tgz</a></p>
<p>Path to dependency file: website_backend/package.json</p>
<p>Path to vulnerable library: website_backend/node_modules/trim-newlines/package.json</p>
<p>
Dependency Hierarchy:
- laravel-mix-2.1.14.tgz (Root Library)
- node-sass-4.14.1.tgz
- meow-3.7.0.tgz
- :x: **trim-newlines-1.0.0.tgz** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/Verseghy/website_backend/commit/00bd63ce3ad5a7ef0bc12007ecae9e018058f2ac">00bd63ce3ad5a7ef0bc12007ecae9e018058f2ac</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
</details>
<p></p>
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> Vulnerability Details</summary>
<p>
The trim-newlines package before 3.0.1 and 4.x before 4.0.1 for Node.js has an issue related to regular expression denial-of-service (ReDoS) for the .end() method.
<p>Publish Date: 2021-05-28
<p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-33623>CVE-2021-33623</a></p>
</p>
</details>
<p></p>
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>7.5</b>)</summary>
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: None
- Integrity Impact: None
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
</details>
<p></p>
<details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary>
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-33623">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-33623</a></p>
<p>Release Date: 2021-05-28</p>
<p>Fix Resolution: trim-newlines - 3.0.1, 4.0.1</p>
</p>
</details>
<p></p>
***
Step up your Open Source Security Game with WhiteSource [here](https://www.whitesourcesoftware.com/full_solution_bolt_github) | non_defect | cve high detected in trim newlines tgz cve high severity vulnerability vulnerable library trim newlines tgz trim newlines from the start and or end of a string library home page a href path to dependency file website backend package json path to vulnerable library website backend node modules trim newlines package json dependency hierarchy laravel mix tgz root library node sass tgz meow tgz x trim newlines tgz vulnerable library found in head commit a href found in base branch master vulnerability details the trim newlines package before and x before for node js has an issue related to regular expression denial of service redos for the end method publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact none integrity impact none availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution trim newlines step up your open source security game with whitesource | 0 |
76,001 | 21,097,338,029 | IssuesEvent | 2022-04-04 11:35:27 | microsoft/PowerToys | https://api.github.com/repos/microsoft/PowerToys | closed | Build fails on Windows 10/Visual Studio 2019 Community Edition | Issue-Bug Resolution-Fix-Committed Priority-1 Area-Build | ### Microsoft PowerToys version
All
### Running as admin
- [ ] Yes
### Area(s) with issue?
General
### Steps to reproduce
1. Fork the repository.
2. Clone the repository.
3. Install dependencies and clone submodules.
4. Try building the solution.
### ✔️ Expected Behavior
Solution builds.
### ❌ Actual Behavior
Solution doesn't build.
### Other Software
N/A | 1.0 | Build fails on Windows 10/Visual Studio 2019 Community Edition - ### Microsoft PowerToys version
All
### Running as admin
- [ ] Yes
### Area(s) with issue?
General
### Steps to reproduce
1. Fork the repository.
2. Clone the repository.
3. Install dependencies and clone submodules.
4. Try building the solution.
### ✔️ Expected Behavior
Solution builds.
### ❌ Actual Behavior
Solution doesn't build.
### Other Software
N/A | non_defect | build fails on windows visual studio community edition microsoft powertoys version all running as admin yes area s with issue general steps to reproduce fork the repository clone the repository install dependencies and clone submodules try building the solution ✔️ expected behavior solution builds ❌ actual behavior solution doesn t build other software n a | 0 |
3,887 | 4,086,891,964 | IssuesEvent | 2016-06-01 07:57:07 | dotnet/corefx | https://api.github.com/repos/dotnet/corefx | closed | Reduce ETW events impact on WCF perf | tenet-performance | @vancem is currently looking into a fix of an ETW issue that has an impact of 2~3 times on the throughput of WCF. The fix is tracked for RTM release. | True | Reduce ETW events impact on WCF perf - @vancem is currently looking into a fix of an ETW issue that has an impact of 2~3 times on the throughput of WCF. The fix is tracked for RTM release. | non_defect | reduce etw events impact on wcf perf vancem is currently looking into a fix of an etw issue that has an impact of times on the throughput of wcf the fix is tracked for rtm release | 0 |
41,280 | 10,354,024,886 | IssuesEvent | 2019-09-05 12:56:54 | mozilla-lockwise/lockwise-android | https://api.github.com/repos/mozilla-lockwise/lockwise-android | opened | Crash - App crashes accessing several times to Edit/Delete entry | type: defect | ## Steps to reproduce
I don't have exact steps yet, but I have seen the crash many times when going to Edit entry, Discard or Cancel, then go to Delete entry and cancel. Repeating these steps the app crashes.
### Expected behavior
App should not crash
### Actual behavior
The app crashes following several steps. It is not a common case to follow those steps but the crash may appear in a regular use so it may be better to investigate
### Device & build information
* Device: Pixel 3, API 28
* Build version: Latest master
### Notes
I got some logs, hope this helps.
Attachments:
[editView crash.docx](https://github.com/mozilla-lockwise/lockwise-android/files/3579372/editView.crash.docx)
| 1.0 | Crash - App crashes accessing several times to Edit/Delete entry - ## Steps to reproduce
I don't have exact steps yet, but I have seen the crash many times when going to Edit entry, Discard or Cancel, then go to Delete entry and cancel. Repeating these steps the app crashes.
### Expected behavior
App should not crash
### Actual behavior
The app crashes following several steps. It is not a common case to follow those steps but the crash may appear in a regular use so it may be better to investigate
### Device & build information
* Device: Pixel 3, API 28
* Build version: Latest master
### Notes
I got some logs, hope this helps.
Attachments:
[editView crash.docx](https://github.com/mozilla-lockwise/lockwise-android/files/3579372/editView.crash.docx)
| defect | crash app crashes accessing several times to edit delete entry steps to reproduce i don t have exact steps yet but i have seen the crash many times when going to edit entry discard or cancel then go to delete entry and cancel repeating these steps the app crashes expected behavior app should not crash actual behavior the app crashes following several steps it is not a common case to follow those steps but the crash may appear in a regular use so it may be better to investigate device build information device pixel api build version latest master notes i got some logs hope this helps attachments | 1 |
29,196 | 5,583,108,251 | IssuesEvent | 2017-03-28 23:08:24 | geoscience-community-codes/GISMO | https://api.github.com/repos/geoscience-community-codes/GISMO | closed | Waveform not spanning Antelope day database boundaries | auto-migrated Priority-Medium Type-Defect | _From @GoogleCodeExporter on August 1, 2015 21:51_
```
What steps will reproduce the problem?
ds = datasource('uaf_continuous');
scnl = scnlobject('RDWB','BHZ','','');
time = datenum(['04/01/2009 00:00' ; '04/01/2009 01:00']);
w = waveform(ds,scnl,time-600/86400,time+600/86400)
The problem arises because the first set of start/end times fails to grab data
from both sides of the day boundary. Example should be pretty self explanatory.
```
Original issue reported on code.google.com by `mew...@alaska.edu` on 10 Feb 2011 at 11:11
_Copied from original issue: giseislab/gismotools#22_
| 1.0 | Waveform not spanning Antelope day database boundaries - _From @GoogleCodeExporter on August 1, 2015 21:51_
```
What steps will reproduce the problem?
ds = datasource('uaf_continuous');
scnl = scnlobject('RDWB','BHZ','','');
time = datenum(['04/01/2009 00:00' ; '04/01/2009 01:00']);
w = waveform(ds,scnl,time-600/86400,time+600/86400)
The problem arises because the first set of start/end times fails to grab data
from both sides of the day boundary. Example should be pretty self explanatory.
```
Original issue reported on code.google.com by `mew...@alaska.edu` on 10 Feb 2011 at 11:11
_Copied from original issue: giseislab/gismotools#22_
| defect | waveform not spanning antelope day database boundaries from googlecodeexporter on august what steps will reproduce the problem ds datasource uaf continuous scnl scnlobject rdwb bhz time datenum w waveform ds scnl time time the problem arises because the first set of start end times fails to grab data from both sides of the day boundary example should be pretty self explanatory original issue reported on code google com by mew alaska edu on feb at copied from original issue giseislab gismotools | 1 |
77,514 | 27,031,097,408 | IssuesEvent | 2023-02-12 07:37:27 | jMonkeyEngine/jmonkeyengine | https://api.github.com/repos/jMonkeyEngine/jmonkeyengine | closed | New animation system: shared stateful static objects cause unexpected threading issues | defect | In general, JME operates in a "threading not supported" mode but in a "you are fine to do whatever until you attach it to the scene graph" sort of way. Meaning that you can load and manipulate Spatials from separate threads but once you attach them to the render-thread managed scene, then hands off.
The animation system internally uses several global objects that keep state. By default, these are shared across every loaded animation, no matter where it was loaded.
Examples at the lowest level are AnimInterpolators.NLerp and AnimInterpolators.LinearVec3f:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/interpolator/AnimInterpolators.java#L46
...which are then used by one shared FrameInterpolator instance:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/interpolator/FrameInterpolator.java#L41
...that is the default for MorphTrack and TransformTrack:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/MorphTrack.java#L55
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/TransformTrack.java#L53
And while you could meticulously set your own:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/TransformTrack.java#L302
...it won't be serialized:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/TransformTrack.java#L332
At a high level, the right solution would be to share a single FrameInterpolator instance (and its own instances of NLerp, LinearVector3f, etc.) across the AnimComposer/SkinningControl and not across the whole Java virtual machine. I'm still trying to figure out the simplest/least-impactful way to make that happen. (Locally I've modified all of these cases to create their own instances and it solves the problems.)
As it stands, if you load Jaime.j3o into a scene and let him run around while meanwhile loading a totally separate model in another thread... posing or modifying that animation from that other thread will cause Jaime to glitch or crash. Which breaks the mental threading model under which JME normally operates.
Or in my case, when having a game load thread animate physics collision shapes while the rendering thread is trying to play animations:
https://www.youtube.com/watch?v=lWAEevlytPE
| 1.0 | New animation system: shared stateful static objects cause unexpected threading issues - In general, JME operates in a "threading not supported" mode but in a "you are fine to do whatever until you attach it to the scene graph" sort of way. Meaning that you can load and manipulate Spatials from separate threads but once you attach them to the render-thread managed scene, then hands off.
The animation system internally uses several global objects that keep state. By default, these are shared across every loaded animation, no matter where it was loaded.
Examples at the lowest level are AnimInterpolators.NLerp and AnimInterpolators.LinearVec3f:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/interpolator/AnimInterpolators.java#L46
...which are then used by one shared FrameInterpolator instance:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/interpolator/FrameInterpolator.java#L41
...that is the default for MorphTrack and TransformTrack:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/MorphTrack.java#L55
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/TransformTrack.java#L53
And while you could meticulously set your own:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/TransformTrack.java#L302
...it won't be serialized:
https://github.com/jMonkeyEngine/jmonkeyengine/blob/master/jme3-core/src/main/java/com/jme3/anim/TransformTrack.java#L332
At a high level, the right solution would be to share a single FrameInterpolator instance (and its own instances of NLerp, LinearVector3f, etc.) across the AnimComposer/SkinningControl and not across the whole Java virtual machine. I'm still trying to figure out the simplest/least-impactful way to make that happen. (Locally I've modified all of these cases to create their own instances and it solves the problems.)
As it stands, if you load Jaime.j3o into a scene and let him run around while meanwhile loading a totally separate model in another thread... posing or modifying that animation from that other thread will cause Jaime to glitch or crash. Which breaks the mental threading model under which JME normally operates.
Or in my case, when having a game load thread animate physics collision shapes while the rendering thread is trying to play animations:
https://www.youtube.com/watch?v=lWAEevlytPE
| defect | new animation system shared stateful static objects cause unexpected threading issues in general jme operates in a threading not supported mode but in a you are fine to do whatever until you attach it to the scene graph sort of way meaning that you can load and manipulate spatials from separate threads but once you attach them to the render thread managed scene then hands off the animation system internally uses several global objects that keep state by default these are shared across every loaded animation no matter where it was loaded examples at the lowest level are animinterpolators nlerp and animinterpolators which are then used by one shared frameinterpolator instance that is the default for morphtrack and transformtrack and while you could meticulously set your own it won t be serialized at a high level the right solution would be to share a single frameinterpolator instance and its own instances of nlerp etc across the animcomposer skinningcontrol and not across the whole java virtual machine i m still trying to figure out the simplest least impactful way to make that happen locally i ve modified all of these cases to create their own instances and it solves the problems as it stands if you load jaime into a scene and let him run around while meanwhile loading a totally separate model in another thread posing or modifying that animation from that other thread will cause jaime to glitch or crash which breaks the mental threading model under which jme normally operates or in my case when having a game load thread animate physics collision shapes while the rendering thread is trying to play animations | 1 |
69,820 | 22,684,711,978 | IssuesEvent | 2022-07-04 13:07:08 | vector-im/element-ios | https://api.github.com/repos/vector-im/element-ios | opened | Constructed replies sometimes have an empty "(null)" replied content | T-Defect | ### Steps to reproduce
1. Browsing a timeline with some replies, especially while backpaginating
### Outcome
This is due to some replied events that have (usually temporary) missing fields in the local DB. Element-iOS should use the fallback display in that case.
### Your phone model
Any
### Operating system version
Any
### Application version
1.8.20
### Homeserver
Any
### Will you send logs?
No | 1.0 | Constructed replies sometimes have an empty "(null)" replied content - ### Steps to reproduce
1. Browsing a timeline with some replies, especially while backpaginating
### Outcome
This is due to some replied events that have (usually temporary) missing fields in the local DB. Element-iOS should use the fallback display in that case.
### Your phone model
Any
### Operating system version
Any
### Application version
1.8.20
### Homeserver
Any
### Will you send logs?
No | defect | constructed replies sometimes have an empty null replied content steps to reproduce browsing a timeline with some replies especially while backpaginating outcome this is due to some replied events that have usually temporary missing fields in the local db element ios should use the fallback display in that case your phone model any operating system version any application version homeserver any will you send logs no | 1 |
64,773 | 16,037,927,251 | IssuesEvent | 2021-04-22 01:44:32 | rubyforgood/casa | https://api.github.com/repos/rubyforgood/casa | opened | Clarify Follow Up / Resolve button and tooltip color & text | not-ready-to-build | **What type of user is this for? volunteer/supervisor/admin/all**
volunteer
**Description**
Clarify Follow Up / Resolve button and tooltip color & text
User confusion:
> 3. After one entry was put in , it now says “resolve”. Don’t know what that means since I don’t see anything to resolve.
**Screenshots of current behavior, if any**
_QA Login Details:_
url: https://casa-qa.herokuapp.com/
password for all users: 123456
Log in using any of the below emails, depending on the account type you'd like to log in as.
- volunteer1@example.com
- supervisor1@example.com
- casa_admin1@example.com
| 1.0 | Clarify Follow Up / Resolve button and tooltip color & text - **What type of user is this for? volunteer/supervisor/admin/all**
volunteer
**Description**
Clarify Follow Up / Resolve button and tooltip color & text
User confusion:
> 3. After one entry was put in , it now says “resolve”. Don’t know what that means since I don’t see anything to resolve.
**Screenshots of current behavior, if any**
_QA Login Details:_
url: https://casa-qa.herokuapp.com/
password for all users: 123456
Log in using any of the below emails, depending on the account type you'd like to log in as.
- volunteer1@example.com
- supervisor1@example.com
- casa_admin1@example.com
| non_defect | clarify follow up resolve button and tooltip color text what type of user is this for volunteer supervisor admin all volunteer description clarify follow up resolve button and tooltip color text user confusion after one entry was put in it now says “resolve” don’t know what that means since i don’t see anything to resolve screenshots of current behavior if any qa login details url password for all users log in using any of the below emails depending on the account type you d like to log in as example com example com casa example com | 0 |
702,091 | 24,120,610,189 | IssuesEvent | 2022-09-20 18:21:15 | googleapis/nodejs-private-catalog | https://api.github.com/repos/googleapis/nodejs-private-catalog | closed | Quickstart: should run quickstart failed | type: bug priority: p1 flakybot: issue flakybot: flaky api: cloudprivatecatalog | Note: #9 was also for this test, but it was closed more than 10 days ago. So, I didn't mark it flaky.
----
commit: 4259f2f26191b70e98cab9b2a75bef793ce3d7da
buildURL: [Build Status](https://source.cloud.google.com/results/invocations/f99a4f9c-c673-407a-81e9-07936283e8a3), [Sponge](http://sponge2/f99a4f9c-c673-407a-81e9-07936283e8a3)
status: failed
<details><summary>Test output</summary><br><pre>Command failed: node ./quickstart.js long-door-651
16 UNAUTHENTICATED: Request had invalid authentication credentials. Expected OAuth 2 access token, login cookie or other valid authentication credential. See https://developers.google.com/identity/sign-in/web/devconsole-project.
Error: Command failed: node ./quickstart.js long-door-651
16 UNAUTHENTICATED: Request had invalid authentication credentials. Expected OAuth 2 access token, login cookie or other valid authentication credential. See https://developers.google.com/identity/sign-in/web/devconsole-project.
at checkExecSyncError (child_process.js:635:11)
at Object.execSync (child_process.js:671:15)
at execSync (test/quickstart.js:28:28)
at Context.<anonymous> (test/quickstart.js:42:20)
at processImmediate (internal/timers.js:461:21)</pre></details> | 1.0 | Quickstart: should run quickstart failed - Note: #9 was also for this test, but it was closed more than 10 days ago. So, I didn't mark it flaky.
----
commit: 4259f2f26191b70e98cab9b2a75bef793ce3d7da
buildURL: [Build Status](https://source.cloud.google.com/results/invocations/f99a4f9c-c673-407a-81e9-07936283e8a3), [Sponge](http://sponge2/f99a4f9c-c673-407a-81e9-07936283e8a3)
status: failed
<details><summary>Test output</summary><br><pre>Command failed: node ./quickstart.js long-door-651
16 UNAUTHENTICATED: Request had invalid authentication credentials. Expected OAuth 2 access token, login cookie or other valid authentication credential. See https://developers.google.com/identity/sign-in/web/devconsole-project.
Error: Command failed: node ./quickstart.js long-door-651
16 UNAUTHENTICATED: Request had invalid authentication credentials. Expected OAuth 2 access token, login cookie or other valid authentication credential. See https://developers.google.com/identity/sign-in/web/devconsole-project.
at checkExecSyncError (child_process.js:635:11)
at Object.execSync (child_process.js:671:15)
at execSync (test/quickstart.js:28:28)
at Context.<anonymous> (test/quickstart.js:42:20)
at processImmediate (internal/timers.js:461:21)</pre></details> | non_defect | quickstart should run quickstart failed note was also for this test but it was closed more than days ago so i didn t mark it flaky commit buildurl status failed test output command failed node quickstart js long door unauthenticated request had invalid authentication credentials expected oauth access token login cookie or other valid authentication credential see error command failed node quickstart js long door unauthenticated request had invalid authentication credentials expected oauth access token login cookie or other valid authentication credential see at checkexecsyncerror child process js at object execsync child process js at execsync test quickstart js at context test quickstart js at processimmediate internal timers js | 0 |
78,031 | 27,284,036,004 | IssuesEvent | 2023-02-23 12:12:55 | vector-im/element-x-ios | https://api.github.com/repos/vector-im/element-x-ios | closed | When specifying a custom server, you cannot specify a URL in the box asking for a URL. | T-Defect A-Login S-Critical O-Occasional Team: Element X Platform | ### Steps to reproduce
Failure:
1. Click "onboarding_continue",
2. Click "login-change_server"
3. Click "change_server-server" and type "https://servername.lab.element.dev" (a valid URL for the C-S api of a server supporting sliding sync)
4. View the error that pops up.
(see https://app-automate.browserstack.com/builds/dcae7ff645884422490a3364caba2a41e49ad691/sessions/ec5788bc713cbfa8557d499462b3ff682da79c60?auth_token=5358d1fe6203c9ae3dc1ecb7577521c5b0854faaf4ef33c31bc3f8f0dee3af3a )
Success:
1. Click "onboarding_continue",
2. Click "login-change_server"
3. Click "change_server-server" and type "servername.lab.element.dev" (which is not a URL, but refers to the same server)
4. Configuration goes through.
https://app-automate.browserstack.com/builds/dcae7ff645884422490a3364caba2a41e49ad691/sessions/41a27c260d6917f1b0e12bda3a7c22abbd33f031?auth_token=653356e0473297d47bf32b3f0db4b372a17684ca95b397ec7f431f1636297753
### Outcome
I believe we should support urls and variations on them in this box, to better support user actions; matching the label. People are likely to type:
```
http://server.com
https://server.com
http://server.com/
https://server.com/
server.com
server.com:8443
https://server.com:8443/
```
etc etc..
and the app should handle and normalise them correctly.
Additionally, we should provide better debugging of the failure in the device logs to identify why a given server failed:
- Is the URL inherently inaccessable, if so, be explicit in the logs which URL is being accessed when reporting a failure.
- Is it a valid matrix server at all?
- Does it additionally support the discovery and similar endpoints for sliding sync to be enabled?
Currently the logs simply say:
```
Feb 17 10:57:43 ElementX(Foundation)[28193] <Notice>: AuthenticationServiceProxy.configure():57 User entered a homeserver that isn't configured for sliding sync.
Feb 17 10:57:43 ElementX(Foundation)[28193] <Notice>: ServerSelectionCoordinator.useHomeserver():93 Invalid homeserver: https://slydingsinc.lab.element.dev
```
I'm assuming the failure is because it's trying to contact `https://https://slydingsinc.lab.element.dev/` or maybe do a DNS resolution or something.
### Your phone model
_No response_
### Operating system version
_No response_
### Application version
_No response_
### Homeserver
_No response_
### Will you send logs?
Yes | 1.0 | When specifying a custom server, you cannot specify a URL in the box asking for a URL. - ### Steps to reproduce
Failure:
1. Click "onboarding_continue",
2. Click "login-change_server"
3. Click "change_server-server" and type "https://servername.lab.element.dev" (a valid URL for the C-S api of a server supporting sliding sync)
4. View the error that pops up.
(see https://app-automate.browserstack.com/builds/dcae7ff645884422490a3364caba2a41e49ad691/sessions/ec5788bc713cbfa8557d499462b3ff682da79c60?auth_token=5358d1fe6203c9ae3dc1ecb7577521c5b0854faaf4ef33c31bc3f8f0dee3af3a )
Success:
1. Click "onboarding_continue",
2. Click "login-change_server"
3. Click "change_server-server" and type "servername.lab.element.dev" (which is not a URL, but refers to the same server)
4. Configuration goes through.
https://app-automate.browserstack.com/builds/dcae7ff645884422490a3364caba2a41e49ad691/sessions/41a27c260d6917f1b0e12bda3a7c22abbd33f031?auth_token=653356e0473297d47bf32b3f0db4b372a17684ca95b397ec7f431f1636297753
### Outcome
I believe we should support urls and variations on them in this box, to better support user actions; matching the label. People are likely to type:
```
http://server.com
https://server.com
http://server.com/
https://server.com/
server.com
server.com:8443
https://server.com:8443/
```
etc etc..
and the app should handle and normalise them correctly.
Additionally, we should provide better debugging of the failure in the device logs to identify why a given server failed:
- Is the URL inherently inaccessable, if so, be explicit in the logs which URL is being accessed when reporting a failure.
- Is it a valid matrix server at all?
- Does it additionally support the discovery and similar endpoints for sliding sync to be enabled?
Currently the logs simply say:
```
Feb 17 10:57:43 ElementX(Foundation)[28193] <Notice>: AuthenticationServiceProxy.configure():57 User entered a homeserver that isn't configured for sliding sync.
Feb 17 10:57:43 ElementX(Foundation)[28193] <Notice>: ServerSelectionCoordinator.useHomeserver():93 Invalid homeserver: https://slydingsinc.lab.element.dev
```
I'm assuming the failure is because it's trying to contact `https://https://slydingsinc.lab.element.dev/` or maybe do a DNS resolution or something.
### Your phone model
_No response_
### Operating system version
_No response_
### Application version
_No response_
### Homeserver
_No response_
### Will you send logs?
Yes | defect | when specifying a custom server you cannot specify a url in the box asking for a url steps to reproduce failure click onboarding continue click login change server click change server server and type a valid url for the c s api of a server supporting sliding sync view the error that pops up see success click onboarding continue click login change server click change server server and type servername lab element dev which is not a url but refers to the same server configuration goes through outcome i believe we should support urls and variations on them in this box to better support user actions matching the label people are likely to type server com server com etc etc and the app should handle and normalise them correctly additionally we should provide better debugging of the failure in the device logs to identify why a given server failed is the url inherently inaccessable if so be explicit in the logs which url is being accessed when reporting a failure is it a valid matrix server at all does it additionally support the discovery and similar endpoints for sliding sync to be enabled currently the logs simply say feb elementx foundation authenticationserviceproxy configure user entered a homeserver that isn t configured for sliding sync feb elementx foundation serverselectioncoordinator usehomeserver invalid homeserver i m assuming the failure is because it s trying to contact or maybe do a dns resolution or something your phone model no response operating system version no response application version no response homeserver no response will you send logs yes | 1 |
105,823 | 23,121,444,812 | IssuesEvent | 2022-07-27 22:02:21 | gdscashesi/ashesi-hackers-league | https://api.github.com/repos/gdscashesi/ashesi-hackers-league | closed | skeleton loader | code | Build for us a skeleton loader component we can customize for our needs. It should be able to morph shapes according to the props passed to it
@Oheneba-Dade
```js
<Skeleton shape="circle"/> // renders a circle skeleton loader
<Skeleton shape="square"/> // renders a square skeleton loader
<Skeleton shape="line"/> // renders a line skeleton loader
```
| 1.0 | skeleton loader - Build for us a skeleton loader component we can customize for our needs. It should be able to morph shapes according to the props passed to it
@Oheneba-Dade
```js
<Skeleton shape="circle"/> // renders a circle skeleton loader
<Skeleton shape="square"/> // renders a square skeleton loader
<Skeleton shape="line"/> // renders a line skeleton loader
```
| non_defect | skeleton loader build for us a skeleton loader component we can customize for our needs it should be able to morph shapes according to the props passed to it oheneba dade js renders a circle skeleton loader renders a square skeleton loader renders a line skeleton loader | 0 |
61,634 | 8,531,742,817 | IssuesEvent | 2018-11-04 15:17:09 | EnMasseProject/enmasse | https://api.github.com/repos/EnMasseProject/enmasse | closed | [Minor][docs] Difference between how firefox and chrome render upstream docs font | component/documentation | Very small insignificant point, but after discussion with @jenmalloy, we agreed that I will create an issue so it may be looked into at some point in the future.
Firefox renders the upstream docs font quite badly.. compared to Chrome. The letter spacing is quite inconsistent in FF. Sometimes 'squashing' the letters together, and other times leaving 'larger-than-usual' spaces between each letter.
example ( look closely )
Chrome (fine)
Firefox (not fine --- "ight" pushed closely together and, a seperated from dd)
many many more examples if needed ...
| 1.0 | [Minor][docs] Difference between how firefox and chrome render upstream docs font - Very small insignificant point, but after discussion with @jenmalloy, we agreed that I will create an issue so it may be looked into at some point in the future.
Firefox renders the upstream docs font quite badly.. compared to Chrome. The letter spacing is quite inconsistent in FF. Sometimes 'squashing' the letters together, and other times leaving 'larger-than-usual' spaces between each letter.
example ( look closely )
Chrome (fine)
Firefox (not fine --- "ight" pushed closely together and, a seperated from dd)
many many more examples if needed ...
| non_defect | difference between how firefox and chrome render upstream docs font very small insignificant point but after discussion with jenmalloy we agreed that i will create an issue so it may be looked into at some point in the future firefox renders the upstream docs font quite badly compared to chrome the letter spacing is quite inconsistent in ff sometimes squashing the letters together and other times leaving larger than usual spaces between each letter example look closely chrome fine firefox not fine ight pushed closely together and a seperated from dd many many more examples if needed | 0 |
61,916 | 17,023,808,251 | IssuesEvent | 2021-07-03 03:58:05 | tomhughes/trac-tickets | https://api.github.com/repos/tomhughes/trac-tickets | closed | [amenity-points] amenity=waste_disposal and amenity=waste_basket is not rendered | Component: mapnik Priority: minor Resolution: duplicate Type: defect | **[Submitted to the original trac issue database at 8.39am, Sunday, 8th July 2012]**
amenity=waste_disposal and amenity=waste_basket is not rendered in Mapnik at 18 zoom. | 1.0 | [amenity-points] amenity=waste_disposal and amenity=waste_basket is not rendered - **[Submitted to the original trac issue database at 8.39am, Sunday, 8th July 2012]**
amenity=waste_disposal and amenity=waste_basket is not rendered in Mapnik at 18 zoom. | defect | amenity waste disposal and amenity waste basket is not rendered amenity waste disposal and amenity waste basket is not rendered in mapnik at zoom | 1 |
69,239 | 22,291,268,562 | IssuesEvent | 2022-06-12 11:59:02 | primefaces/primereact | https://api.github.com/repos/primefaces/primereact | closed | DataTable: Filter Menu not displayed when inside <React.StrictMode> in React 18 | defect 👍 confirmed | In case it helps you with the adoption of React 18,
**I'm submitting a...**
```
[x] bug report
[ ] feature request
[ ] support request
```
**Codesandbox Case**
https://codesandbox.io/s/primereact-test-forked-vkirpl?file=/src/index.js
**Current behavior**
When opening the filter menu, only the "Clear" and "Apply" buttons appear.
**Expected behavior**
The actual filters should be shown too.
* **React version:** 18.0.0
* **PrimeReact version:** 8.0.0-rc.2
* **Browser:** at least Chromium
**Does NOT Work:**
```ts
ReactDOM.createRoot(document.getElementById("root3")).render(
// remove StricMode and the app works fine
<React.StrictMode>
<App />
</React.StrictMode>
);
```
**Works:**
```ts
ReactDOM.createRoot(document.getElementById("root3")).render(
<App />
);
``` | 1.0 | DataTable: Filter Menu not displayed when inside <React.StrictMode> in React 18 - In case it helps you with the adoption of React 18,
**I'm submitting a...**
```
[x] bug report
[ ] feature request
[ ] support request
```
**Codesandbox Case**
https://codesandbox.io/s/primereact-test-forked-vkirpl?file=/src/index.js
**Current behavior**
When opening the filter menu, only the "Clear" and "Apply" buttons appear.
**Expected behavior**
The actual filters should be shown too.
* **React version:** 18.0.0
* **PrimeReact version:** 8.0.0-rc.2
* **Browser:** at least Chromium
**Does NOT Work:**
```ts
ReactDOM.createRoot(document.getElementById("root3")).render(
// remove StricMode and the app works fine
<React.StrictMode>
<App />
</React.StrictMode>
);
```
**Works:**
```ts
ReactDOM.createRoot(document.getElementById("root3")).render(
<App />
);
``` | defect | datatable filter menu not displayed when inside in react in case it helps you with the adoption of react i m submitting a bug report feature request support request codesandbox case current behavior when opening the filter menu only the clear and apply buttons appear expected behavior the actual filters should be shown too react version primereact version rc browser at least chromium does not work ts reactdom createroot document getelementbyid render remove stricmode and the app works fine works ts reactdom createroot document getelementbyid render | 1 |
53,289 | 13,261,359,882 | IssuesEvent | 2020-08-20 19:45:18 | icecube-trac/tix4 | https://api.github.com/repos/icecube-trac/tix4 | closed | cmake - I3_USE_ROOT macro set w/o root installed (Trac #1131) | Migrated from Trac cmake defect | if USE_ROOT is given to cmake, the C macro I3_USE_ROOT is set even if root isn't found.
see #1115
<details>
<summary><em>Migrated from <a href="https://code.icecube.wisc.edu/projects/icecube/ticket/1131">https://code.icecube.wisc.edu/projects/icecube/ticket/1131</a>, reported by negaand owned by nega</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2019-01-11T23:59:15",
"_ts": "1547251155701656",
"description": "if USE_ROOT is given to cmake, the C macro I3_USE_ROOT is set even if root isn't found.\n\nsee #1121",
"reporter": "nega",
"cc": "",
"resolution": "fixed",
"time": "2015-08-17T18:43:53",
"component": "cmake",
"summary": "cmake - I3_USE_ROOT macro set w/o root installed",
"priority": "blocker",
"keywords": "",
"milestone": "",
"owner": "nega",
"type": "defect"
}
```
</p>
</details>
| 1.0 | cmake - I3_USE_ROOT macro set w/o root installed (Trac #1131) - if USE_ROOT is given to cmake, the C macro I3_USE_ROOT is set even if root isn't found.
see #1115
<details>
<summary><em>Migrated from <a href="https://code.icecube.wisc.edu/projects/icecube/ticket/1131">https://code.icecube.wisc.edu/projects/icecube/ticket/1131</a>, reported by negaand owned by nega</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2019-01-11T23:59:15",
"_ts": "1547251155701656",
"description": "if USE_ROOT is given to cmake, the C macro I3_USE_ROOT is set even if root isn't found.\n\nsee #1121",
"reporter": "nega",
"cc": "",
"resolution": "fixed",
"time": "2015-08-17T18:43:53",
"component": "cmake",
"summary": "cmake - I3_USE_ROOT macro set w/o root installed",
"priority": "blocker",
"keywords": "",
"milestone": "",
"owner": "nega",
"type": "defect"
}
```
</p>
</details>
| defect | cmake use root macro set w o root installed trac if use root is given to cmake the c macro use root is set even if root isn t found see migrated from json status closed changetime ts description if use root is given to cmake the c macro use root is set even if root isn t found n nsee reporter nega cc resolution fixed time component cmake summary cmake use root macro set w o root installed priority blocker keywords milestone owner nega type defect | 1 |
436,834 | 30,571,467,644 | IssuesEvent | 2023-07-20 22:48:20 | terrapower/armi | https://api.github.com/repos/terrapower/armi | closed | Missing unit definitions | documentation good first issue cleanup | Unit definitions are missing in much of the documentation. Because there is not a single set of units used throughout ARMI, variables without unit specifications are difficult to comprehend.
It would be useful to add units on all physical quantities outlined in the documentation, preferably in a consistent manner. | 1.0 | Missing unit definitions - Unit definitions are missing in much of the documentation. Because there is not a single set of units used throughout ARMI, variables without unit specifications are difficult to comprehend.
It would be useful to add units on all physical quantities outlined in the documentation, preferably in a consistent manner. | non_defect | missing unit definitions unit definitions are missing in much of the documentation because there is not a single set of units used throughout armi variables without unit specifications are difficult to comprehend it would be useful to add units on all physical quantities outlined in the documentation preferably in a consistent manner | 0 |
33,092 | 7,656,908,834 | IssuesEvent | 2018-05-10 17:52:10 | usnistgov/ACVP | https://api.github.com/repos/usnistgov/ACVP | closed | DSA pqgVer: not supported for L=1024/N=160? | Numerical code bug Spec error | When I request the pqgVer for L-1024, I get the following response from the server:
```
[ {
"acvVersion" : "0.4"
}, {
"vsId" : 2141,
"status" : "error during vector generation",
"message" : "failed to generate tests for: 2141"
} ]
```
My request was
```
{
"algorithm":"DSA",
"mode":"pqgVer",
"prereqVals":[
{
"algorithm":"SHA",
"valValue":"same"
},
{
"algorithm":"DRBG",
"valValue":"same"
}
],
"capabilities":[
{
"l":1024,
"n":160,
"PQGen":[
"probable"
],
"GGen":[
"unverifiable"
],
"hashAlg":[
"SHA-1",
"SHA2-224",
"SHA2-256"
]
}
]
},
``` | 1.0 | DSA pqgVer: not supported for L=1024/N=160? - When I request the pqgVer for L-1024, I get the following response from the server:
```
[ {
"acvVersion" : "0.4"
}, {
"vsId" : 2141,
"status" : "error during vector generation",
"message" : "failed to generate tests for: 2141"
} ]
```
My request was
```
{
"algorithm":"DSA",
"mode":"pqgVer",
"prereqVals":[
{
"algorithm":"SHA",
"valValue":"same"
},
{
"algorithm":"DRBG",
"valValue":"same"
}
],
"capabilities":[
{
"l":1024,
"n":160,
"PQGen":[
"probable"
],
"GGen":[
"unverifiable"
],
"hashAlg":[
"SHA-1",
"SHA2-224",
"SHA2-256"
]
}
]
},
``` | non_defect | dsa pqgver not supported for l n when i request the pqgver for l i get the following response from the server acvversion vsid status error during vector generation message failed to generate tests for my request was algorithm dsa mode pqgver prereqvals algorithm sha valvalue same algorithm drbg valvalue same capabilities l n pqgen probable ggen unverifiable hashalg sha | 0 |
93,205 | 3,896,986,976 | IssuesEvent | 2016-04-16 04:34:42 | FrozenSand/UrbanTerror4 | https://api.github.com/repos/FrozenSand/UrbanTerror4 | closed | Error popup - Text outside of the frame | confirmed low priority | The error-popup, e.g when map can't be downloaded, is bugging.
The URL leaves the border of the box.
**Example over here:**
| 1.0 | Error popup - Text outside of the frame - The error-popup, e.g when map can't be downloaded, is bugging.
The URL leaves the border of the box.
**Example over here:**
| non_defect | error popup text outside of the frame the error popup e g when map can t be downloaded is bugging the url leaves the border of the box example over here | 0 |
36,937 | 8,198,668,317 | IssuesEvent | 2018-08-31 17:14:20 | google/googletest | https://api.github.com/repos/google/googletest | closed | Unable to compile tests which use exception assertions | Priority-Medium Type-Defect auto-migrated | ```
The issue has been posted in googletestframework without being replied, so I
post it here as well.
https://groups.google.com/d/topic/googletestframework/D3OqJspi2TI/discussion
If you really need to create a new issue, please provide the information
asked for below.
What steps will reproduce the problem?
1. Create a test file that is using either of: ASSERT_THROW, ASSERT_ANY_THROW,
ASSERT_NO_THROW, EXPECT_THROW, EXPECT_ANY_THROW, EXPECT_NO_THROW.
For example use this:
#include "gtest/gtest.h"
TEST(Tests, NoThrowTest) {
EXPECT_NO_THROW({ int i = 1; });
}
2. Compile with VC7.1 (Microsoft Visual Studio .NET 2003)
What is the expected output? What do you see instead?
I expect the compilation to succeed. Instead, I get compilation error:
------ Build started: Project: Unit_tests, Configuration: Debug Win32 ------
Compiling...
tcp_ip_tests.cpp
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C2143: syntax error : missing ';' before '('
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C2143: syntax error : missing ';' before ':'
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C3861: 'gtest_label_testnothrow_': identifier
not found, even with argument-dependent lookup
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C2143: syntax error : missing ';' before ':'
What version of Google Test are you using?
I use google test version 1.6
On what operating system?
Windows 7
Please provide any additional information below, such as a code snippet.
The compilation problem shows only when using exception assertions. Without
them it compiles and runs as expected.
```
Original issue reported on code.google.com by `YalonLo...@gmail.com` on 4 Sep 2012 at 11:57
| 1.0 | Unable to compile tests which use exception assertions - ```
The issue has been posted in googletestframework without being replied, so I
post it here as well.
https://groups.google.com/d/topic/googletestframework/D3OqJspi2TI/discussion
If you really need to create a new issue, please provide the information
asked for below.
What steps will reproduce the problem?
1. Create a test file that is using either of: ASSERT_THROW, ASSERT_ANY_THROW,
ASSERT_NO_THROW, EXPECT_THROW, EXPECT_ANY_THROW, EXPECT_NO_THROW.
For example use this:
#include "gtest/gtest.h"
TEST(Tests, NoThrowTest) {
EXPECT_NO_THROW({ int i = 1; });
}
2. Compile with VC7.1 (Microsoft Visual Studio .NET 2003)
What is the expected output? What do you see instead?
I expect the compilation to succeed. Instead, I get compilation error:
------ Build started: Project: Unit_tests, Configuration: Debug Win32 ------
Compiling...
tcp_ip_tests.cpp
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C2143: syntax error : missing ';' before '('
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C2143: syntax error : missing ';' before ':'
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C3861: 'gtest_label_testnothrow_': identifier
not found, even with argument-dependent lookup
d:\Projects\Diamond_0_1\diamond_0.1_integ\hwctrl\test\src\core\communication\tcp
_ip\tcp_ip_tests.cpp(4) : error C2143: syntax error : missing ';' before ':'
What version of Google Test are you using?
I use google test version 1.6
On what operating system?
Windows 7
Please provide any additional information below, such as a code snippet.
The compilation problem shows only when using exception assertions. Without
them it compiles and runs as expected.
```
Original issue reported on code.google.com by `YalonLo...@gmail.com` on 4 Sep 2012 at 11:57
| defect | unable to compile tests which use exception assertions the issue has been posted in googletestframework without being replied so i post it here as well if you really need to create a new issue please provide the information asked for below what steps will reproduce the problem create a test file that is using either of assert throw assert any throw assert no throw expect throw expect any throw expect no throw for example use this include gtest gtest h test tests nothrowtest expect no throw int i compile with microsoft visual studio net what is the expected output what do you see instead i expect the compilation to succeed instead i get compilation error build started project unit tests configuration debug compiling tcp ip tests cpp d projects diamond diamond integ hwctrl test src core communication tcp ip tcp ip tests cpp error syntax error missing before d projects diamond diamond integ hwctrl test src core communication tcp ip tcp ip tests cpp error syntax error missing before d projects diamond diamond integ hwctrl test src core communication tcp ip tcp ip tests cpp error gtest label testnothrow identifier not found even with argument dependent lookup d projects diamond diamond integ hwctrl test src core communication tcp ip tcp ip tests cpp error syntax error missing before what version of google test are you using i use google test version on what operating system windows please provide any additional information below such as a code snippet the compilation problem shows only when using exception assertions without them it compiles and runs as expected original issue reported on code google com by yalonlo gmail com on sep at | 1 |
39,304 | 9,389,990,195 | IssuesEvent | 2019-04-06 00:32:58 | zfsonlinux/zfs | https://api.github.com/repos/zfsonlinux/zfs | closed | PANIC at dnode.c:715:dnode_reallocate() / Crash - interrupt took too long | Type: Defect Type: Question | Hi! I am not sure how to debug this. Any ideas?
filename: /lib/modules/4.15.18-12-pve/zfs/zfs.ko
version: 0.7.13-pve1~bpo1
| 1.0 | PANIC at dnode.c:715:dnode_reallocate() / Crash - interrupt took too long - Hi! I am not sure how to debug this. Any ideas?
filename: /lib/modules/4.15.18-12-pve/zfs/zfs.ko
version: 0.7.13-pve1~bpo1
| defect | panic at dnode c dnode reallocate crash interrupt took too long hi i am not sure how to debug this any ideas filename lib modules pve zfs zfs ko version | 1 |
259,221 | 22,412,786,733 | IssuesEvent | 2022-06-19 01:13:06 | backend-br/vagas | https://api.github.com/repos/backend-br/vagas | closed | [Brasil - Remoto] Back-end Developer Sr (NODE.JS) @BeerOrCoffee | CLT Pleno NodeJS TDD Remoto DevOps Especialista Presencial Testes automatizados Scrum Git Stale | <!--
==================================================
Caso a vaga for remoto durante a pandemia informar no texto "Remoto durante o covid"
==================================================
-->
<!--
==================================================
POR FAVOR, SÓ POSTE SE A VAGA FOR PARA BACK-END!
Não faça distinção de gênero no título da vaga.
Use: "Back-End Developer" ao invés de
"Desenvolvedor Back-End" \o/
Exemplo: `[São Paulo] Back-End Developer @ NOME DA EMPRESA`
==================================================
-->
<!--
==================================================
Caso a vaga for remoto durante a pandemia deixar a linha abaixo
==================================================
-->
> Vaga totalmente remota.
## BeerOrCoffee
Você já sonhou em trabalhar de forma 100% remota e poder viver toda a liberdade e flexibilidade que esse modelo de trabalho oferece?
Imagina ter +1.000 espaços ao redor do Brasil e poder trabalhar de onde quiser?
Se você ainda não conhece, somos uma plataforma que conecta empresas a espaços de trabalho em todo Brasil proporcionando maior liberdade, eficácia e inteligência na forma de trabalhar.
## Back end Developer Sr.
100% remoto.
Candidato pode residir em qualquer cidade do Brasil.
Requisitos
Obrigatórios:
Formação superior completa;
Experiência em desenvolvimento em NodeJs (ou linguagem correlata como Go e Clojure) para aplicações críticas ao negócio;
Experiência em desenvolvimento de software voltado para qualidade (TDD ou BDD);
Conhecimento em versionamento de código utilizando Git/Github/GitLab;
Experiência com equipes ágeis (Kanban, scrum,XP);
Desejáveis:
Escrita de testes automatizados;
Habilidade em design de aplicações pensando em boas práticas de integração, performance e segurança;
Experiência com práticas de DevOps;
Experiência com mentoria de novos membros do time;
Prévia experiência em startups ou Marketplace.
Inglês intermediário para leitura.
## Benefícios
✈️ Trabalho Remoto (Be #anywhere);
🎒 Kit Anywhereoffice (Você pode adquirir mochila, mouse, teclado, headset que desejar para o seu conforto no remoto);
🔑 OfficePass (Remoto não precisa ser apenas homeoffice, você terá acesso ilimitado a mais de 1000 coworkings);
🛫 BeerOrCoffee Wings (ajudamos no custo das suas viagens);
☕ Caju (Nosso cartão contempla as categorias: 🥗 alimentação, 🍴 refeição, ⛽mobilidade, 📚 educação e 🏠 ajuda de custo homeoffice)
🏥 Plano de Saúde & Odontológico;
👶🏽 Auxílio Creche;
💖 Head of Love (cuidando do bem-estar dos nômades);
🏖️ Annual BeerOrCoffee Retreat (Nosso encontro presencial dos nômades);
💰 Bonificação trimestral (exceto áreas que tenham comissão);
🥪 Snack Time (quando estiver trabalhando de algum dos nossos espaços, peça um lanche por nossa conta);
📖 12 minutos (app de livros);
## Contratação
CLT
## Como se candidatar
https://jobs.kenoby.com/beerorcoffee/job/developer-back-end-sr-remoto/61e8b4ad6cc0d92836613b71?utm_source=website
Em caso de dúvidas enviar e-mail para leticia.franca@beerorcoffee.com
## Tempo médio de feedbacks
Costumamos enviar feedbacks em até 05 dias após o encerramento do processo seletivo.
E-mail para contato em caso de não haver resposta: leticia.franca@beerorcoffee.com
Nível
Pleno ou Sênior
## Labels
<!-- retire os labels que não fazem sentido à vaga -->
#### Alocação
- Remoto
#### Regime
- CLT
#### Nível
- Pleno
- Sênior
- Especialista
| 1.0 | [Brasil - Remoto] Back-end Developer Sr (NODE.JS) @BeerOrCoffee - <!--
==================================================
Caso a vaga for remoto durante a pandemia informar no texto "Remoto durante o covid"
==================================================
-->
<!--
==================================================
POR FAVOR, SÓ POSTE SE A VAGA FOR PARA BACK-END!
Não faça distinção de gênero no título da vaga.
Use: "Back-End Developer" ao invés de
"Desenvolvedor Back-End" \o/
Exemplo: `[São Paulo] Back-End Developer @ NOME DA EMPRESA`
==================================================
-->
<!--
==================================================
Caso a vaga for remoto durante a pandemia deixar a linha abaixo
==================================================
-->
> Vaga totalmente remota.
## BeerOrCoffee
Você já sonhou em trabalhar de forma 100% remota e poder viver toda a liberdade e flexibilidade que esse modelo de trabalho oferece?
Imagina ter +1.000 espaços ao redor do Brasil e poder trabalhar de onde quiser?
Se você ainda não conhece, somos uma plataforma que conecta empresas a espaços de trabalho em todo Brasil proporcionando maior liberdade, eficácia e inteligência na forma de trabalhar.
## Back end Developer Sr.
100% remoto.
Candidato pode residir em qualquer cidade do Brasil.
Requisitos
Obrigatórios:
Formação superior completa;
Experiência em desenvolvimento em NodeJs (ou linguagem correlata como Go e Clojure) para aplicações críticas ao negócio;
Experiência em desenvolvimento de software voltado para qualidade (TDD ou BDD);
Conhecimento em versionamento de código utilizando Git/Github/GitLab;
Experiência com equipes ágeis (Kanban, scrum,XP);
Desejáveis:
Escrita de testes automatizados;
Habilidade em design de aplicações pensando em boas práticas de integração, performance e segurança;
Experiência com práticas de DevOps;
Experiência com mentoria de novos membros do time;
Prévia experiência em startups ou Marketplace.
Inglês intermediário para leitura.
## Benefícios
✈️ Trabalho Remoto (Be #anywhere);
🎒 Kit Anywhereoffice (Você pode adquirir mochila, mouse, teclado, headset que desejar para o seu conforto no remoto);
🔑 OfficePass (Remoto não precisa ser apenas homeoffice, você terá acesso ilimitado a mais de 1000 coworkings);
🛫 BeerOrCoffee Wings (ajudamos no custo das suas viagens);
☕ Caju (Nosso cartão contempla as categorias: 🥗 alimentação, 🍴 refeição, ⛽mobilidade, 📚 educação e 🏠 ajuda de custo homeoffice)
🏥 Plano de Saúde & Odontológico;
👶🏽 Auxílio Creche;
💖 Head of Love (cuidando do bem-estar dos nômades);
🏖️ Annual BeerOrCoffee Retreat (Nosso encontro presencial dos nômades);
💰 Bonificação trimestral (exceto áreas que tenham comissão);
🥪 Snack Time (quando estiver trabalhando de algum dos nossos espaços, peça um lanche por nossa conta);
📖 12 minutos (app de livros);
## Contratação
CLT
## Como se candidatar
https://jobs.kenoby.com/beerorcoffee/job/developer-back-end-sr-remoto/61e8b4ad6cc0d92836613b71?utm_source=website
Em caso de dúvidas enviar e-mail para leticia.franca@beerorcoffee.com
## Tempo médio de feedbacks
Costumamos enviar feedbacks em até 05 dias após o encerramento do processo seletivo.
E-mail para contato em caso de não haver resposta: leticia.franca@beerorcoffee.com
Nível
Pleno ou Sênior
## Labels
<!-- retire os labels que não fazem sentido à vaga -->
#### Alocação
- Remoto
#### Regime
- CLT
#### Nível
- Pleno
- Sênior
- Especialista
| non_defect | back end developer sr node js beerorcoffee caso a vaga for remoto durante a pandemia informar no texto remoto durante o covid por favor só poste se a vaga for para back end não faça distinção de gênero no título da vaga use back end developer ao invés de desenvolvedor back end o exemplo back end developer nome da empresa caso a vaga for remoto durante a pandemia deixar a linha abaixo vaga totalmente remota beerorcoffee você já sonhou em trabalhar de forma remota e poder viver toda a liberdade e flexibilidade que esse modelo de trabalho oferece imagina ter espaços ao redor do brasil e poder trabalhar de onde quiser se você ainda não conhece somos uma plataforma que conecta empresas a espaços de trabalho em todo brasil proporcionando maior liberdade eficácia e inteligência na forma de trabalhar back end developer sr remoto candidato pode residir em qualquer cidade do brasil requisitos obrigatórios formação superior completa experiência em desenvolvimento em nodejs ou linguagem correlata como go e clojure para aplicações críticas ao negócio experiência em desenvolvimento de software voltado para qualidade tdd ou bdd conhecimento em versionamento de código utilizando git github gitlab experiência com equipes ágeis kanban scrum xp desejáveis escrita de testes automatizados habilidade em design de aplicações pensando em boas práticas de integração performance e segurança experiência com práticas de devops experiência com mentoria de novos membros do time prévia experiência em startups ou marketplace inglês intermediário para leitura benefícios ✈️ trabalho remoto be anywhere 🎒 kit anywhereoffice você pode adquirir mochila mouse teclado headset que desejar para o seu conforto no remoto 🔑 officepass remoto não precisa ser apenas homeoffice você terá acesso ilimitado a mais de coworkings 🛫 beerorcoffee wings ajudamos no custo das suas viagens ☕ caju nosso cartão contempla as categorias 🥗 alimentação 🍴 refeição ⛽mobilidade 📚 educação e 🏠 ajuda de custo homeoffice 🏥 plano de saúde odontológico 👶🏽 auxílio creche 💖 head of love cuidando do bem estar dos nômades 🏖️ annual beerorcoffee retreat nosso encontro presencial dos nômades 💰 bonificação trimestral exceto áreas que tenham comissão 🥪 snack time quando estiver trabalhando de algum dos nossos espaços peça um lanche por nossa conta 📖 minutos app de livros contratação clt como se candidatar em caso de dúvidas enviar e mail para leticia franca beerorcoffee com tempo médio de feedbacks costumamos enviar feedbacks em até dias após o encerramento do processo seletivo e mail para contato em caso de não haver resposta leticia franca beerorcoffee com nível pleno ou sênior labels alocação remoto regime clt nível pleno sênior especialista | 0 |
45,056 | 12,530,667,005 | IssuesEvent | 2020-06-04 13:26:25 | STEllAR-GROUP/hpx | https://api.github.com/repos/STEllAR-GROUP/hpx | reopened | Thread stacksize not properly set | type: defect | Did you have a case where `stacksize` still was `thread_stacksize_current` at this point? I would rather put an assert in the first if after `stacksize` has been updated as this shouldn't happen. A created HPX thread should always have one of the actual sizes (small, medium, ...), and a non-HPX thread should return the default which is the small stacksize at the moment.
_Originally posted by @msimberg in https://github.com/STEllAR-GROUP/hpx/pull/4644_ | 1.0 | Thread stacksize not properly set - Did you have a case where `stacksize` still was `thread_stacksize_current` at this point? I would rather put an assert in the first if after `stacksize` has been updated as this shouldn't happen. A created HPX thread should always have one of the actual sizes (small, medium, ...), and a non-HPX thread should return the default which is the small stacksize at the moment.
_Originally posted by @msimberg in https://github.com/STEllAR-GROUP/hpx/pull/4644_ | defect | thread stacksize not properly set did you have a case where stacksize still was thread stacksize current at this point i would rather put an assert in the first if after stacksize has been updated as this shouldn t happen a created hpx thread should always have one of the actual sizes small medium and a non hpx thread should return the default which is the small stacksize at the moment originally posted by msimberg in | 1 |
10,317 | 2,622,143,696 | IssuesEvent | 2015-03-04 00:03:11 | byzhang/i7z | https://api.github.com/repos/byzhang/i7z | closed | actual freq(Mult.) displays "nan(nans)" | auto-migrated Priority-Medium Type-Defect | ```
What steps will reproduce the problem?
1.Intel Core i5 750 , 2.66GHz, Turbo Max 3.2GHz
2.use all the 4 cores to 100%
3.run i7z
What is the expected output? What do you see instead?
listed actual freq displays "nan", Mult displays "nanx"
What version of the product are you using? On what operating system?
BTW is it a 32-bit or a 64-bit OS/Kernel?
i7z-0.21-3.
Ubuntu 9.10, 32-bit, kernel linux 2.6.31-20-generic
Please provide any additional information below.
the output of i7z
Cpu speed from cpuinfo 2793.00Mhz
cpuinfo might be wrong if cpufreq is enabled. To guess correctly try estimating
Linux's inbuilt cpu_khz code emulated now
True Frequency (without accounting Turbo) 2665 MHz
CPU Multiplier 20x || Bus clock frequency (BCLK) 133.25 MHz
TURBO ENABLED on 4 Cores, Hyper Threading OFF
True Frequency 2798.25 MHz (133.25 x [21])
Max TURBO (if Enabled) with 1/2 Core active 24x / 24x
Max TURBO (if Enabled) with 3/4 Cores active 21x / 21x
Current Freqs
True Frequency 2798.25 MHz (Intel specifies largest of below to be running
Freq)
Processor :Actual Freq (Mult.) C0% Halt(C1)% C3 % C6 %
Processor 1: nan (nanx) 0 100 0 0
Processor 2: nan (nanx) 0 100 0 0
Processor 3: nan (nanx) 0 100 0 0
Processor 4: nan (nanx) 0 100 0 0
C0 = Processor running without halting
C1 = Processor running with halts (States >C0 are power saver)
```
Original issue reported on code.google.com by `frank...@gmail.com` on 12 Mar 2010 at 5:27 | 1.0 | actual freq(Mult.) displays "nan(nans)" - ```
What steps will reproduce the problem?
1.Intel Core i5 750 , 2.66GHz, Turbo Max 3.2GHz
2.use all the 4 cores to 100%
3.run i7z
What is the expected output? What do you see instead?
listed actual freq displays "nan", Mult displays "nanx"
What version of the product are you using? On what operating system?
BTW is it a 32-bit or a 64-bit OS/Kernel?
i7z-0.21-3.
Ubuntu 9.10, 32-bit, kernel linux 2.6.31-20-generic
Please provide any additional information below.
the output of i7z
Cpu speed from cpuinfo 2793.00Mhz
cpuinfo might be wrong if cpufreq is enabled. To guess correctly try estimating
Linux's inbuilt cpu_khz code emulated now
True Frequency (without accounting Turbo) 2665 MHz
CPU Multiplier 20x || Bus clock frequency (BCLK) 133.25 MHz
TURBO ENABLED on 4 Cores, Hyper Threading OFF
True Frequency 2798.25 MHz (133.25 x [21])
Max TURBO (if Enabled) with 1/2 Core active 24x / 24x
Max TURBO (if Enabled) with 3/4 Cores active 21x / 21x
Current Freqs
True Frequency 2798.25 MHz (Intel specifies largest of below to be running
Freq)
Processor :Actual Freq (Mult.) C0% Halt(C1)% C3 % C6 %
Processor 1: nan (nanx) 0 100 0 0
Processor 2: nan (nanx) 0 100 0 0
Processor 3: nan (nanx) 0 100 0 0
Processor 4: nan (nanx) 0 100 0 0
C0 = Processor running without halting
C1 = Processor running with halts (States >C0 are power saver)
```
Original issue reported on code.google.com by `frank...@gmail.com` on 12 Mar 2010 at 5:27 | defect | actual freq mult displays nan nans what steps will reproduce the problem intel core turbo max use all the cores to run what is the expected output what do you see instead listed actual freq displays nan mult displays nanx what version of the product are you using on what operating system btw is it a bit or a bit os kernel ubuntu bit kernel linux generic please provide any additional information below the output of cpu speed from cpuinfo cpuinfo might be wrong if cpufreq is enabled to guess correctly try estimating linux s inbuilt cpu khz code emulated now true frequency without accounting turbo mhz cpu multiplier bus clock frequency bclk mhz turbo enabled on cores hyper threading off true frequency mhz x max turbo if enabled with core active max turbo if enabled with cores active current freqs true frequency mhz intel specifies largest of below to be running freq processor actual freq mult halt processor nan nanx processor nan nanx processor nan nanx processor nan nanx processor running without halting processor running with halts states are power saver original issue reported on code google com by frank gmail com on mar at | 1 |
20,191 | 4,513,610,636 | IssuesEvent | 2016-09-04 11:32:54 | owncloud/gallery | https://api.github.com/repos/owncloud/gallery | closed | Gallery+ links in Gallery | documentation | @jancborchardt suggested I should ask this question here.
I've noticed that Gallery+ will be integrated into oc 8.2.0 and I'm curious what will happen to all the links that were created by Gallery+.
e.g. right now I have a link `https://<server>/index.php/apps/galleryplus/s/Y3hngafqvdLBR7g`
Will this link still work in 8.2.0?
<bountysource-plugin>
---
Want to back this issue? **[Post a bounty on it!](https://www.bountysource.com/issues/26687963-gallery-links-in-gallery?utm_campaign=plugin&utm_content=tracker%2F9328526&utm_medium=issues&utm_source=github)** We accept bounties via [Bountysource](https://www.bountysource.com/?utm_campaign=plugin&utm_content=tracker%2F9328526&utm_medium=issues&utm_source=github).
</bountysource-plugin> | 1.0 | Gallery+ links in Gallery - @jancborchardt suggested I should ask this question here.
I've noticed that Gallery+ will be integrated into oc 8.2.0 and I'm curious what will happen to all the links that were created by Gallery+.
e.g. right now I have a link `https://<server>/index.php/apps/galleryplus/s/Y3hngafqvdLBR7g`
Will this link still work in 8.2.0?
<bountysource-plugin>
---
Want to back this issue? **[Post a bounty on it!](https://www.bountysource.com/issues/26687963-gallery-links-in-gallery?utm_campaign=plugin&utm_content=tracker%2F9328526&utm_medium=issues&utm_source=github)** We accept bounties via [Bountysource](https://www.bountysource.com/?utm_campaign=plugin&utm_content=tracker%2F9328526&utm_medium=issues&utm_source=github).
</bountysource-plugin> | non_defect | gallery links in gallery jancborchardt suggested i should ask this question here i ve noticed that gallery will be integrated into oc and i m curious what will happen to all the links that were created by gallery e g right now i have a link will this link still work in want to back this issue we accept bounties via | 0 |
72,373 | 13,823,160,073 | IssuesEvent | 2020-10-13 06:34:52 | eclipse/che | https://api.github.com/repos/eclipse/che | closed | Switch existing tests on k8s to use single-host | area/qe kind/task new¬eworthy status/code-review team/che-qe | ### Is your task related to a problem? Please describe.
Subtask of https://github.com/eclipse/che/issues/16842.
### Describe the solution you'd like
All the tests we are currently running on k8s should run with single-host configuration
### Additional context
**Known issues**
- Running demo application of 'java-web-spring' doesn't work in CHE 'single-host' on k8s https://github.com/eclipse/che/issues/17783
- 'Plugins' list is absent in IDE in CHE 'single-host' on k8s https://github.com/eclipse/che/issues/17749 | 1.0 | Switch existing tests on k8s to use single-host - ### Is your task related to a problem? Please describe.
Subtask of https://github.com/eclipse/che/issues/16842.
### Describe the solution you'd like
All the tests we are currently running on k8s should run with single-host configuration
### Additional context
**Known issues**
- Running demo application of 'java-web-spring' doesn't work in CHE 'single-host' on k8s https://github.com/eclipse/che/issues/17783
- 'Plugins' list is absent in IDE in CHE 'single-host' on k8s https://github.com/eclipse/che/issues/17749 | non_defect | switch existing tests on to use single host is your task related to a problem please describe subtask of describe the solution you d like all the tests we are currently running on should run with single host configuration additional context known issues running demo application of java web spring doesn t work in che single host on plugins list is absent in ide in che single host on | 0 |
645,304 | 21,001,121,517 | IssuesEvent | 2022-03-29 17:33:03 | 123kevyd/recipeasy | https://api.github.com/repos/123kevyd/recipeasy | closed | Connect recipe backend to frontend | Front End High Priority Back End Dev Task | desc: Recipes aren't fetched from the backend and displayed yet | 1.0 | Connect recipe backend to frontend - desc: Recipes aren't fetched from the backend and displayed yet | non_defect | connect recipe backend to frontend desc recipes aren t fetched from the backend and displayed yet | 0 |
52,849 | 7,787,026,006 | IssuesEvent | 2018-06-06 20:55:14 | pangeo-data/pangeo | https://api.github.com/repos/pangeo-data/pangeo | closed | Rework setup guides | documentation | We currently have a handful of setup guides for dask/xarray/pangeo for Cheyenne and Geyser/Caldera. These are quite out of date now and seem to be causing potential users/adopters all sorts of problems. I am proposing that we create more general setup guides:
### HPC systems
In this, we'll discuss how to:
1. setup a conda environment,
1. launch jupyter,
1. connect via an ssh tunnel,
1. launch dask distributed via dask-jobqueue or dask-mpi
I'm open to suggestions on how much detail we really want to include here. These steps can be somewhat machine specific so we'll want to separate those parts.
### Cloud systems
In this, we'd want to leverage the zero-to-jupyterhub but cover the pangeo specific bits. There may also be an argument for contributing some "cloud for dummies" content to zero-to-jupyterhub since we've been developing some new user know-how in this area. | 1.0 | Rework setup guides - We currently have a handful of setup guides for dask/xarray/pangeo for Cheyenne and Geyser/Caldera. These are quite out of date now and seem to be causing potential users/adopters all sorts of problems. I am proposing that we create more general setup guides:
### HPC systems
In this, we'll discuss how to:
1. setup a conda environment,
1. launch jupyter,
1. connect via an ssh tunnel,
1. launch dask distributed via dask-jobqueue or dask-mpi
I'm open to suggestions on how much detail we really want to include here. These steps can be somewhat machine specific so we'll want to separate those parts.
### Cloud systems
In this, we'd want to leverage the zero-to-jupyterhub but cover the pangeo specific bits. There may also be an argument for contributing some "cloud for dummies" content to zero-to-jupyterhub since we've been developing some new user know-how in this area. | non_defect | rework setup guides we currently have a handful of setup guides for dask xarray pangeo for cheyenne and geyser caldera these are quite out of date now and seem to be causing potential users adopters all sorts of problems i am proposing that we create more general setup guides hpc systems in this we ll discuss how to setup a conda environment launch jupyter connect via an ssh tunnel launch dask distributed via dask jobqueue or dask mpi i m open to suggestions on how much detail we really want to include here these steps can be somewhat machine specific so we ll want to separate those parts cloud systems in this we d want to leverage the zero to jupyterhub but cover the pangeo specific bits there may also be an argument for contributing some cloud for dummies content to zero to jupyterhub since we ve been developing some new user know how in this area | 0 |
3,279 | 2,610,059,808 | IssuesEvent | 2015-02-26 18:17:38 | chrsmith/jsjsj122 | https://api.github.com/repos/chrsmith/jsjsj122 | opened | 临海不孕不育治疗费用 | auto-migrated Priority-Medium Type-Defect | ```
临海不孕不育治疗费用【台州五洲生殖医院】24小时健康咨询
热线:0576-88066933-(扣扣800080609)-(微信号tzwzszyy)医院地址:台州市
椒江区枫南路229号（枫南大转盘旁）乘车线路:乘坐104、108、1
18、198及椒江一金清公交车直达枫南小区，乘坐107、105、109、
112、901、 902公交车到星星广场下车，步行即可到院。
诊疗项目：阳痿，早泄，前列腺炎，前列腺增生，龟头炎，��
�精，无精。包皮包茎，精索静脉曲张，淋病等。
台州五洲生殖医院是台州最大的男科医院，权威专家在线免��
�咨询，拥有专业完善的男科检查治疗设备，严格按照国家标�
��收费。尖端医疗设备，与世界同步。权威专家，成就专业典
范。人性化服务，一切以患者为中心。
看男科就选台州五洲生殖医院，专业男科为男人。
```
-----
Original issue reported on code.google.com by `poweragr...@gmail.com` on 30 May 2014 at 7:02 | 1.0 | 临海不孕不育治疗费用 - ```
临海不孕不育治疗费用【台州五洲生殖医院】24小时健康咨询
热线:0576-88066933-(扣扣800080609)-(微信号tzwzszyy)医院地址:台州市
椒江区枫南路229号（枫南大转盘旁）乘车线路:乘坐104、108、1
18、198及椒江一金清公交车直达枫南小区，乘坐107、105、109、
112、901、 902公交车到星星广场下车，步行即可到院。
诊疗项目：阳痿，早泄，前列腺炎，前列腺增生，龟头炎，��
�精，无精。包皮包茎，精索静脉曲张，淋病等。
台州五洲生殖医院是台州最大的男科医院，权威专家在线免��
�咨询，拥有专业完善的男科检查治疗设备，严格按照国家标�
��收费。尖端医疗设备，与世界同步。权威专家，成就专业典
范。人性化服务，一切以患者为中心。
看男科就选台州五洲生殖医院，专业男科为男人。
```
-----
Original issue reported on code.google.com by `poweragr...@gmail.com` on 30 May 2014 at 7:02 | defect | 临海不孕不育治疗费用 临海不孕不育治疗费用【台州五洲生殖医院】 热线 微信号tzwzszyy 医院地址 台州市 （枫南大转盘旁）乘车线路 、 、 、 ， 、 、 、 、 、 ，步行即可到院。 诊疗项目：阳痿，早泄，前列腺炎，前列腺增生，龟头炎，�� �精，无精。包皮包茎，精索静脉曲张，淋病等。 台州五洲生殖医院是台州最大的男科医院，权威专家在线免�� �咨询，拥有专业完善的男科检查治疗设备，严格按照国家标� ��收费。尖端医疗设备，与世界同步。权威专家，成就专业典 范。人性化服务，一切以患者为中心。 看男科就选台州五洲生殖医院，专业男科为男人。 original issue reported on code google com by poweragr gmail com on may at | 1 |
696,289 | 23,895,627,558 | IssuesEvent | 2022-09-08 14:35:33 | bcgov/entity | https://api.github.com/repos/bcgov/entity | closed | Update Resources Page to include Maximus number for account setup and login support | Priority1 OCM | Update resources page to include phone number for login/account set up support.
Just below "call the help desk"
add text, in the same font, same button, etc
For login/account setup support, call: 1-877-370-1033
| 1.0 | Update Resources Page to include Maximus number for account setup and login support - Update resources page to include phone number for login/account set up support.
Just below "call the help desk"
add text, in the same font, same button, etc
For login/account setup support, call: 1-877-370-1033
| non_defect | update resources page to include maximus number for account setup and login support update resources page to include phone number for login account set up support just below call the help desk add text in the same font same button etc for login account setup support call | 0 |
39,029 | 15,859,284,370 | IssuesEvent | 2021-04-08 07:50:22 | azure-deprecation/dashboard | https://api.github.com/repos/azure-deprecation/dashboard | closed | Codeless App Insights monitoring on Azure App Service (Windows) is retiring for .NET 2.0, 2.2, 3.0 by mid-March 2021 (at latest) | area:feature impact:upgrade-required services:app-services verified | Codeless App Insights monitoring on Azure App Service (Windows) is retiring for .NET 2.0, 2.2, 3.0 by mid-March 2021 (at latest)
**Deadline:** Mar 15, 2021
**Impacted Services:**
- Azure App Service (Windows)
**More information:**
- https://github.com/Azure/app-service-announcements/issues/319
### Notice
Here's the official report from Microsoft:
> An upcoming update to App Service Windows will retire Application Insight's auto-instrumentation for .NET Core versions 2.0, 2.2, and 3.0. The update will be applied to your web app(s) between mid-February and mid-March, depending on your web app's region.
>
> > This change does not affect .NET on App Service Linux or Azure Functions.
### Timeline
| Phase | Date | Description |
|:------|------|-------------|
|Announcement|Feb 12, 2021|Deprecation was announced|
|Deprecation|Mar 15, 2021|Codeless monitoring for .NET 2.0, 2.2, 3.0 on Windows will no longer work|
### Impact
Codeless App Insights monitoring on Azure App Service (Windows) is retiring for .NET 2.0, 2.2, 3.0. The update is rolling out between mid-February and mid-March March 2021.
### Required Action
The team provides some interim mitigations to avoid short-term issues:
>The following mitigations should only be used as an interim. We suggest that you upgrade to a supported .NET version in the future and do not rely on these in the long-term.
>
>- You can include the Application Insights SDK directly in your .NET Core application. For more information on including the App Insights SDK in your project, please see this guide: Azure Application Insights for ASP.NET Core applications - Azure Monitor | Microsoft Docs. Once the SDK is added to your project, re-deploy your application to App Service.
>- Set the app setting, `ApplicationInsightsAgent_EXTENSION_VERSION` to a value of 2.8.37. This will trigger App Service to use the old Application Insights extension.
Here's the official report from Microsoft:
> If you are using .NET Core 2.0, 2.2, 3.0, update your web app to a supported version such as .NET Core 3.1 or 2.1 to continue receiving Application Insights telemetry.
### Contact
No information was provided.
| 2.0 | Codeless App Insights monitoring on Azure App Service (Windows) is retiring for .NET 2.0, 2.2, 3.0 by mid-March 2021 (at latest) - Codeless App Insights monitoring on Azure App Service (Windows) is retiring for .NET 2.0, 2.2, 3.0 by mid-March 2021 (at latest)
**Deadline:** Mar 15, 2021
**Impacted Services:**
- Azure App Service (Windows)
**More information:**
- https://github.com/Azure/app-service-announcements/issues/319
### Notice
Here's the official report from Microsoft:
> An upcoming update to App Service Windows will retire Application Insight's auto-instrumentation for .NET Core versions 2.0, 2.2, and 3.0. The update will be applied to your web app(s) between mid-February and mid-March, depending on your web app's region.
>
> > This change does not affect .NET on App Service Linux or Azure Functions.
### Timeline
| Phase | Date | Description |
|:------|------|-------------|
|Announcement|Feb 12, 2021|Deprecation was announced|
|Deprecation|Mar 15, 2021|Codeless monitoring for .NET 2.0, 2.2, 3.0 on Windows will no longer work|
### Impact
Codeless App Insights monitoring on Azure App Service (Windows) is retiring for .NET 2.0, 2.2, 3.0. The update is rolling out between mid-February and mid-March March 2021.
### Required Action
The team provides some interim mitigations to avoid short-term issues:
>The following mitigations should only be used as an interim. We suggest that you upgrade to a supported .NET version in the future and do not rely on these in the long-term.
>
>- You can include the Application Insights SDK directly in your .NET Core application. For more information on including the App Insights SDK in your project, please see this guide: Azure Application Insights for ASP.NET Core applications - Azure Monitor | Microsoft Docs. Once the SDK is added to your project, re-deploy your application to App Service.
>- Set the app setting, `ApplicationInsightsAgent_EXTENSION_VERSION` to a value of 2.8.37. This will trigger App Service to use the old Application Insights extension.
Here's the official report from Microsoft:
> If you are using .NET Core 2.0, 2.2, 3.0, update your web app to a supported version such as .NET Core 3.1 or 2.1 to continue receiving Application Insights telemetry.
### Contact
No information was provided.
| non_defect | codeless app insights monitoring on azure app service windows is retiring for net by mid march at latest codeless app insights monitoring on azure app service windows is retiring for net by mid march at latest deadline mar impacted services azure app service windows more information notice here s the official report from microsoft an upcoming update to app service windows will retire application insight s auto instrumentation for net core versions and the update will be applied to your web app s between mid february and mid march depending on your web app s region this change does not affect net on app service linux or azure functions timeline phase date description announcement feb deprecation was announced deprecation mar codeless monitoring for net on windows will no longer work impact codeless app insights monitoring on azure app service windows is retiring for net the update is rolling out between mid february and mid march march required action the team provides some interim mitigations to avoid short term issues the following mitigations should only be used as an interim we suggest that you upgrade to a supported net version in the future and do not rely on these in the long term you can include the application insights sdk directly in your net core application for more information on including the app insights sdk in your project please see this guide azure application insights for asp net core applications azure monitor microsoft docs once the sdk is added to your project re deploy your application to app service set the app setting applicationinsightsagent extension version to a value of this will trigger app service to use the old application insights extension here s the official report from microsoft if you are using net core update your web app to a supported version such as net core or to continue receiving application insights telemetry contact no information was provided | 0 |
29,272 | 5,632,040,548 | IssuesEvent | 2017-04-05 15:44:27 | BOINC/boinc | https://api.github.com/repos/BOINC/boinc | closed | change checkpoint timing mechanism | C: BOINC - API P: Minor T: Defect | **Reported by davea on 9 Feb 37549995 04:26 UTC**
Old: checkpoint timing is driven by a timer in the runtime library. Checkpoint times of different jobs are out of phase.
New: have the core client send a message saying it's time to checkpoint; do this synchronously between jobs
Migrated-From: http://boinc.berkeley.edu/trac/ticket/349
| 1.0 | change checkpoint timing mechanism - **Reported by davea on 9 Feb 37549995 04:26 UTC**
Old: checkpoint timing is driven by a timer in the runtime library. Checkpoint times of different jobs are out of phase.
New: have the core client send a message saying it's time to checkpoint; do this synchronously between jobs
Migrated-From: http://boinc.berkeley.edu/trac/ticket/349
| defect | change checkpoint timing mechanism reported by davea on feb utc old checkpoint timing is driven by a timer in the runtime library checkpoint times of different jobs are out of phase new have the core client send a message saying it s time to checkpoint do this synchronously between jobs migrated from | 1 |
177,135 | 6,574,674,204 | IssuesEvent | 2017-09-11 13:43:28 | vmware/vic | https://api.github.com/repos/vmware/vic | opened | docker inspect does not populate IPAddress field properly | kind/bug priority/medium | vanilla docker:
```
"NetworkSettings": {
"Bridge": "",
"SandboxID": "ff905ff4362daaa20182f5f43c0fbfa7ab3925886fb218f5219553c560e2d012",
"HairpinMode": false,
"LinkLocalIPv6Address": "",
"LinkLocalIPv6PrefixLen": 0,
"Ports": {
"80/tcp": null
},
"SandboxKey": "/var/run/docker/netns/ff905ff4362d",
"SecondaryIPAddresses": null,
"SecondaryIPv6Addresses": null,
"EndpointID": "223a41a39069f9f6c6ff4592e21b2f9114c73723766b616324d4ba77815d94e2",
"Gateway": "172.17.0.1",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"IPAddress": "172.17.0.2",
"IPPrefixLen": 16,
"IPv6Gateway": "",
"MacAddress": "02:42:ac:11:00:02",
"Networks": {
"bridge": {
"IPAMConfig": null,
"Links": null,
"Aliases": null,
"NetworkID": "29ad1e62d28eb0dbb32b9e810ebf1fa866c6d99ee2a821250496e252329e18ca",
"EndpointID": "223a41a39069f9f6c6ff4592e21b2f9114c73723766b616324d4ba77815d94e2",
"Gateway": "172.17.0.1",
"IPAddress": "172.17.0.2",
"IPPrefixLen": 16,
"IPv6Gateway": "",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"MacAddress": "02:42:ac:11:00:02"
}
}
```
VCH:
```
"NetworkSettings": {
"Bridge": "",
"SandboxID": "",
"HairpinMode": false,
"LinkLocalIPv6Address": "",
"LinkLocalIPv6PrefixLen": 0,
"Ports": {
"80/tcp": null
},
"SandboxKey": "",
"SecondaryIPAddresses": null,
"SecondaryIPv6Addresses": null,
"EndpointID": "",
"Gateway": "",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"IPAddress": "",
"IPPrefixLen": 0,
"IPv6Gateway": "",
"MacAddress": "",
"Networks": {
"bridge": {
"IPAMConfig": null,
"Links": null,
"Aliases": null,
"NetworkID": "",
"EndpointID": "192",
"Gateway": "172.16.0.1/16",
"IPAddress": "172.16.0.2",
"IPPrefixLen": 16,
"IPv6Gateway": "",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"MacAddress": ""
}
}
```
MAC address and gateway also are not quite correct. | 1.0 | docker inspect does not populate IPAddress field properly - vanilla docker:
```
"NetworkSettings": {
"Bridge": "",
"SandboxID": "ff905ff4362daaa20182f5f43c0fbfa7ab3925886fb218f5219553c560e2d012",
"HairpinMode": false,
"LinkLocalIPv6Address": "",
"LinkLocalIPv6PrefixLen": 0,
"Ports": {
"80/tcp": null
},
"SandboxKey": "/var/run/docker/netns/ff905ff4362d",
"SecondaryIPAddresses": null,
"SecondaryIPv6Addresses": null,
"EndpointID": "223a41a39069f9f6c6ff4592e21b2f9114c73723766b616324d4ba77815d94e2",
"Gateway": "172.17.0.1",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"IPAddress": "172.17.0.2",
"IPPrefixLen": 16,
"IPv6Gateway": "",
"MacAddress": "02:42:ac:11:00:02",
"Networks": {
"bridge": {
"IPAMConfig": null,
"Links": null,
"Aliases": null,
"NetworkID": "29ad1e62d28eb0dbb32b9e810ebf1fa866c6d99ee2a821250496e252329e18ca",
"EndpointID": "223a41a39069f9f6c6ff4592e21b2f9114c73723766b616324d4ba77815d94e2",
"Gateway": "172.17.0.1",
"IPAddress": "172.17.0.2",
"IPPrefixLen": 16,
"IPv6Gateway": "",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"MacAddress": "02:42:ac:11:00:02"
}
}
```
VCH:
```
"NetworkSettings": {
"Bridge": "",
"SandboxID": "",
"HairpinMode": false,
"LinkLocalIPv6Address": "",
"LinkLocalIPv6PrefixLen": 0,
"Ports": {
"80/tcp": null
},
"SandboxKey": "",
"SecondaryIPAddresses": null,
"SecondaryIPv6Addresses": null,
"EndpointID": "",
"Gateway": "",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"IPAddress": "",
"IPPrefixLen": 0,
"IPv6Gateway": "",
"MacAddress": "",
"Networks": {
"bridge": {
"IPAMConfig": null,
"Links": null,
"Aliases": null,
"NetworkID": "",
"EndpointID": "192",
"Gateway": "172.16.0.1/16",
"IPAddress": "172.16.0.2",
"IPPrefixLen": 16,
"IPv6Gateway": "",
"GlobalIPv6Address": "",
"GlobalIPv6PrefixLen": 0,
"MacAddress": ""
}
}
```
MAC address and gateway also are not quite correct. | non_defect | docker inspect does not populate ipaddress field properly vanilla docker networksettings bridge sandboxid hairpinmode false ports tcp null sandboxkey var run docker netns secondaryipaddresses null null endpointid gateway ipaddress ipprefixlen macaddress ac networks bridge ipamconfig null links null aliases null networkid endpointid gateway ipaddress ipprefixlen macaddress ac vch networksettings bridge sandboxid hairpinmode false ports tcp null sandboxkey secondaryipaddresses null null endpointid gateway ipaddress ipprefixlen macaddress networks bridge ipamconfig null links null aliases null networkid endpointid gateway ipaddress ipprefixlen macaddress mac address and gateway also are not quite correct | 0 |
112,496 | 11,770,415,015 | IssuesEvent | 2020-03-15 19:08:09 | contributing-to-kubernetes/cool-kubernetes | https://api.github.com/repos/contributing-to-kubernetes/cool-kubernetes | closed | Document PR #85968 (Fix bug in apiserver service cidr split) | documentation | **PR:**
https://github.com/kubernetes/kubernetes/pull/85968
**ISSUE:**
bug
**SIG LABELS:**
sig/api-machinery
sig/network | 1.0 | Document PR #85968 (Fix bug in apiserver service cidr split) - **PR:**
https://github.com/kubernetes/kubernetes/pull/85968
**ISSUE:**
bug
**SIG LABELS:**
sig/api-machinery
sig/network | non_defect | document pr fix bug in apiserver service cidr split pr issue bug sig labels sig api machinery sig network | 0 |
696,842 | 23,918,326,700 | IssuesEvent | 2022-09-09 14:33:48 | cs2103jan2015-w09-4j/main | https://api.github.com/repos/cs2103jan2015-w09-4j/main | closed | User can dismiss or bring up the program to the task bar | priority.high feature.advanced | The program can be dismissed at will.
This task requires the GUI version of the program be up first.
| 1.0 | User can dismiss or bring up the program to the task bar - The program can be dismissed at will.
This task requires the GUI version of the program be up first.
| non_defect | user can dismiss or bring up the program to the task bar the program can be dismissed at will this task requires the gui version of the program be up first | 0 |
13,928 | 2,789,762,255 | IssuesEvent | 2015-05-08 21:20:08 | google/google-visualization-api-issues | https://api.github.com/repos/google/google-visualization-api-issues | opened | Bug: Y-axis title on areachart is way too small (5 pt?) - and API does not allow us to change this | Priority-Medium Type-Defect | Original [issue 72](https://code.google.com/p/google-visualization-api-issues/issues/detail?id=72) created by orwant on 2009-09-30T16:53:01.000Z:
<b>What steps will reproduce the problem? Please provide a link to a</b>
<b>demonstration page if at all possible, or attach code.</b>
1. It should default to the same as the category labels
2. Or change the API to allow a font size to be specified
<b>3.</b>
<b>What component is this issue related to (PieChart, LineChart, DataTable,</b>
<b>Query, etc)?</b>
AreaChart
<b>Are you using the test environment (version 1.1)?</b>
Have tried both, same behavior
<b>What operating system and browser are you using?</b>
Windows XP (IE8 and Firefox) and Ubuntu (Firefox)
<b>*********************************************************</b>
<b>For developers viewing this issue: please click the 'star' icon to be</b>
<b>notified of future changes, and to let us know how many of you are</b>
<b>interested in seeing it resolved.</b>
<b>*********************************************************</b>
| 1.0 | Bug: Y-axis title on areachart is way too small (5 pt?) - and API does not allow us to change this - Original [issue 72](https://code.google.com/p/google-visualization-api-issues/issues/detail?id=72) created by orwant on 2009-09-30T16:53:01.000Z:
<b>What steps will reproduce the problem? Please provide a link to a</b>
<b>demonstration page if at all possible, or attach code.</b>
1. It should default to the same as the category labels
2. Or change the API to allow a font size to be specified
<b>3.</b>
<b>What component is this issue related to (PieChart, LineChart, DataTable,</b>
<b>Query, etc)?</b>
AreaChart
<b>Are you using the test environment (version 1.1)?</b>
Have tried both, same behavior
<b>What operating system and browser are you using?</b>
Windows XP (IE8 and Firefox) and Ubuntu (Firefox)
<b>*********************************************************</b>
<b>For developers viewing this issue: please click the 'star' icon to be</b>
<b>notified of future changes, and to let us know how many of you are</b>
<b>interested in seeing it resolved.</b>
<b>*********************************************************</b>
| defect | bug y axis title on areachart is way too small pt and api does not allow us to change this original created by orwant on what steps will reproduce the problem please provide a link to a demonstration page if at all possible or attach code it should default to the same as the category labels or change the api to allow a font size to be specified what component is this issue related to piechart linechart datatable query etc areachart are you using the test environment version have tried both same behavior what operating system and browser are you using windows xp and firefox and ubuntu firefox for developers viewing this issue please click the star icon to be notified of future changes and to let us know how many of you are interested in seeing it resolved | 1 |
14,160 | 2,790,616,419 | IssuesEvent | 2015-05-09 11:38:35 | excilys/androidannotations | https://api.github.com/repos/excilys/androidannotations | closed | @PreferenceChange minor parameter related changes | Defect | You are supporting a Boolean parameter on the @PreferenceChange annotation (but not mentioned in documentation), and you are not supporting a
Set<String>
parameter (but is reported in the documentation, you probably only meant to say that Set is supported) Finally the Long parameter is not supported (and correctly not reported in the documentation).
Maybe while you are at it you can also change @SharedPref to support Double, and also make @PreferenceChange support doubles? | 1.0 | @PreferenceChange minor parameter related changes - You are supporting a Boolean parameter on the @PreferenceChange annotation (but not mentioned in documentation), and you are not supporting a
Set<String>
parameter (but is reported in the documentation, you probably only meant to say that Set is supported) Finally the Long parameter is not supported (and correctly not reported in the documentation).
Maybe while you are at it you can also change @SharedPref to support Double, and also make @PreferenceChange support doubles? | defect | preferencechange minor parameter related changes you are supporting a boolean parameter on the preferencechange annotation but not mentioned in documentation and you are not supporting a set parameter but is reported in the documentation you probably only meant to say that set is supported finally the long parameter is not supported and correctly not reported in the documentation maybe while you are at it you can also change sharedpref to support double and also make preferencechange support doubles | 1 |
23,730 | 11,944,603,513 | IssuesEvent | 2020-04-03 03:00:05 | microsoft/BotFramework-WebChat | https://api.github.com/repos/microsoft/BotFramework-WebChat | opened | Webchat Speech Services in Spanish | Bot Services Pending Question customer-reported | 🚨 The issue tracker is not for implementation questions 🚨
<!-- ATTENTION: Bot Framework internals, please remove the `customer-reported` and `Bot Services` labels before submitting this issue. -->
<!-- If you have other questions on implementation of Web Chat or about other features of Bot Framework, please see the support page on where to direct your question. -->
Greetings guys,
I managed to connect my bot to speech services, however, I'm trying to get it to recognize and speak Spanish, but it is still sending en-US to cognitive services (sample url:
wss://eastus.stt.speech.microsoft.com/speech/recognition/conversation/cognitiveservices/v1?language=en-US&format=detailed&Authorization=eyJhbGciOiJodHRwOi8vd3d3LnczLm9yZy8yMDAxLzA0L3htbGRzaWctbW9yZSNobWFjLXNoYTI1NiIsInR5cCI6IkpXVCJ9.eyJyZW.........)
If I set chrome as spanish, then it understands me in spanish perfectly, but speech-to-text still reads it a very weird spanish with a strong english accent (I hope that makes sense), but I need to get spanish in recognition and speech-to-text.
Any help would be greatly appreciated,
Thanks,
Geo
Here's my final renderchat (excluded tokens to both speech and directline for brevity, but it is working, just in the wrong language.
`
window.WebChat.renderWebChat(
{
directLine: window.WebChat.createDirectLine({ token }),
store,
selectVoice: (voices, activity) =>
activity.locale === 'es-ES'
? voices.find(({ name }) => /TracyRUS/iu.test(name))
: voices.find(({ name }) => /JessaNeural/iu.test(name)) ||
voices.find(({ name }) => /Jessa/iu.test(name)),
webSpeechPonyfillFactory
},
document.getElementById('webchat')
);
`
| 1.0 | Webchat Speech Services in Spanish - 🚨 The issue tracker is not for implementation questions 🚨
<!-- ATTENTION: Bot Framework internals, please remove the `customer-reported` and `Bot Services` labels before submitting this issue. -->
<!-- If you have other questions on implementation of Web Chat or about other features of Bot Framework, please see the support page on where to direct your question. -->
Greetings guys,
I managed to connect my bot to speech services, however, I'm trying to get it to recognize and speak Spanish, but it is still sending en-US to cognitive services (sample url:
wss://eastus.stt.speech.microsoft.com/speech/recognition/conversation/cognitiveservices/v1?language=en-US&format=detailed&Authorization=eyJhbGciOiJodHRwOi8vd3d3LnczLm9yZy8yMDAxLzA0L3htbGRzaWctbW9yZSNobWFjLXNoYTI1NiIsInR5cCI6IkpXVCJ9.eyJyZW.........)
If I set chrome as spanish, then it understands me in spanish perfectly, but speech-to-text still reads it a very weird spanish with a strong english accent (I hope that makes sense), but I need to get spanish in recognition and speech-to-text.
Any help would be greatly appreciated,
Thanks,
Geo
Here's my final renderchat (excluded tokens to both speech and directline for brevity, but it is working, just in the wrong language.
`
window.WebChat.renderWebChat(
{
directLine: window.WebChat.createDirectLine({ token }),
store,
selectVoice: (voices, activity) =>
activity.locale === 'es-ES'
? voices.find(({ name }) => /TracyRUS/iu.test(name))
: voices.find(({ name }) => /JessaNeural/iu.test(name)) ||
voices.find(({ name }) => /Jessa/iu.test(name)),
webSpeechPonyfillFactory
},
document.getElementById('webchat')
);
`
| non_defect | webchat speech services in spanish 🚨 the issue tracker is not for implementation questions 🚨 greetings guys i managed to connect my bot to speech services however i m trying to get it to recognize and speak spanish but it is still sending en us to cognitive services sample url wss eastus stt speech microsoft com speech recognition conversation cognitiveservices language en us format detailed authorization eyjyzw if i set chrome as spanish then it understands me in spanish perfectly but speech to text still reads it a very weird spanish with a strong english accent i hope that makes sense but i need to get spanish in recognition and speech to text any help would be greatly appreciated thanks geo here s my final renderchat excluded tokens to both speech and directline for brevity but it is working just in the wrong language window webchat renderwebchat directline window webchat createdirectline token store selectvoice voices activity activity locale es es voices find name tracyrus iu test name voices find name jessaneural iu test name voices find name jessa iu test name webspeechponyfillfactory document getelementbyid webchat | 0 |
75,810 | 26,074,610,840 | IssuesEvent | 2022-12-24 09:55:31 | openzfs/zfs | https://api.github.com/repos/openzfs/zfs | closed | initramfs: booting a snapshot doesn't work if the rootfs dataset tree contains branches using canmount=off | Type: Defect Status: Stale | ### System information
Type | Version/Name
--- | ---
Distribution Name | Debian
Distribution Version | bullseye/buster (stable/oldstable, same ZFS version)
Kernel Version | n/a, script issue
Architecture | n/a, script issue
OpenZFS Version | zfs-2.0.3-9~bpo10+1 (bug present in current master)
### Describe the problem you're observing
Booting with the kernel cmdline `rootfs=zfs:rpool/myrootfs@myfoosnapshot` fails if there are datasets in the rootfs having set `canmount=off`.
### Describe how to reproduce the problem
Arbitrary example rootfs layout:
```
rpool/myrootfs (canmount=noauto)
rpool/myrootfs/var (canmount=off)
rpool/myrootfs/var/lib (canmount=on via default)
```
AFAUI the root cause lies in zfs snapshots not having a `canmount` property. Therefore `contrib/initramfs/zfs/scripts` cannot deduce whether or not do clone `rpool/myrootfs/var` - which it shouldn't due to `canmount=off`, it does however. And in doing so (and mounting said clone), all data stored below `rpool/myrootfs` and not being handled by `rpool/myrootfs/var/lib` gets masked by mounting an empty clone of `rpool/myrootfs/var` to `/root/var`.
| 1.0 | initramfs: booting a snapshot doesn't work if the rootfs dataset tree contains branches using canmount=off - ### System information
Type | Version/Name
--- | ---
Distribution Name | Debian
Distribution Version | bullseye/buster (stable/oldstable, same ZFS version)
Kernel Version | n/a, script issue
Architecture | n/a, script issue
OpenZFS Version | zfs-2.0.3-9~bpo10+1 (bug present in current master)
### Describe the problem you're observing
Booting with the kernel cmdline `rootfs=zfs:rpool/myrootfs@myfoosnapshot` fails if there are datasets in the rootfs having set `canmount=off`.
### Describe how to reproduce the problem
Arbitrary example rootfs layout:
```
rpool/myrootfs (canmount=noauto)
rpool/myrootfs/var (canmount=off)
rpool/myrootfs/var/lib (canmount=on via default)
```
AFAUI the root cause lies in zfs snapshots not having a `canmount` property. Therefore `contrib/initramfs/zfs/scripts` cannot deduce whether or not do clone `rpool/myrootfs/var` - which it shouldn't due to `canmount=off`, it does however. And in doing so (and mounting said clone), all data stored below `rpool/myrootfs` and not being handled by `rpool/myrootfs/var/lib` gets masked by mounting an empty clone of `rpool/myrootfs/var` to `/root/var`.
| defect | initramfs booting a snapshot doesn t work if the rootfs dataset tree contains branches using canmount off system information type version name distribution name debian distribution version bullseye buster stable oldstable same zfs version kernel version n a script issue architecture n a script issue openzfs version zfs bug present in current master describe the problem you re observing booting with the kernel cmdline rootfs zfs rpool myrootfs myfoosnapshot fails if there are datasets in the rootfs having set canmount off describe how to reproduce the problem arbitrary example rootfs layout rpool myrootfs canmount noauto rpool myrootfs var canmount off rpool myrootfs var lib canmount on via default afaui the root cause lies in zfs snapshots not having a canmount property therefore contrib initramfs zfs scripts cannot deduce whether or not do clone rpool myrootfs var which it shouldn t due to canmount off it does however and in doing so and mounting said clone all data stored below rpool myrootfs and not being handled by rpool myrootfs var lib gets masked by mounting an empty clone of rpool myrootfs var to root var | 1 |
90,454 | 18,156,218,609 | IssuesEvent | 2021-09-27 02:10:59 | EddieHubCommunity/api | https://api.github.com/repos/EddieHubCommunity/api | closed | Unittesting | ✨ goal: improvement 💻 aspect: code 💬 talk: discussion no-issue-activity | The Unittests which are currently available are the predefined ones. Should we invest time in Unittests in addition to e2e-tests? | 1.0 | Unittesting - The Unittests which are currently available are the predefined ones. Should we invest time in Unittests in addition to e2e-tests? | non_defect | unittesting the unittests which are currently available are the predefined ones should we invest time in unittests in addition to tests | 0 |
9,910 | 2,616,009,868 | IssuesEvent | 2015-03-02 00:53:26 | jasonhall/bwapi | https://api.github.com/repos/jasonhall/bwapi | closed | How to warp two Protoss Templar into one Protoss Archon? | auto-migrated Component-Logic Maintainability Priority-High Type-Defect Usability | ```
What steps will reproduce the problem?
1. In BWAPI, I cannot find a way to warp(merge) two templars into an
Archon.
What is the expected output? What do you see instead?
What version of the product are you using? On what operating system?
BWAPI 2.6.1. It is not OS-dependent.
Please provide any additional information below.
```
Original issue reported on code.google.com by `huangsha...@gmail.com` on 26 Jan 2010 at 2:48 | 1.0 | How to warp two Protoss Templar into one Protoss Archon? - ```
What steps will reproduce the problem?
1. In BWAPI, I cannot find a way to warp(merge) two templars into an
Archon.
What is the expected output? What do you see instead?
What version of the product are you using? On what operating system?
BWAPI 2.6.1. It is not OS-dependent.
Please provide any additional information below.
```
Original issue reported on code.google.com by `huangsha...@gmail.com` on 26 Jan 2010 at 2:48 | defect | how to warp two protoss templar into one protoss archon what steps will reproduce the problem in bwapi i cannot find a way to warp merge two templars into an archon what is the expected output what do you see instead what version of the product are you using on what operating system bwapi it is not os dependent please provide any additional information below original issue reported on code google com by huangsha gmail com on jan at | 1 |
59,565 | 17,023,163,740 | IssuesEvent | 2021-07-03 00:39:36 | tomhughes/trac-tickets | https://api.github.com/repos/tomhughes/trac-tickets | closed | Segment direction is reversed | Component: potlatch (flash editor) Priority: major Resolution: fixed Type: defect | **[Submitted to the original trac issue database at 2.04am, Saturday, 19th May 2007]**
I just used potlach (a couple of hours before the official announcment) to plot some motorways. I made sure that they got plotted in the right direction, so they keep the one-way-ness.
However, looking at the data in JOSM, all segments created by Potlach are reversed.
This really can screw up one-way roads if the data isn't reviewed in JOSM later...
| 1.0 | Segment direction is reversed - **[Submitted to the original trac issue database at 2.04am, Saturday, 19th May 2007]**
I just used potlach (a couple of hours before the official announcment) to plot some motorways. I made sure that they got plotted in the right direction, so they keep the one-way-ness.
However, looking at the data in JOSM, all segments created by Potlach are reversed.
This really can screw up one-way roads if the data isn't reviewed in JOSM later...
| defect | segment direction is reversed i just used potlach a couple of hours before the official announcment to plot some motorways i made sure that they got plotted in the right direction so they keep the one way ness however looking at the data in josm all segments created by potlach are reversed this really can screw up one way roads if the data isn t reviewed in josm later | 1 |
30,181 | 13,206,957,203 | IssuesEvent | 2020-08-14 21:33:14 | cityofaustin/atd-data-tech | https://api.github.com/repos/cityofaustin/atd-data-tech | closed | [Bug] Fee Status Field Error | Need: 1-Must Have Product: TIA Module Service: Apps Type: Bug Report | ### Update Fee Paid Field to accept 'No' as a valid value.
- When updating the 'Review Fee Sent' field to 'Yes', and the Fee Paid field to 'No', the system throws the error "Fee Paid is Required"
| 1.0 | [Bug] Fee Status Field Error - ### Update Fee Paid Field to accept 'No' as a valid value.
- When updating the 'Review Fee Sent' field to 'Yes', and the Fee Paid field to 'No', the system throws the error "Fee Paid is Required"
| non_defect | fee status field error update fee paid field to accept no as a valid value when updating the review fee sent field to yes and the fee paid field to no the system throws the error fee paid is required | 0 |
205,369 | 7,097,422,551 | IssuesEvent | 2018-01-14 19:08:41 | bitshares/bitshares-ui | https://api.github.com/repos/bitshares/bitshares-ui | closed | [1][startailcoon] Deposit Modal Tweaks | bug high priority | When selecting from the dashboard, we should send both the gateway and the symbol to the deposit modal so both values are populated when the modal opens. As it stands now, we are always defaulting to BTS.
| 1.0 | [1][startailcoon] Deposit Modal Tweaks - When selecting from the dashboard, we should send both the gateway and the symbol to the deposit modal so both values are populated when the modal opens. As it stands now, we are always defaulting to BTS.
| non_defect | deposit modal tweaks when selecting from the dashboard we should send both the gateway and the symbol to the deposit modal so both values are populated when the modal opens as it stands now we are always defaulting to bts | 0 |
64,472 | 18,684,715,541 | IssuesEvent | 2021-11-01 10:55:11 | obophenotype/cell-ontology | https://api.github.com/repos/obophenotype/cell-ontology | closed | "lacks" relations as object properties (between individuals) are not meaningful: | Priority-Medium Type-Defect auto-migrated autoclosed-unfixed | ```
From Stefan:
- Erythrocyte subClassOf lacks_part some ribosome
- 'erythroid lineage cell' and (lacks_part some nucleolus) and
(lacks_plasma_membrane_part some 'CD19 molecule') …
(145 uses of lacks* )
```
Original issue reported on code.google.com by `cmung...@gmail.com` on 25 Jun 2013 at 10:34
| 1.0 | "lacks" relations as object properties (between individuals) are not meaningful: - ```
From Stefan:
- Erythrocyte subClassOf lacks_part some ribosome
- 'erythroid lineage cell' and (lacks_part some nucleolus) and
(lacks_plasma_membrane_part some 'CD19 molecule') …
(145 uses of lacks* )
```
Original issue reported on code.google.com by `cmung...@gmail.com` on 25 Jun 2013 at 10:34
| defect | lacks relations as object properties between individuals are not meaningful from stefan erythrocyte subclassof lacks part some ribosome erythroid lineage cell and lacks part some nucleolus and lacks plasma membrane part some molecule … uses of lacks original issue reported on code google com by cmung gmail com on jun at | 1 |
60,487 | 17,023,439,739 | IssuesEvent | 2021-07-03 02:02:31 | tomhughes/trac-tickets | https://api.github.com/repos/tomhughes/trac-tickets | closed | Not translatable text on relation history page | Component: website Priority: minor Resolution: fixed Type: defect | **[Submitted to the original trac issue database at 7.21pm, Friday, 10th July 2009]**
The text "Download XML or view details" in the bottom of the relation history page is not translatable. Please correct the file [http://svn.openstreetmap.org/sites/rails_port/app/views/browse/relation_history.html.erb] (like the node history and way history), and add missing strings to the l18n files. | 1.0 | Not translatable text on relation history page - **[Submitted to the original trac issue database at 7.21pm, Friday, 10th July 2009]**
The text "Download XML or view details" in the bottom of the relation history page is not translatable. Please correct the file [http://svn.openstreetmap.org/sites/rails_port/app/views/browse/relation_history.html.erb] (like the node history and way history), and add missing strings to the l18n files. | defect | not translatable text on relation history page the text download xml or view details in the bottom of the relation history page is not translatable please correct the file like the node history and way history and add missing strings to the files | 1 |
758,676 | 26,564,413,018 | IssuesEvent | 2023-01-20 18:43:10 | grpc/grpc | https://api.github.com/repos/grpc/grpc | closed | [fork] grpcio1.52.0rc1 python library hang on fork. | kind/bug lang/Python priority/P2 untriaged | <!--
PLEASE DO NOT POST A QUESTION HERE.
This form is for bug reports and feature requests ONLY!
For general questions and troubleshooting, please ask/look for answers at StackOverflow, with "grpc" tag: https://stackoverflow.com/questions/tagged/grpc
For questions that specifically need to be answered by gRPC team members, please ask/look for answers at grpc.io mailing list: https://groups.google.com/forum/#!forum/grpc-io
Issues specific to *grpc-java*, *grpc-go*, *grpc-node*, *grpc-dart*, *grpc-web* should be created in the repository they belong to (e.g. https://github.com/grpc/grpc-LANGUAGE/issues/new)
-->
### What version of gRPC and what language are you using?
grpcio1.52.0rc1
### What operating system (Linux, Windows,...) and version?
Linux
### What runtime / compiler are you using (e.g. python version or version of gcc)
python3.7
### What did you do?
pip install ray
pip install --pre grpcio==1.52.0rc1
run following script
```
import ray
ray.init(
num_cpus=2,
object_store_memory=700e6,
_system_config={"inline_object_status_in_refs": True},
)
```
### What did you expect to see?
exit successfully
### What did you see instead?
hanging with
```
E0119 20:24:49.531070000 4528778752 thread_pool.cc:254] Waiting for thread pool to idle before forking
E0119 20:24:52.531712000 4528778752 thread_pool.cc:254] Waiting for thread pool to idle before forking
```
Make sure you include information that can help us debug (full error message, exception listing, stack trace, logs).
See [TROUBLESHOOTING.md](https://github.com/grpc/grpc/blob/master/TROUBLESHOOTING.md) for how to diagnose problems better.
### Anything else we should know about your project / environment?
https://buildkite.com/ray-project/oss-ci-build-branch/builds/1917#0185cd14-ed5f-4614-b685-fb35b5d2922e/1785-2278
tests in our CI
| 1.0 | [fork] grpcio1.52.0rc1 python library hang on fork. - <!--
PLEASE DO NOT POST A QUESTION HERE.
This form is for bug reports and feature requests ONLY!
For general questions and troubleshooting, please ask/look for answers at StackOverflow, with "grpc" tag: https://stackoverflow.com/questions/tagged/grpc
For questions that specifically need to be answered by gRPC team members, please ask/look for answers at grpc.io mailing list: https://groups.google.com/forum/#!forum/grpc-io
Issues specific to *grpc-java*, *grpc-go*, *grpc-node*, *grpc-dart*, *grpc-web* should be created in the repository they belong to (e.g. https://github.com/grpc/grpc-LANGUAGE/issues/new)
-->
### What version of gRPC and what language are you using?
grpcio1.52.0rc1
### What operating system (Linux, Windows,...) and version?
Linux
### What runtime / compiler are you using (e.g. python version or version of gcc)
python3.7
### What did you do?
pip install ray
pip install --pre grpcio==1.52.0rc1
run following script
```
import ray
ray.init(
num_cpus=2,
object_store_memory=700e6,
_system_config={"inline_object_status_in_refs": True},
)
```
### What did you expect to see?
exit successfully
### What did you see instead?
hanging with
```
E0119 20:24:49.531070000 4528778752 thread_pool.cc:254] Waiting for thread pool to idle before forking
E0119 20:24:52.531712000 4528778752 thread_pool.cc:254] Waiting for thread pool to idle before forking
```
Make sure you include information that can help us debug (full error message, exception listing, stack trace, logs).
See [TROUBLESHOOTING.md](https://github.com/grpc/grpc/blob/master/TROUBLESHOOTING.md) for how to diagnose problems better.
### Anything else we should know about your project / environment?
https://buildkite.com/ray-project/oss-ci-build-branch/builds/1917#0185cd14-ed5f-4614-b685-fb35b5d2922e/1785-2278
tests in our CI
| non_defect | python library hang on fork please do not post a question here this form is for bug reports and feature requests only for general questions and troubleshooting please ask look for answers at stackoverflow with grpc tag for questions that specifically need to be answered by grpc team members please ask look for answers at grpc io mailing list issues specific to grpc java grpc go grpc node grpc dart grpc web should be created in the repository they belong to e g what version of grpc and what language are you using what operating system linux windows and version linux what runtime compiler are you using e g python version or version of gcc what did you do pip install ray pip install pre grpcio run following script import ray ray init num cpus object store memory system config inline object status in refs true what did you expect to see exit successfully what did you see instead hanging with thread pool cc waiting for thread pool to idle before forking thread pool cc waiting for thread pool to idle before forking make sure you include information that can help us debug full error message exception listing stack trace logs see for how to diagnose problems better anything else we should know about your project environment tests in our ci | 0 |
307,751 | 9,421,804,119 | IssuesEvent | 2019-04-11 07:51:18 | NillerMedDild/Enigmatica2Expert | https://api.github.com/repos/NillerMedDild/Enigmatica2Expert | closed | RFTools spawner not spawning Modded creatures | Marker: Config Priority: Low Status: Completed Type: Enhancement | 1.59a
So far the issue has been reproduced.
modded mobs including the Blizz and similar mobs are giving a "NullRF" notification in the RFTools spawner.
| 1.0 | RFTools spawner not spawning Modded creatures - 1.59a
So far the issue has been reproduced.
modded mobs including the Blizz and similar mobs are giving a "NullRF" notification in the RFTools spawner.
| non_defect | rftools spawner not spawning modded creatures so far the issue has been reproduced modded mobs including the blizz and similar mobs are giving a nullrf notification in the rftools spawner | 0 |
28,680 | 5,330,555,167 | IssuesEvent | 2017-02-15 17:19:00 | bridgedotnet/Bridge | https://api.github.com/repos/bridgedotnet/Bridge | closed | Struct is not cloned during box/unbox operations | defect in progress | Any value type must be cloned during box/unbox conversion
### Steps To Reproduce
http://deck.net/b68d86f0bd432125ec567d028859f04b
```c#
interface IChangeBoxedPoint
{
void Change(int x, int y);
}
struct Point : IChangeBoxedPoint
{
private int m_x, m_y;
public Point(int x, int y)
{
m_x = x;
m_y = y;
}
public void Change(int x, int y)
{
m_x = x;
m_y = y;
}
public override string ToString()
{
return $"({m_x}, {m_y})";
}
}
public class Program
{
public static void Main()
{
Point p = new Point(1, 1);
// (1, 1)
Console.WriteLine(p);
p.Change(2, 2);
// (2, 2)
Console.WriteLine(p);
object o = p;
// (2, 2)
Console.WriteLine(o);
((Point) o).Change(3, 3);
// (2, 2)
Console.WriteLine(o);
((IChangeBoxedPoint) p).Change(4, 4);
// (2, 2)
Console.WriteLine(p);
((IChangeBoxedPoint) o).Change(5, 5);
// (5, 5)
Console.WriteLine(o);
}
}
```
### Expected Result
```js
(1, 1)
(2, 2)
(2, 2)
(2, 2)
(2, 2)
(5, 5)
```
### Actual Result
```js
(1, 1)
(2, 2)
(2, 2)
(3, 3)
(4, 4)
(5, 5)
```
| 1.0 | Struct is not cloned during box/unbox operations - Any value type must be cloned during box/unbox conversion
### Steps To Reproduce
http://deck.net/b68d86f0bd432125ec567d028859f04b
```c#
interface IChangeBoxedPoint
{
void Change(int x, int y);
}
struct Point : IChangeBoxedPoint
{
private int m_x, m_y;
public Point(int x, int y)
{
m_x = x;
m_y = y;
}
public void Change(int x, int y)
{
m_x = x;
m_y = y;
}
public override string ToString()
{
return $"({m_x}, {m_y})";
}
}
public class Program
{
public static void Main()
{
Point p = new Point(1, 1);
// (1, 1)
Console.WriteLine(p);
p.Change(2, 2);
// (2, 2)
Console.WriteLine(p);
object o = p;
// (2, 2)
Console.WriteLine(o);
((Point) o).Change(3, 3);
// (2, 2)
Console.WriteLine(o);
((IChangeBoxedPoint) p).Change(4, 4);
// (2, 2)
Console.WriteLine(p);
((IChangeBoxedPoint) o).Change(5, 5);
// (5, 5)
Console.WriteLine(o);
}
}
```
### Expected Result
```js
(1, 1)
(2, 2)
(2, 2)
(2, 2)
(2, 2)
(5, 5)
```
### Actual Result
```js
(1, 1)
(2, 2)
(2, 2)
(3, 3)
(4, 4)
(5, 5)
```
| defect | struct is not cloned during box unbox operations any value type must be cloned during box unbox conversion steps to reproduce c interface ichangeboxedpoint void change int x int y struct point ichangeboxedpoint private int m x m y public point int x int y m x x m y y public void change int x int y m x x m y y public override string tostring return m x m y public class program public static void main point p new point console writeline p p change console writeline p object o p console writeline o point o change console writeline o ichangeboxedpoint p change console writeline p ichangeboxedpoint o change console writeline o expected result js actual result js | 1 |
22,758 | 3,697,312,425 | IssuesEvent | 2016-02-27 15:56:50 | garglk/garglk | https://api.github.com/repos/garglk/garglk | closed | libsmpeg0 dependency | auto-migrated Priority-Medium Type-Defect | ```
Installing Gargoyle in Ubuntu GNOME 14.04 there is need to install manually the
pakage libsmpeg0 because it is not pheraps inserted in the dependency list of
the Debian pakage.
Probably you have to insert libsmpeg0 in the dependency list :)
```
Original issue reported on code.google.com by `valerio....@gmail.com` on 26 Jun 2014 at 7:39 | 1.0 | libsmpeg0 dependency - ```
Installing Gargoyle in Ubuntu GNOME 14.04 there is need to install manually the
pakage libsmpeg0 because it is not pheraps inserted in the dependency list of
the Debian pakage.
Probably you have to insert libsmpeg0 in the dependency list :)
```
Original issue reported on code.google.com by `valerio....@gmail.com` on 26 Jun 2014 at 7:39 | defect | dependency installing gargoyle in ubuntu gnome there is need to install manually the pakage because it is not pheraps inserted in the dependency list of the debian pakage probably you have to insert in the dependency list original issue reported on code google com by valerio gmail com on jun at | 1 |
49,998 | 13,187,304,798 | IssuesEvent | 2020-08-13 02:59:31 | icecube-trac/tix3 | https://api.github.com/repos/icecube-trac/tix3 | opened | [clsim] 100 char unix socket limitation (Trac #2422) | Incomplete Migration Migrated from Trac combo simulation defect | <details>
<summary><em>Migrated from <a href="https://code.icecube.wisc.edu/ticket/2422">https://code.icecube.wisc.edu/ticket/2422</a>, reported by msilva and owned by jvansanten</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2020-06-24T12:32:17",
"description": "Clsim server uses a ZMQ unix socket to communicate. Unix sockets are limited to roughly 100 characters of absolute path length by the kernel. Some sites are exceeding this length (specifically, UMD).\n\nA workaround is needed for deeper directories. Maybe UDP/TCP on localhost?",
"reporter": "msilva",
"cc": "olivas",
"resolution": "fixed",
"_ts": "1593001937450890",
"component": "combo simulation",
"summary": "[clsim] 100 char unix socket limitation",
"priority": "major",
"keywords": "zmq",
"time": "2020-04-07T19:40:25",
"milestone": "Autumnal Equinox 2020",
"owner": "jvansanten",
"type": "defect"
}
```
</p>
</details>
| 1.0 | [clsim] 100 char unix socket limitation (Trac #2422) - <details>
<summary><em>Migrated from <a href="https://code.icecube.wisc.edu/ticket/2422">https://code.icecube.wisc.edu/ticket/2422</a>, reported by msilva and owned by jvansanten</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2020-06-24T12:32:17",
"description": "Clsim server uses a ZMQ unix socket to communicate. Unix sockets are limited to roughly 100 characters of absolute path length by the kernel. Some sites are exceeding this length (specifically, UMD).\n\nA workaround is needed for deeper directories. Maybe UDP/TCP on localhost?",
"reporter": "msilva",
"cc": "olivas",
"resolution": "fixed",
"_ts": "1593001937450890",
"component": "combo simulation",
"summary": "[clsim] 100 char unix socket limitation",
"priority": "major",
"keywords": "zmq",
"time": "2020-04-07T19:40:25",
"milestone": "Autumnal Equinox 2020",
"owner": "jvansanten",
"type": "defect"
}
```
</p>
</details>
| defect | char unix socket limitation trac migrated from json status closed changetime description clsim server uses a zmq unix socket to communicate unix sockets are limited to roughly characters of absolute path length by the kernel some sites are exceeding this length specifically umd n na workaround is needed for deeper directories maybe udp tcp on localhost reporter msilva cc olivas resolution fixed ts component combo simulation summary char unix socket limitation priority major keywords zmq time milestone autumnal equinox owner jvansanten type defect | 1 |
152,899 | 12,129,142,477 | IssuesEvent | 2020-04-22 21:53:48 | urapadmin/kiosk | https://api.github.com/repos/urapadmin/kiosk | closed | file download does not work any longer | bug file repository test-stage | because the filename is assembled using the old archaeological context. And there is a try / except missing in filerepositorycontroller.download. | 1.0 | file download does not work any longer - because the filename is assembled using the old archaeological context. And there is a try / except missing in filerepositorycontroller.download. | non_defect | file download does not work any longer because the filename is assembled using the old archaeological context and there is a try except missing in filerepositorycontroller download | 0 |
70,583 | 23,246,882,928 | IssuesEvent | 2022-08-03 21:10:06 | hazelcast/hazelcast | https://api.github.com/repos/hazelcast/hazelcast | opened | Can not serialize TreeMap with GenericRecord | Type: Defect | I am using hazelcast 5.1.3 with java 17.
example below not working. I am expected that treeMap with generic record will be printed.
returned object is corrupted after this code in `BufferPoolImpl` when DataInput is cleared
```
@Override
public void returnInputBuffer(BufferObjectDataInput in) {
if (in == null) {
return;
}
in.clear();
tryOffer(inputQueue, in);
}
```
StreamSerializerAdapter with TreeMap is used instead of CompactStreamSerializer
more info: https://stackoverflow.com/questions/73220117/why-hazelcast-can-not-read-data-from-treemap-with-generic-record/73220370
```
public static void main(String[] args) {
Config hzConfig = new Config();
NetworkConfig network = hzConfig.getNetworkConfig();
network.setPortAutoIncrement(false);
network.getInterfaces().setEnabled(true).addInterface("127.0.0.1");
network.getJoin().getMulticastConfig().setEnabled(false);
hzConfig.getUserCodeDeploymentConfig().setEnabled(true);
hzConfig.getSerializationConfig().getCompactSerializationConfig().setEnabled(true);
HazelcastInstance hzInstance = Hazelcast.newHazelcastInstance(hzConfig);
Map<Integer, TreeMap<Long, GenericRecord>> map = hzInstance.getMap(TEST_MAP);
TreeMap<Long, GenericRecord> zmeny = new TreeMap<Long, GenericRecord>();
zmeny.put(1l, GenericRecordBuilder.compact("test").setString("string", "stringvalue").setInt32("integer", 123)
.build());
map.put(1, zmeny);
Map<Integer, TreeMap<Long, GenericRecord>> a = hzInstance.getMap(TEST_MAP);
TreeMap<Long, GenericRecord> qq = a.get(1);
System.out.println(qq);
}
``` | 1.0 | Can not serialize TreeMap with GenericRecord - I am using hazelcast 5.1.3 with java 17.
example below not working. I am expected that treeMap with generic record will be printed.
returned object is corrupted after this code in `BufferPoolImpl` when DataInput is cleared
```
@Override
public void returnInputBuffer(BufferObjectDataInput in) {
if (in == null) {
return;
}
in.clear();
tryOffer(inputQueue, in);
}
```
StreamSerializerAdapter with TreeMap is used instead of CompactStreamSerializer
more info: https://stackoverflow.com/questions/73220117/why-hazelcast-can-not-read-data-from-treemap-with-generic-record/73220370
```
public static void main(String[] args) {
Config hzConfig = new Config();
NetworkConfig network = hzConfig.getNetworkConfig();
network.setPortAutoIncrement(false);
network.getInterfaces().setEnabled(true).addInterface("127.0.0.1");
network.getJoin().getMulticastConfig().setEnabled(false);
hzConfig.getUserCodeDeploymentConfig().setEnabled(true);
hzConfig.getSerializationConfig().getCompactSerializationConfig().setEnabled(true);
HazelcastInstance hzInstance = Hazelcast.newHazelcastInstance(hzConfig);
Map<Integer, TreeMap<Long, GenericRecord>> map = hzInstance.getMap(TEST_MAP);
TreeMap<Long, GenericRecord> zmeny = new TreeMap<Long, GenericRecord>();
zmeny.put(1l, GenericRecordBuilder.compact("test").setString("string", "stringvalue").setInt32("integer", 123)
.build());
map.put(1, zmeny);
Map<Integer, TreeMap<Long, GenericRecord>> a = hzInstance.getMap(TEST_MAP);
TreeMap<Long, GenericRecord> qq = a.get(1);
System.out.println(qq);
}
``` | defect | can not serialize treemap with genericrecord i am using hazelcast with java example below not working i am expected that treemap with generic record will be printed returned object is corrupted after this code in bufferpoolimpl when datainput is cleared override public void returninputbuffer bufferobjectdatainput in if in null return in clear tryoffer inputqueue in streamserializeradapter with treemap is used instead of compactstreamserializer more info public static void main string args config hzconfig new config networkconfig network hzconfig getnetworkconfig network setportautoincrement false network getinterfaces setenabled true addinterface network getjoin getmulticastconfig setenabled false hzconfig getusercodedeploymentconfig setenabled true hzconfig getserializationconfig getcompactserializationconfig setenabled true hazelcastinstance hzinstance hazelcast newhazelcastinstance hzconfig map map hzinstance getmap test map treemap zmeny new treemap zmeny put genericrecordbuilder compact test setstring string stringvalue integer build map put zmeny map a hzinstance getmap test map treemap qq a get system out println qq | 1 |
722,670 | 24,871,105,430 | IssuesEvent | 2022-10-27 15:16:50 | AY2223S1-CS2103T-W16-3/tp | https://api.github.com/repos/AY2223S1-CS2103T-W16-3/tp | closed | Update person view panel when a person card is clicked on | priority.Medium type.Enhancement | Currently the only way to change the person view panel is by calling the view command.
Clicking a person card on the person list panel should also change the person view panel details. | 1.0 | Update person view panel when a person card is clicked on - Currently the only way to change the person view panel is by calling the view command.
Clicking a person card on the person list panel should also change the person view panel details. | non_defect | update person view panel when a person card is clicked on currently the only way to change the person view panel is by calling the view command clicking a person card on the person list panel should also change the person view panel details | 0 |
78,367 | 27,456,022,653 | IssuesEvent | 2023-03-02 21:25:36 | scipy/scipy | https://api.github.com/repos/scipy/scipy | opened | BUG: signal.freqs has undocumented magic numbers resulting in odd behavior | defect | ### Describe your issue.
There are a few magic numbers in the code for the frequency range heuristics. It would be great if there were some explanation behind them. Current values provide non-symmetric plots in the case of symmetric (mirror image) filters. It seems the original goal was to pick about one decade of frequency span from the last pole/zero, but it only works in special cases. The new ones may be better and this might benefit of some more sophistication to make it universal. Also seen in bug #17789.
### Reproducing Code Example
```python
n=4
f=1
#f=3
ftype='butter'
#ftype='ellip'
import numpy
import numpy as np
from numpy import (atleast_1d, poly, polyval, roots, real, asarray,
resize, pi, absolute, logspace, r_, sqrt, tan, log10,
arctan, arcsinh, sin, exp, cosh, arccosh, ceil, conjugate,
zeros, sinh, append, concatenate, prod, ones, full, array,
mintypecode)
from scipy.signal import findfreqs, iirfilter
import matplotlib.pyplot as plt
def findfreqs2(num, den, N, kind='ba'):
if kind == 'ba':
ep = atleast_1d(roots(den)) + 0j
tz = atleast_1d(roots(num)) + 0j
elif kind == 'zp':
ep = atleast_1d(den) + 0j
tz = atleast_1d(num) + 0j
else:
raise ValueError("input must be one of {'ba', 'zp'}")
if len(ep) == 0:
ep = atleast_1d(-1000) + 0j
ez = r_['-1',
numpy.compress(ep.imag >= 0, ep, axis=-1),
numpy.compress((abs(tz) < 1e5) & (tz.imag >= 0), tz, axis=-1)]
integ = abs(ez) < 1e-10
hfreq = numpy.log10(numpy.max(1 * abs(ez.real + integ) +
1 * ez.imag)) + 1
lfreq = numpy.log10(numpy.min(1 * abs(ez.real + integ) +
1 * ez.imag)) - 1
print(lfreq, hfreq)
lfreq = numpy.around(lfreq)
hfreq = numpy.around(hfreq)
w = logspace(lfreq, hfreq, N)
return w
fig, axs = plt.subplots(2,2)
axs[0,0].title.set_text('New magic numbers')
axs[0,1].title.set_text('Old magic numbers')
b, a = iirfilter(n, f, 1, 30, 'lp', analog=True, ftype=ftype, output='ba')
# new findfreqs
w = findfreqs2(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[0,0].semilogx(w, 20 * np.log10(abs(h)))
w = findfreqs(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[0,1].semilogx(w, 20 * np.log10(abs(h)))
b, a = iirfilter(n, f, 1, 30, 'hp', analog=True, ftype=ftype, output='ba')
# new findfreqs
w = findfreqs2(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[1,0].semilogx(w, 20 * np.log10(abs(h)))
w = findfreqs(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[1,1].semilogx(w, 20 * np.log10(abs(h)))
axs[0,0].grid();axs[1,0].grid();axs[0,1].grid();axs[1,1].grid();plt.show()
```
### Error message
```shell
none
```
### SciPy/NumPy/Python version and system information
```shell
1.10.0 1.21.5 sys.version_info(major=3, minor=10, micro=6, releaselevel='final', serial=0)
```
| 1.0 | BUG: signal.freqs has undocumented magic numbers resulting in odd behavior - ### Describe your issue.
There are a few magic numbers in the code for the frequency range heuristics. It would be great if there were some explanation behind them. Current values provide non-symmetric plots in the case of symmetric (mirror image) filters. It seems the original goal was to pick about one decade of frequency span from the last pole/zero, but it only works in special cases. The new ones may be better and this might benefit of some more sophistication to make it universal. Also seen in bug #17789.
### Reproducing Code Example
```python
n=4
f=1
#f=3
ftype='butter'
#ftype='ellip'
import numpy
import numpy as np
from numpy import (atleast_1d, poly, polyval, roots, real, asarray,
resize, pi, absolute, logspace, r_, sqrt, tan, log10,
arctan, arcsinh, sin, exp, cosh, arccosh, ceil, conjugate,
zeros, sinh, append, concatenate, prod, ones, full, array,
mintypecode)
from scipy.signal import findfreqs, iirfilter
import matplotlib.pyplot as plt
def findfreqs2(num, den, N, kind='ba'):
if kind == 'ba':
ep = atleast_1d(roots(den)) + 0j
tz = atleast_1d(roots(num)) + 0j
elif kind == 'zp':
ep = atleast_1d(den) + 0j
tz = atleast_1d(num) + 0j
else:
raise ValueError("input must be one of {'ba', 'zp'}")
if len(ep) == 0:
ep = atleast_1d(-1000) + 0j
ez = r_['-1',
numpy.compress(ep.imag >= 0, ep, axis=-1),
numpy.compress((abs(tz) < 1e5) & (tz.imag >= 0), tz, axis=-1)]
integ = abs(ez) < 1e-10
hfreq = numpy.log10(numpy.max(1 * abs(ez.real + integ) +
1 * ez.imag)) + 1
lfreq = numpy.log10(numpy.min(1 * abs(ez.real + integ) +
1 * ez.imag)) - 1
print(lfreq, hfreq)
lfreq = numpy.around(lfreq)
hfreq = numpy.around(hfreq)
w = logspace(lfreq, hfreq, N)
return w
fig, axs = plt.subplots(2,2)
axs[0,0].title.set_text('New magic numbers')
axs[0,1].title.set_text('Old magic numbers')
b, a = iirfilter(n, f, 1, 30, 'lp', analog=True, ftype=ftype, output='ba')
# new findfreqs
w = findfreqs2(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[0,0].semilogx(w, 20 * np.log10(abs(h)))
w = findfreqs(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[0,1].semilogx(w, 20 * np.log10(abs(h)))
b, a = iirfilter(n, f, 1, 30, 'hp', analog=True, ftype=ftype, output='ba')
# new findfreqs
w = findfreqs2(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[1,0].semilogx(w, 20 * np.log10(abs(h)))
w = findfreqs(b, a, 200)
s = 1j * w
h = polyval(b, s) / polyval(a, s)
axs[1,1].semilogx(w, 20 * np.log10(abs(h)))
axs[0,0].grid();axs[1,0].grid();axs[0,1].grid();axs[1,1].grid();plt.show()
```
### Error message
```shell
none
```
### SciPy/NumPy/Python version and system information
```shell
1.10.0 1.21.5 sys.version_info(major=3, minor=10, micro=6, releaselevel='final', serial=0)
```
| defect | bug signal freqs has undocumented magic numbers resulting in odd behavior describe your issue there are a few magic numbers in the code for the frequency range heuristics it would be great if there were some explanation behind them current values provide non symmetric plots in the case of symmetric mirror image filters it seems the original goal was to pick about one decade of frequency span from the last pole zero but it only works in special cases the new ones may be better and this might benefit of some more sophistication to make it universal also seen in bug reproducing code example python n f f ftype butter ftype ellip import numpy import numpy as np from numpy import atleast poly polyval roots real asarray resize pi absolute logspace r sqrt tan arctan arcsinh sin exp cosh arccosh ceil conjugate zeros sinh append concatenate prod ones full array mintypecode from scipy signal import findfreqs iirfilter import matplotlib pyplot as plt def num den n kind ba if kind ba ep atleast roots den tz atleast roots num elif kind zp ep atleast den tz atleast num else raise valueerror input must be one of ba zp if len ep ep atleast ez r numpy compress ep imag ep axis numpy compress abs tz tz axis integ abs ez hfreq numpy numpy max abs ez real integ ez imag lfreq numpy numpy min abs ez real integ ez imag print lfreq hfreq lfreq numpy around lfreq hfreq numpy around hfreq w logspace lfreq hfreq n return w fig axs plt subplots axs title set text new magic numbers axs title set text old magic numbers b a iirfilter n f lp analog true ftype ftype output ba new findfreqs w b a s w h polyval b s polyval a s axs semilogx w np abs h w findfreqs b a s w h polyval b s polyval a s axs semilogx w np abs h b a iirfilter n f hp analog true ftype ftype output ba new findfreqs w b a s w h polyval b s polyval a s axs semilogx w np abs h w findfreqs b a s w h polyval b s polyval a s axs semilogx w np abs h axs grid axs grid axs grid axs grid plt show error message shell none scipy numpy python version and system information shell sys version info major minor micro releaselevel final serial | 1 |
114,442 | 11,847,743,305 | IssuesEvent | 2020-03-24 12:36:36 | dlopez079/lopezdavidv1 | https://api.github.com/repos/dlopez079/lopezdavidv1 | closed | Create Authentication and front Scaffolding with Vue | documentation | Using View, create front end scaffolding and authentication. | 1.0 | Create Authentication and front Scaffolding with Vue - Using View, create front end scaffolding and authentication. | non_defect | create authentication and front scaffolding with vue using view create front end scaffolding and authentication | 0 |
74,254 | 25,028,391,524 | IssuesEvent | 2022-11-04 10:08:31 | vector-im/element-call | https://api.github.com/repos/vector-im/element-call | opened | Missing audio/video for at least one particiapnt. | T-Defect | ### Steps to reproduce
1. Start a call with 4 participants.
2. Participants were using a mix of Firefox and Chrome.
3. User video streams were fairly reliable for me (`@ivory-sure-guineafowl:call.ems.host`), but not for other users. However, we all couldn't hear some participants some of the time.
### Debug logs
https://github.com/matrix-org/matrix-video-chat-rageshakes/issues/1471
https://github.com/matrix-org/matrix-video-chat-rageshakes/issues/1474
### Outcome
#### What did you expect?
Everyone can hear and see everyone.
#### What happened instead?
- Some participants reported that one participant had no video/audio.
- Other participants could see the one participant had video but no audio.
### Operating system
Arch Linux
### Browser information
Firefox 106
### URL for webapp
call.element.io
### Will you send logs?
Yes | 1.0 | Missing audio/video for at least one particiapnt. - ### Steps to reproduce
1. Start a call with 4 participants.
2. Participants were using a mix of Firefox and Chrome.
3. User video streams were fairly reliable for me (`@ivory-sure-guineafowl:call.ems.host`), but not for other users. However, we all couldn't hear some participants some of the time.
### Debug logs
https://github.com/matrix-org/matrix-video-chat-rageshakes/issues/1471
https://github.com/matrix-org/matrix-video-chat-rageshakes/issues/1474
### Outcome
#### What did you expect?
Everyone can hear and see everyone.
#### What happened instead?
- Some participants reported that one participant had no video/audio.
- Other participants could see the one participant had video but no audio.
### Operating system
Arch Linux
### Browser information
Firefox 106
### URL for webapp
call.element.io
### Will you send logs?
Yes | defect | missing audio video for at least one particiapnt steps to reproduce start a call with participants participants were using a mix of firefox and chrome user video streams were fairly reliable for me ivory sure guineafowl call ems host but not for other users however we all couldn t hear some participants some of the time debug logs outcome what did you expect everyone can hear and see everyone what happened instead some participants reported that one participant had no video audio other participants could see the one participant had video but no audio operating system arch linux browser information firefox url for webapp call element io will you send logs yes | 1 |
59,058 | 17,015,339,689 | IssuesEvent | 2021-07-02 11:10:56 | tomhughes/trac-tickets | https://api.github.com/repos/tomhughes/trac-tickets | opened | Hard to select way with many nodes | Component: potlatch2 Priority: trivial Type: defect | **[Submitted to the original trac issue database at 6.54am, Monday, 17th January 2011]**
If there are a lot of nodes on a way, it's hard or impossible to select because you end up dragging nodes instead of ways.
One use case where this is a problem is aligning a roundabout with background imagery. To select the way, you may have to zoom in...but if there's no imagery at that level...
Can we repurpose the Alt key to mean "don't select nodes" in unselected mode, and "don't try and form junctions" when drawing ways? | 1.0 | Hard to select way with many nodes - **[Submitted to the original trac issue database at 6.54am, Monday, 17th January 2011]**
If there are a lot of nodes on a way, it's hard or impossible to select because you end up dragging nodes instead of ways.
One use case where this is a problem is aligning a roundabout with background imagery. To select the way, you may have to zoom in...but if there's no imagery at that level...
Can we repurpose the Alt key to mean "don't select nodes" in unselected mode, and "don't try and form junctions" when drawing ways? | defect | hard to select way with many nodes if there are a lot of nodes on a way it s hard or impossible to select because you end up dragging nodes instead of ways one use case where this is a problem is aligning a roundabout with background imagery to select the way you may have to zoom in but if there s no imagery at that level can we repurpose the alt key to mean don t select nodes in unselected mode and don t try and form junctions when drawing ways | 1 |
50,476 | 13,187,519,689 | IssuesEvent | 2020-08-13 03:40:41 | icecube-trac/tix3 | https://api.github.com/repos/icecube-trac/tix3 | closed | [examples] scripts should run and build docs properly (Trac #776) | Migrated from Trac defect other | Many of the python modules and scripts in examples/ rely on imports from the long attic'd utils/ project. This breaks scripts, modules, and doc generation. #516 was related this.
doc generation is disabled in r1947/IceTray
<details>
<summary><em>Migrated from https://code.icecube.wisc.edu/ticket/776
, reported by nega and owned by olivas</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2015-03-11T13:57:15",
"description": "Many of the python modules and scripts in examples/ rely on imports from the long attic'd utils/ project. This breaks scripts, modules, and doc generation. #517 was related this.\n\ndoc generation is disabled in r1947/IceTray",
"reporter": "nega",
"cc": "olivas",
"resolution": "wontfix",
"_ts": "1426082235272119",
"component": "other",
"summary": "[examples] scripts should run and build docs properly",
"priority": "normal",
"keywords": "documentation",
"time": "2014-10-08T21:45:17",
"milestone": "",
"owner": "olivas",
"type": "defect"
}
```
</p>
</details>
| 1.0 | [examples] scripts should run and build docs properly (Trac #776) - Many of the python modules and scripts in examples/ rely on imports from the long attic'd utils/ project. This breaks scripts, modules, and doc generation. #516 was related this.
doc generation is disabled in r1947/IceTray
<details>
<summary><em>Migrated from https://code.icecube.wisc.edu/ticket/776
, reported by nega and owned by olivas</em></summary>
<p>
```json
{
"status": "closed",
"changetime": "2015-03-11T13:57:15",
"description": "Many of the python modules and scripts in examples/ rely on imports from the long attic'd utils/ project. This breaks scripts, modules, and doc generation. #517 was related this.\n\ndoc generation is disabled in r1947/IceTray",
"reporter": "nega",
"cc": "olivas",
"resolution": "wontfix",
"_ts": "1426082235272119",
"component": "other",
"summary": "[examples] scripts should run and build docs properly",
"priority": "normal",
"keywords": "documentation",
"time": "2014-10-08T21:45:17",
"milestone": "",
"owner": "olivas",
"type": "defect"
}
```
</p>
</details>
| defect | scripts should run and build docs properly trac many of the python modules and scripts in examples rely on imports from the long attic d utils project this breaks scripts modules and doc generation was related this doc generation is disabled in icetray migrated from reported by nega and owned by olivas json status closed changetime description many of the python modules and scripts in examples rely on imports from the long attic d utils project this breaks scripts modules and doc generation was related this n ndoc generation is disabled in icetray reporter nega cc olivas resolution wontfix ts component other summary scripts should run and build docs properly priority normal keywords documentation time milestone owner olivas type defect | 1 |
14,114 | 2,789,911,880 | IssuesEvent | 2015-05-08 22:22:00 | google/google-visualization-api-issues | https://api.github.com/repos/google/google-visualization-api-issues | closed | "Invalid argument" error on IE while rendering a column chart | Priority-Medium Type-Defect | Original [issue 498](https://code.google.com/p/google-visualization-api-issues/issues/detail?id=498) created by orwant on 2011-01-20T08:03:15.000Z:
This is similar to issue 373, but doesn't seem to have been solved:
<b>What steps will reproduce the problem? Please provide a link to a</b>
<b>demonstration page if at all possible, or attach code.</b>
1. Create a column chart with at least 2 columns:
http://code.google.com/apis/visualization/documentation/gallery/columnchart.html
2. Give the first column a large value - e.g. 100, and the 2nd a very small value - e.g. 0.001. For example:
data.setValue(0, 0, '2004');
data.setValue(0, 1, 100);
data.setValue(1, 0, '2005');
data.setValue(1, 1, 0.1);
(see complete code attached)
3. The chart does renders fine on Chrome or Firefox, but does not render on IE, instead showing the error "Invalid Argument"
What component is this issue related to (PieChart, LineChart, DataTable, Query, etc)? Column Chart
<b>Are you using the test environment (version 1.1)?</b>
(If you are not sure, answer NO) NO
<b>What operating system and browser are you using?</b>
Windows/IE
<b>*********************************************************</b>
<b>For developers viewing this issue: please click the 'star' icon to be</b>
<b>notified of future changes, and to let us know how many of you are</b>
<b>interested in seeing it resolved.</b>
<b>*********************************************************</b>
| 1.0 | "Invalid argument" error on IE while rendering a column chart - Original [issue 498](https://code.google.com/p/google-visualization-api-issues/issues/detail?id=498) created by orwant on 2011-01-20T08:03:15.000Z:
This is similar to issue 373, but doesn't seem to have been solved:
<b>What steps will reproduce the problem? Please provide a link to a</b>
<b>demonstration page if at all possible, or attach code.</b>
1. Create a column chart with at least 2 columns:
http://code.google.com/apis/visualization/documentation/gallery/columnchart.html
2. Give the first column a large value - e.g. 100, and the 2nd a very small value - e.g. 0.001. For example:
data.setValue(0, 0, '2004');
data.setValue(0, 1, 100);
data.setValue(1, 0, '2005');
data.setValue(1, 1, 0.1);
(see complete code attached)
3. The chart does renders fine on Chrome or Firefox, but does not render on IE, instead showing the error "Invalid Argument"
What component is this issue related to (PieChart, LineChart, DataTable, Query, etc)? Column Chart
<b>Are you using the test environment (version 1.1)?</b>
(If you are not sure, answer NO) NO
<b>What operating system and browser are you using?</b>
Windows/IE
<b>*********************************************************</b>
<b>For developers viewing this issue: please click the 'star' icon to be</b>
<b>notified of future changes, and to let us know how many of you are</b>
<b>interested in seeing it resolved.</b>
<b>*********************************************************</b>
| defect | invalid argument error on ie while rendering a column chart original created by orwant on this is similar to issue but doesn t seem to have been solved what steps will reproduce the problem please provide a link to a demonstration page if at all possible or attach code create a column chart with at least columns give the first column a large value e g and the a very small value e g for example data setvalue data setvalue data setvalue data setvalue see complete code attached the chart does renders fine on chrome or firefox but does not render on ie instead showing the error quot invalid argument quot what component is this issue related to piechart linechart datatable query etc column chart are you using the test environment version if you are not sure answer no no what operating system and browser are you using windows ie for developers viewing this issue please click the star icon to be notified of future changes and to let us know how many of you are interested in seeing it resolved | 1 |
37,065 | 8,221,538,642 | IssuesEvent | 2018-09-06 02:32:13 | davidhabib/Auctions-for-Salesforce | https://api.github.com/repos/davidhabib/Auctions-for-Salesforce | opened | New Ticket Wizard should not require Contact for Organization tickets | Defect | hub thread:
https://powerofus.force.com/0D58000004U6tRr
Looks like when I reworked the ticket code to work with NPSP 3.0, in Dec 2017, it began to assume it always had a Contact. Previously, A4S did allow organization tickets to be purchased without a Contact.
| 1.0 | New Ticket Wizard should not require Contact for Organization tickets - hub thread:
https://powerofus.force.com/0D58000004U6tRr
Looks like when I reworked the ticket code to work with NPSP 3.0, in Dec 2017, it began to assume it always had a Contact. Previously, A4S did allow organization tickets to be purchased without a Contact.
| defect | new ticket wizard should not require contact for organization tickets hub thread looks like when i reworked the ticket code to work with npsp in dec it began to assume it always had a contact previously did allow organization tickets to be purchased without a contact | 1 |
20,198 | 3,314,716,430 | IssuesEvent | 2015-11-06 07:37:00 | OpenMS/OpenMS | https://api.github.com/repos/OpenMS/OpenMS | closed | Peaks shown as single pixels - nothing to see [315] | 1.9 defect major TOPPView | Submitted by hendrikweisser on 2011-07-13 23:22:29
Displaying LC-MS maps in TOPPView, it seems that the size of individual peaks depends on the screen size/resolution. This leads to the following problem on big monitors: When zooming in, peaks are shown as single pixels for much too long. This means that at medium zoom levels, practically nothing can be seen (making the viewer quite useless).
This happens for me with OpenMS 1.8 on Ubuntu 11.04, and for a colleague with OpenMS 1.9 (devel) on Ubuntu 10.10.
-------------------------------------------------
Commented by timosachsenberg on 2011-07-20 17:02:26:
On the attached image it seems to show the correct behavior:
- only switch from drawing pixels to drawing (larger) circles if the expected distance between scans and between peaks is larger than one pixel (based on a few analyzed spectra for performance reasons).
So that's actually not a bug (and probably doesn't make the viewer useless) but could be improved by calculating an interpolated background color map - similar to the images created by the ImageCreator tool.
-------------------------------------------------
Commented by hendrikweisser on 2011-07-20 18:44:55:
It may work the way you intended, but if the end result is that I can hardly see things in a viewer, that's bad - especially if this problem did not occur in earlier releases. (Of course TOPPView is not generally useless, but in this specific situation, it pretty much is.)
I don't want to argue about whether this should be considered a bug - my point is that something needs to be done about it. Adapt the way peak size is calculated (to make the peaks bigger earlier), give users the option to set peak size explicitly (like for features), or whatever.
I think that it's better to draw points/circles that overlap (as long as you are zoomed in and the total number of points to draw is relatively small) if that improves overall visibility.
-------------------------------------------------
Commented by aiche on 2012-03-30 13:34:34:
As it was again reported on the mailing list I made it again a defect. If people complain about that they cannot see there data it is definitely a bug and should be fixed as soon as possible. Maybe it would be a good starting point to give the user the possibility to choose the drawing mode, so he can switch between the old and the new behavior depending on what fits best for his data.
-------------------------------------------------
Commented by timosachsenberg on 2012-10-14 13:10:18:
That's actually a very bad idea and you can try this easily on your installation. Drawing will then take up to several minutes and render TOPPVIew useless.
Also sorting of intensities is very important in the case of overlapping peaks especially if MS1 profile data is used otherwise you even won't see the apex as I saw in some of my experiments.
A possible easier idea to try would be to collect the e.g. top 10000 intensive peaks of the visible area during drawing and then draw them sorted by intensity with cirecles/boxes of increased size (maybe even size based on the log intensity). This should be reasonable fast and look nicer but won't work easily if the transition from the drawMaximumIntensity draw mode to the drawAllIntensities draw mode has not yet been made.
I hope I find time to implement this before 1.10 but please feel free to try this on your own.
-------------------------------------------------
Commented by hendrikweisser on 2012-11-23 01:46:15:
I'm currently trying to use TOPPView for some figures for my thesis, and it's seriously annoying. It's just impossible to use the 2D view with high-resolution profile data at medium zoom levels.
I think we shouldn't release 1.10 before this is fixed.
-------------------------------------------------
Commented by hendrikweisser on 2012-11-23 16:38:32:
Timo: I won't have time to fix this, so it's no use assigning it to me. Honestly, it's been broken since you "fixed" the drawing of the points, so I still think it's your bug.
I'm not saying "shame on you for not fixing it" - I know you're busy, too. But I think fixing this should have a higher priority - I think it's currently the most severe bug in OpenMS. I don't understand why you downgraded it to "major" - it's been "critical" for a long time now, and in my opinion it should rather be a "blocker".
| 1.0 | Peaks shown as single pixels - nothing to see [315] - Submitted by hendrikweisser on 2011-07-13 23:22:29
Displaying LC-MS maps in TOPPView, it seems that the size of individual peaks depends on the screen size/resolution. This leads to the following problem on big monitors: When zooming in, peaks are shown as single pixels for much too long. This means that at medium zoom levels, practically nothing can be seen (making the viewer quite useless).
This happens for me with OpenMS 1.8 on Ubuntu 11.04, and for a colleague with OpenMS 1.9 (devel) on Ubuntu 10.10.
-------------------------------------------------
Commented by timosachsenberg on 2011-07-20 17:02:26:
On the attached image it seems to show the correct behavior:
- only switch from drawing pixels to drawing (larger) circles if the expected distance between scans and between peaks is larger than one pixel (based on a few analyzed spectra for performance reasons).
So that's actually not a bug (and probably doesn't make the viewer useless) but could be improved by calculating an interpolated background color map - similar to the images created by the ImageCreator tool.
-------------------------------------------------
Commented by hendrikweisser on 2011-07-20 18:44:55:
It may work the way you intended, but if the end result is that I can hardly see things in a viewer, that's bad - especially if this problem did not occur in earlier releases. (Of course TOPPView is not generally useless, but in this specific situation, it pretty much is.)
I don't want to argue about whether this should be considered a bug - my point is that something needs to be done about it. Adapt the way peak size is calculated (to make the peaks bigger earlier), give users the option to set peak size explicitly (like for features), or whatever.
I think that it's better to draw points/circles that overlap (as long as you are zoomed in and the total number of points to draw is relatively small) if that improves overall visibility.
-------------------------------------------------
Commented by aiche on 2012-03-30 13:34:34:
As it was again reported on the mailing list I made it again a defect. If people complain about that they cannot see there data it is definitely a bug and should be fixed as soon as possible. Maybe it would be a good starting point to give the user the possibility to choose the drawing mode, so he can switch between the old and the new behavior depending on what fits best for his data.
-------------------------------------------------
Commented by timosachsenberg on 2012-10-14 13:10:18:
That's actually a very bad idea and you can try this easily on your installation. Drawing will then take up to several minutes and render TOPPVIew useless.
Also sorting of intensities is very important in the case of overlapping peaks especially if MS1 profile data is used otherwise you even won't see the apex as I saw in some of my experiments.
A possible easier idea to try would be to collect the e.g. top 10000 intensive peaks of the visible area during drawing and then draw them sorted by intensity with cirecles/boxes of increased size (maybe even size based on the log intensity). This should be reasonable fast and look nicer but won't work easily if the transition from the drawMaximumIntensity draw mode to the drawAllIntensities draw mode has not yet been made.
I hope I find time to implement this before 1.10 but please feel free to try this on your own.
-------------------------------------------------
Commented by hendrikweisser on 2012-11-23 01:46:15:
I'm currently trying to use TOPPView for some figures for my thesis, and it's seriously annoying. It's just impossible to use the 2D view with high-resolution profile data at medium zoom levels.
I think we shouldn't release 1.10 before this is fixed.
-------------------------------------------------
Commented by hendrikweisser on 2012-11-23 16:38:32:
Timo: I won't have time to fix this, so it's no use assigning it to me. Honestly, it's been broken since you "fixed" the drawing of the points, so I still think it's your bug.
I'm not saying "shame on you for not fixing it" - I know you're busy, too. But I think fixing this should have a higher priority - I think it's currently the most severe bug in OpenMS. I don't understand why you downgraded it to "major" - it's been "critical" for a long time now, and in my opinion it should rather be a "blocker".
| defect | peaks shown as single pixels nothing to see submitted by hendrikweisser on displaying lc ms maps in toppview it seems that the size of individual peaks depends on the screen size resolution this leads to the following problem on big monitors when zooming in peaks are shown as single pixels for much too long this means that at medium zoom levels practically nothing can be seen making the viewer quite useless this happens for me with openms on ubuntu and for a colleague with openms devel on ubuntu commented by timosachsenberg on on the attached image it seems to show the correct behavior only switch from drawing pixels to drawing larger circles if the expected distance between scans and between peaks is larger than one pixel based on a few analyzed spectra for performance reasons so that s actually not a bug and probably doesn t make the viewer useless but could be improved by calculating an interpolated background color map similar to the images created by the imagecreator tool commented by hendrikweisser on it may work the way you intended but if the end result is that i can hardly see things in a viewer that s bad especially if this problem did not occur in earlier releases of course toppview is not generally useless but in this specific situation it pretty much is i don t want to argue about whether this should be considered a bug my point is that something needs to be done about it adapt the way peak size is calculated to make the peaks bigger earlier give users the option to set peak size explicitly like for features or whatever i think that it s better to draw points circles that overlap as long as you are zoomed in and the total number of points to draw is relatively small if that improves overall visibility commented by aiche on as it was again reported on the mailing list i made it again a defect if people complain about that they cannot see there data it is definitely a bug and should be fixed as soon as possible maybe it would be a good starting point to give the user the possibility to choose the drawing mode so he can switch between the old and the new behavior depending on what fits best for his data commented by timosachsenberg on that s actually a very bad idea and you can try this easily on your installation drawing will then take up to several minutes and render toppview useless also sorting of intensities is very important in the case of overlapping peaks especially if profile data is used otherwise you even won t see the apex as i saw in some of my experiments a possible easier idea to try would be to collect the e g top intensive peaks of the visible area during drawing and then draw them sorted by intensity with cirecles boxes of increased size maybe even size based on the log intensity this should be reasonable fast and look nicer but won t work easily if the transition from the drawmaximumintensity draw mode to the drawallintensities draw mode has not yet been made i hope i find time to implement this before but please feel free to try this on your own commented by hendrikweisser on i m currently trying to use toppview for some figures for my thesis and it s seriously annoying it s just impossible to use the view with high resolution profile data at medium zoom levels i think we shouldn t release before this is fixed commented by hendrikweisser on timo i won t have time to fix this so it s no use assigning it to me honestly it s been broken since you fixed the drawing of the points so i still think it s your bug i m not saying shame on you for not fixing it i know you re busy too but i think fixing this should have a higher priority i think it s currently the most severe bug in openms i don t understand why you downgraded it to major it s been critical for a long time now and in my opinion it should rather be a blocker | 1 |
160,170 | 13,783,045,547 | IssuesEvent | 2020-10-08 18:35:02 | FirebaseExtended/flutterfire | https://api.github.com/repos/FirebaseExtended/flutterfire | opened | [📚] Please provide a complete Streambuilder based example for auth based apps | good first issue type: documentation | Hello,
Looking at the auth docs they stop short of providing a complete Flutter Material app based example, with a Scaffold and a Streambuilder.
Can this please be provided?
https://firebase.flutter.dev/docs/auth/usage
| 1.0 | [📚] Please provide a complete Streambuilder based example for auth based apps - Hello,
Looking at the auth docs they stop short of providing a complete Flutter Material app based example, with a Scaffold and a Streambuilder.
Can this please be provided?
https://firebase.flutter.dev/docs/auth/usage
| non_defect | please provide a complete streambuilder based example for auth based apps hello looking at the auth docs they stop short of providing a complete flutter material app based example with a scaffold and a streambuilder can this please be provided | 0 |
54,939 | 3,071,637,987 | IssuesEvent | 2015-08-19 13:19:07 | Maslor/wfmgr | https://api.github.com/repos/Maslor/wfmgr | closed | can't delete tasks | enhancement high priority UI | tasks are being created with no problems. Yet, there is no "remove task" button. | 1.0 | can't delete tasks - tasks are being created with no problems. Yet, there is no "remove task" button. | non_defect | can t delete tasks tasks are being created with no problems yet there is no remove task button | 0 |
572 | 2,572,202,967 | IssuesEvent | 2015-02-10 21:04:07 | paparazzi/paparazzi | https://api.github.com/repos/paparazzi/paparazzi | closed | Problem with waypoint altitude | Not a defect | I am testing the autoland using MentorEnergy AC.
the AF has alt=30 but when geo_init run it set to -155m when the correct is ground altitude + 30 (215m)
The same occur with TD. After geoinit it get -185 when the correct is ground altitude + 0 (185m)
i think someone changed a signal in the code becahuse some time ago it worked fine | 1.0 | Problem with waypoint altitude - I am testing the autoland using MentorEnergy AC.
the AF has alt=30 but when geo_init run it set to -155m when the correct is ground altitude + 30 (215m)
The same occur with TD. After geoinit it get -185 when the correct is ground altitude + 0 (185m)
i think someone changed a signal in the code becahuse some time ago it worked fine | defect | problem with waypoint altitude i am testing the autoland using mentorenergy ac the af has alt but when geo init run it set to when the correct is ground altitude the same occur with td after geoinit it get when the correct is ground altitude i think someone changed a signal in the code becahuse some time ago it worked fine | 1 |
111,935 | 14,173,095,972 | IssuesEvent | 2020-11-12 17:50:39 | hydroshare/hydroshare | https://api.github.com/repos/hydroshare/hydroshare | closed | Look at portal.lternet.edu for ideas on improving resource landing page | Resource Model design phase needed low priority | Based on review of HydroShare with Rick Hooper he noted a number of places where retrieving information from HydroShare resources and their landing pages was unclear, and possibly better done at portal.lternet.edu
- There is a metadata link that expands the metadata. This seemed more user friendly than our resourcemetadata.xml retrieved as part of the bag with no easy visualization tools.
- There is Matlab, R, SAS and SPSS code for analyzing the data. I just tested one R script and it is slick in that it includes data download. This could be a nice enhancement to our multidimensional, raster, time series and referenced time series resources, drawing on the new WaterML R functionality.
| 1.0 | Look at portal.lternet.edu for ideas on improving resource landing page - Based on review of HydroShare with Rick Hooper he noted a number of places where retrieving information from HydroShare resources and their landing pages was unclear, and possibly better done at portal.lternet.edu
- There is a metadata link that expands the metadata. This seemed more user friendly than our resourcemetadata.xml retrieved as part of the bag with no easy visualization tools.
- There is Matlab, R, SAS and SPSS code for analyzing the data. I just tested one R script and it is slick in that it includes data download. This could be a nice enhancement to our multidimensional, raster, time series and referenced time series resources, drawing on the new WaterML R functionality.
| non_defect | look at portal lternet edu for ideas on improving resource landing page based on review of hydroshare with rick hooper he noted a number of places where retrieving information from hydroshare resources and their landing pages was unclear and possibly better done at portal lternet edu there is a metadata link that expands the metadata this seemed more user friendly than our resourcemetadata xml retrieved as part of the bag with no easy visualization tools there is matlab r sas and spss code for analyzing the data i just tested one r script and it is slick in that it includes data download this could be a nice enhancement to our multidimensional raster time series and referenced time series resources drawing on the new waterml r functionality | 0 |
2,458 | 2,607,903,630 | IssuesEvent | 2015-02-26 00:14:39 | chrsmithdemos/zen-coding | https://api.github.com/repos/chrsmithdemos/zen-coding | closed | Notepad++ AppData plugin install Javascript error | auto-migrated Priority-Medium Type-Defect | ```
What steps will reproduce the problem?
1. Instead of installing it to %programfiles%\Notepad++\Plugins; install to
%appdata%\Notepad++\Plugins
2. Start notepad++
3. get this error:
---------------------------
Microsoft JScript runtime error
---------------------------
Path not found
---------------------------
OK
---------------------------
This problem is probably just that it's running in a different dir than it
expects to. It would probably be an easy fix, but the least that should be
done is mention that it should only be installed to the install dir in the
documentation (readme.txt in the zip).
Zen Coding for Notepad++ v0.6.1; Windows 7 64-bit; Notepad++ v5.6.8
```
-----
Original issue reported on code.google.com by `infogu...@gmail.com` on 1 May 2010 at 7:17 | 1.0 | Notepad++ AppData plugin install Javascript error - ```
What steps will reproduce the problem?
1. Instead of installing it to %programfiles%\Notepad++\Plugins; install to
%appdata%\Notepad++\Plugins
2. Start notepad++
3. get this error:
---------------------------
Microsoft JScript runtime error
---------------------------
Path not found
---------------------------
OK
---------------------------
This problem is probably just that it's running in a different dir than it
expects to. It would probably be an easy fix, but the least that should be
done is mention that it should only be installed to the install dir in the
documentation (readme.txt in the zip).
Zen Coding for Notepad++ v0.6.1; Windows 7 64-bit; Notepad++ v5.6.8
```
-----
Original issue reported on code.google.com by `infogu...@gmail.com` on 1 May 2010 at 7:17 | defect | notepad appdata plugin install javascript error what steps will reproduce the problem instead of installing it to programfiles notepad plugins install to appdata notepad plugins start notepad get this error microsoft jscript runtime error path not found ok this problem is probably just that it s running in a different dir than it expects to it would probably be an easy fix but the least that should be done is mention that it should only be installed to the install dir in the documentation readme txt in the zip zen coding for notepad windows bit notepad original issue reported on code google com by infogu gmail com on may at | 1 |
224,412 | 24,772,981,395 | IssuesEvent | 2022-10-23 11:32:04 | sast-automation-dev/openidm-community-edition-41 | https://api.github.com/repos/sast-automation-dev/openidm-community-edition-41 | opened | activiti-engine-5.10.jar: 3 vulnerabilities (highest severity is: 8.1) | security vulnerability | <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>activiti-engine-5.10.jar</b></p></summary>
<p></p>
<p>Path to dependency file: /openidm-workflow-activiti/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar,/home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar</p>
<p>
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p></details>
## Vulnerabilities
| CVE | Severity | <img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS | Dependency | Type | Fixed in (activiti-engine version) | Remediation Available |
| ------------- | ------------- | ----- | ----- | ----- | ------------- | --- |
| [CVE-2020-26945](https://www.mend.io/vulnerability-database/CVE-2020-26945) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | mybatis-3.1.1.jar | Transitive | 5.14 | ✅ |
| [CVE-2017-9801](https://www.mend.io/vulnerability-database/CVE-2017-9801) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | commons-email-1.2.jar | Transitive | 5.14 | ✅ |
| [CVE-2018-1294](https://www.mend.io/vulnerability-database/CVE-2018-1294) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | commons-email-1.2.jar | Transitive | 5.14 | ✅ |
## Details
<details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-26945</summary>
### Vulnerable Library - <b>mybatis-3.1.1.jar</b></p>
<p>The MyBatis data mapper framework makes it easier to use a relational database with object-oriented
applications. MyBatis couples objects with stored procedures or SQL statements using a XML descriptor or
annotations. Simplicity is the biggest advantage of the MyBatis data mapper over object relational mapping
tools.</p>
<p>Library home page: <a href="http://www.mybatis.org/core/">http://www.mybatis.org/core/</a></p>
<p>Path to dependency file: /openidm-workflow-remote/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/mybatis/mybatis/3.1.1/mybatis-3.1.1.jar,/home/wss-scanner/.m2/repository/org/mybatis/mybatis/3.1.1/mybatis-3.1.1.jar</p>
<p>
Dependency Hierarchy:
- activiti-engine-5.10.jar (Root Library)
- :x: **mybatis-3.1.1.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
MyBatis before 3.5.6 mishandles deserialization of object streams.
<p>Publish Date: Oct 10, 2020 8:15:00 PM
<p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2020-26945>CVE-2020-26945</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.1</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: High
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: Oct 26, 2020 3:17:00 PM</p>
<p>Fix Resolution (org.mybatis:mybatis): 3.5.6</p>
<p>Direct dependency fix Resolution (org.activiti:activiti-engine): 5.14</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2017-9801</summary>
### Vulnerable Library - <b>commons-email-1.2.jar</b></p>
<p>Commons-Email aims to provide an API for sending email. It is built on top of
the JavaMail API, which it aims to simplify.</p>
<p>Library home page: <a href="http://commons.apache.org/email/">http://commons.apache.org/email/</a></p>
<p>Path to dependency file: /openidm-workflow-activiti/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar,/home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar</p>
<p>
Dependency Hierarchy:
- activiti-engine-5.10.jar (Root Library)
- :x: **commons-email-1.2.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
When a call-site passes a subject for an email that contains line-breaks in Apache Commons Email 1.0 through 1.4, the caller can add arbitrary SMTP headers.
<p>Publish Date: Aug 7, 2017 3:29:01 PM
<p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2017-9801>CVE-2017-9801</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>7.5</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: None
- Integrity Impact: High
- Availability Impact: None
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2017-9801">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2017-9801</a></p>
<p>Release Date: Aug 7, 2017 3:29:01 PM</p>
<p>Fix Resolution (org.apache.commons:commons-email): 1.5</p>
<p>Direct dependency fix Resolution (org.activiti:activiti-engine): 5.14</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2018-1294</summary>
### Vulnerable Library - <b>commons-email-1.2.jar</b></p>
<p>Commons-Email aims to provide an API for sending email. It is built on top of
the JavaMail API, which it aims to simplify.</p>
<p>Library home page: <a href="http://commons.apache.org/email/">http://commons.apache.org/email/</a></p>
<p>Path to dependency file: /openidm-workflow-activiti/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar,/home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar</p>
<p>
Dependency Hierarchy:
- activiti-engine-5.10.jar (Root Library)
- :x: **commons-email-1.2.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
If a user of Apache Commons Email (typically an application programmer) passes unvalidated input as the so-called "Bounce Address", and that input contains line-breaks, then the email details (recipients, contents, etc.) might be manipulated. Mitigation: Users should upgrade to Commons-Email 1.5. You can mitigate this vulnerability for older versions of Commons Email by stripping line-breaks from data, that will be passed to Email.setBounceAddress(String).
<p>Publish Date: Mar 20, 2018 5:29:00 PM
<p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2018-1294>CVE-2018-1294</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>7.5</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: None
- Integrity Impact: High
- Availability Impact: None
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2018-1294">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2018-1294</a></p>
<p>Release Date: Mar 20, 2018 5:29:00 PM</p>
<p>Fix Resolution (org.apache.commons:commons-email): 1.5</p>
<p>Direct dependency fix Resolution (org.activiti:activiti-engine): 5.14</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details>
***
<p>:rescue_worker_helmet: Automatic Remediation is available for this issue.</p> | True | activiti-engine-5.10.jar: 3 vulnerabilities (highest severity is: 8.1) - <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>activiti-engine-5.10.jar</b></p></summary>
<p></p>
<p>Path to dependency file: /openidm-workflow-activiti/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar,/home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar</p>
<p>
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p></details>
## Vulnerabilities
| CVE | Severity | <img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS | Dependency | Type | Fixed in (activiti-engine version) | Remediation Available |
| ------------- | ------------- | ----- | ----- | ----- | ------------- | --- |
| [CVE-2020-26945](https://www.mend.io/vulnerability-database/CVE-2020-26945) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 8.1 | mybatis-3.1.1.jar | Transitive | 5.14 | ✅ |
| [CVE-2017-9801](https://www.mend.io/vulnerability-database/CVE-2017-9801) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | commons-email-1.2.jar | Transitive | 5.14 | ✅ |
| [CVE-2018-1294](https://www.mend.io/vulnerability-database/CVE-2018-1294) | <img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> High | 7.5 | commons-email-1.2.jar | Transitive | 5.14 | ✅ |
## Details
<details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2020-26945</summary>
### Vulnerable Library - <b>mybatis-3.1.1.jar</b></p>
<p>The MyBatis data mapper framework makes it easier to use a relational database with object-oriented
applications. MyBatis couples objects with stored procedures or SQL statements using a XML descriptor or
annotations. Simplicity is the biggest advantage of the MyBatis data mapper over object relational mapping
tools.</p>
<p>Library home page: <a href="http://www.mybatis.org/core/">http://www.mybatis.org/core/</a></p>
<p>Path to dependency file: /openidm-workflow-remote/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/mybatis/mybatis/3.1.1/mybatis-3.1.1.jar,/home/wss-scanner/.m2/repository/org/mybatis/mybatis/3.1.1/mybatis-3.1.1.jar</p>
<p>
Dependency Hierarchy:
- activiti-engine-5.10.jar (Root Library)
- :x: **mybatis-3.1.1.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
MyBatis before 3.5.6 mishandles deserialization of object streams.
<p>Publish Date: Oct 10, 2020 8:15:00 PM
<p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2020-26945>CVE-2020-26945</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>8.1</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: High
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: High
- Integrity Impact: High
- Availability Impact: High
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Release Date: Oct 26, 2020 3:17:00 PM</p>
<p>Fix Resolution (org.mybatis:mybatis): 3.5.6</p>
<p>Direct dependency fix Resolution (org.activiti:activiti-engine): 5.14</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2017-9801</summary>
### Vulnerable Library - <b>commons-email-1.2.jar</b></p>
<p>Commons-Email aims to provide an API for sending email. It is built on top of
the JavaMail API, which it aims to simplify.</p>
<p>Library home page: <a href="http://commons.apache.org/email/">http://commons.apache.org/email/</a></p>
<p>Path to dependency file: /openidm-workflow-activiti/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar,/home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar</p>
<p>
Dependency Hierarchy:
- activiti-engine-5.10.jar (Root Library)
- :x: **commons-email-1.2.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
When a call-site passes a subject for an email that contains line-breaks in Apache Commons Email 1.0 through 1.4, the caller can add arbitrary SMTP headers.
<p>Publish Date: Aug 7, 2017 3:29:01 PM
<p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2017-9801>CVE-2017-9801</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>7.5</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: None
- Integrity Impact: High
- Availability Impact: None
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2017-9801">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2017-9801</a></p>
<p>Release Date: Aug 7, 2017 3:29:01 PM</p>
<p>Fix Resolution (org.apache.commons:commons-email): 1.5</p>
<p>Direct dependency fix Resolution (org.activiti:activiti-engine): 5.14</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details><details>
<summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> CVE-2018-1294</summary>
### Vulnerable Library - <b>commons-email-1.2.jar</b></p>
<p>Commons-Email aims to provide an API for sending email. It is built on top of
the JavaMail API, which it aims to simplify.</p>
<p>Library home page: <a href="http://commons.apache.org/email/">http://commons.apache.org/email/</a></p>
<p>Path to dependency file: /openidm-workflow-activiti/pom.xml</p>
<p>Path to vulnerable library: /home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar,/home/wss-scanner/.m2/repository/org/apache/commons/commons-email/1.2/commons-email-1.2.jar</p>
<p>
Dependency Hierarchy:
- activiti-engine-5.10.jar (Root Library)
- :x: **commons-email-1.2.jar** (Vulnerable Library)
<p>Found in HEAD commit: <a href="https://github.com/sast-automation-dev/openidm-community-edition-41/commit/54e4a95a9c637664871fdebd0539d3b2c470113a">54e4a95a9c637664871fdebd0539d3b2c470113a</a></p>
<p>Found in base branch: <b>master</b></p>
</p>
<p></p>
### Vulnerability Details
<p>
If a user of Apache Commons Email (typically an application programmer) passes unvalidated input as the so-called "Bounce Address", and that input contains line-breaks, then the email details (recipients, contents, etc.) might be manipulated. Mitigation: Users should upgrade to Commons-Email 1.5. You can mitigate this vulnerability for older versions of Commons Email by stripping line-breaks from data, that will be passed to Email.setBounceAddress(String).
<p>Publish Date: Mar 20, 2018 5:29:00 PM
<p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2018-1294>CVE-2018-1294</a></p>
</p>
<p></p>
### CVSS 3 Score Details (<b>7.5</b>)
<p>
Base Score Metrics:
- Exploitability Metrics:
- Attack Vector: Network
- Attack Complexity: Low
- Privileges Required: None
- User Interaction: None
- Scope: Unchanged
- Impact Metrics:
- Confidentiality Impact: None
- Integrity Impact: High
- Availability Impact: None
</p>
For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>.
</p>
<p></p>
### Suggested Fix
<p>
<p>Type: Upgrade version</p>
<p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2018-1294">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2018-1294</a></p>
<p>Release Date: Mar 20, 2018 5:29:00 PM</p>
<p>Fix Resolution (org.apache.commons:commons-email): 1.5</p>
<p>Direct dependency fix Resolution (org.activiti:activiti-engine): 5.14</p>
</p>
<p></p>
:rescue_worker_helmet: Automatic Remediation is available for this issue
</details>
***
<p>:rescue_worker_helmet: Automatic Remediation is available for this issue.</p> | non_defect | activiti engine jar vulnerabilities highest severity is vulnerable library activiti engine jar path to dependency file openidm workflow activiti pom xml path to vulnerable library home wss scanner repository org apache commons commons email commons email jar home wss scanner repository org apache commons commons email commons email jar found in head commit a href vulnerabilities cve severity cvss dependency type fixed in activiti engine version remediation available high mybatis jar transitive high commons email jar transitive high commons email jar transitive details cve vulnerable library mybatis jar the mybatis data mapper framework makes it easier to use a relational database with object oriented applications mybatis couples objects with stored procedures or sql statements using a xml descriptor or annotations simplicity is the biggest advantage of the mybatis data mapper over object relational mapping tools library home page a href path to dependency file openidm workflow remote pom xml path to vulnerable library home wss scanner repository org mybatis mybatis mybatis jar home wss scanner repository org mybatis mybatis mybatis jar dependency hierarchy activiti engine jar root library x mybatis jar vulnerable library found in head commit a href found in base branch master vulnerability details mybatis before mishandles deserialization of object streams publish date oct pm url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity high privileges required none user interaction none scope unchanged impact metrics confidentiality impact high integrity impact high availability impact high for more information on scores click a href suggested fix type upgrade version release date oct pm fix resolution org mybatis mybatis direct dependency fix resolution org activiti activiti engine rescue worker helmet automatic remediation is available for this issue cve vulnerable library commons email jar commons email aims to provide an api for sending email it is built on top of the javamail api which it aims to simplify library home page a href path to dependency file openidm workflow activiti pom xml path to vulnerable library home wss scanner repository org apache commons commons email commons email jar home wss scanner repository org apache commons commons email commons email jar dependency hierarchy activiti engine jar root library x commons email jar vulnerable library found in head commit a href found in base branch master vulnerability details when a call site passes a subject for an email that contains line breaks in apache commons email through the caller can add arbitrary smtp headers publish date aug pm url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact none integrity impact high availability impact none for more information on scores click a href suggested fix type upgrade version origin a href release date aug pm fix resolution org apache commons commons email direct dependency fix resolution org activiti activiti engine rescue worker helmet automatic remediation is available for this issue cve vulnerable library commons email jar commons email aims to provide an api for sending email it is built on top of the javamail api which it aims to simplify library home page a href path to dependency file openidm workflow activiti pom xml path to vulnerable library home wss scanner repository org apache commons commons email commons email jar home wss scanner repository org apache commons commons email commons email jar dependency hierarchy activiti engine jar root library x commons email jar vulnerable library found in head commit a href found in base branch master vulnerability details if a user of apache commons email typically an application programmer passes unvalidated input as the so called bounce address and that input contains line breaks then the email details recipients contents etc might be manipulated mitigation users should upgrade to commons email you can mitigate this vulnerability for older versions of commons email by stripping line breaks from data that will be passed to email setbounceaddress string publish date mar pm url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact none integrity impact high availability impact none for more information on scores click a href suggested fix type upgrade version origin a href release date mar pm fix resolution org apache commons commons email direct dependency fix resolution org activiti activiti engine rescue worker helmet automatic remediation is available for this issue rescue worker helmet automatic remediation is available for this issue | 0 |
80,801 | 30,536,656,993 | IssuesEvent | 2023-07-19 17:53:38 | department-of-veterans-affairs/va.gov-team | https://api.github.com/repos/department-of-veterans-affairs/va.gov-team | closed | [Components and pattern standards] Design components or patterns don't align with Design System guidelines. (04.07.13) | content design accessibility ia a11y-defect-3 collab-cycle-feedback Staging CCIssue04.07 CC-Dashboard MHV-Secure-Messaging | ### General Information
#### VFS team name
MHV
#### VFS product name
My HealtheVet
#### VFS feature name
Secure Messaging
#### Point of Contact/Reviewers
Brian DeConinck - @briandeconinck - Accessibility
*For more information on how to interpret this ticket, please refer to the [Anatomy of a Staging Review issue ticket](https://depo-platform-documentation.scrollhelp.site/collaboration-cycle/Anatomy-of-a-Staging-Review-Issue-ticket.2060320997.html) guidance on Platform Website.
---
### Platform Issue
Design components or patterns don't align with Design System guidelines.
### Issue Details
When printing a message modal, the second radio button, "Print all messages in this conversation," is followed by a line of text indicating how many messages are in that conversation --- important context for a user deciding how much they want to print. That line of text isn't programmatically associated with the radio button, so it's not announced by a screen reader when a user moves focus to the radio button. Since it's just a `p` paragraph of text that doesn't receive focus, a screen reader user who's tabbing through the interactive elements in the modal is likely to skip right over that text entirely without ever hearing it.
### Link, screenshot or steps to recreate
Example modal body:
```
<div class="modal-body">
<va-radio enable-analytics="true" class="form-radio-buttons hydrated" role="radiogroup" aria-invalid="true" aria-label="undefined" error="Please select an option to print.">
<va-radio-option data-testid="radio-print-one-message" label="Print only this message" value="PRINT_MAIN" name="this-message" aria-checked="false" role="radio" id="this-messagePRINT_MAIN" class="hydrated" tabindex="-1"></va-radio-option>
<va-radio-option data-testid="radio-print-all-messages" aria-label="Print all messages in this conversation (undefined messages)" label="Print all messages in this conversation" value="PRINT_THREAD" name="all-messages" aria-checked="true" role="radio" id="all-messagesPRINT_THREAD" class="hydrated" tabindex="0" style="display: flex;" checked=""></va-radio-option>
</va-radio>
<p><strong>(5 messages)</strong></p>
</div>
```
Note that there's no programmatic association between the `p` and the second `va-radio-option`. They appear in sequence, but that's it.
### VA.gov Experience Standard
[Category Number 04, Issue Number 07](https://depo-platform-documentation.scrollhelp.site/collaboration-cycle/VA.gov-experience-standards.1683980311.html)
### Other References
WCAG SC 3.2.4 AA
### Platform Recommendation
This is a perfect use case for the [description text property supported by the component](https://design.va.gov/components/form/radio-button#description-text).
---
### VFS Guidance
- Close the ticket when the issue has been resolved or validated by your Product Owner
- If your team has additional questions or needs Platform help validating the issue, please comment on the ticket
- Some feedback provided may be out of scope for your iteration of the product, however, Platform's OCTO leadership has stated that all identified issues need to be documented and it is still your responsibility to resolve the issue.
- If you do not believe that this Staging Review issue ticket is the responsibility of your team, comment below providing an explanation and who you believe is responsible. Please tag the Point of Contact/Reviewers. Governance team will research and will follow up. | 1.0 | [Components and pattern standards] Design components or patterns don't align with Design System guidelines. (04.07.13) - ### General Information
#### VFS team name
MHV
#### VFS product name
My HealtheVet
#### VFS feature name
Secure Messaging
#### Point of Contact/Reviewers
Brian DeConinck - @briandeconinck - Accessibility
*For more information on how to interpret this ticket, please refer to the [Anatomy of a Staging Review issue ticket](https://depo-platform-documentation.scrollhelp.site/collaboration-cycle/Anatomy-of-a-Staging-Review-Issue-ticket.2060320997.html) guidance on Platform Website.
---
### Platform Issue
Design components or patterns don't align with Design System guidelines.
### Issue Details
When printing a message modal, the second radio button, "Print all messages in this conversation," is followed by a line of text indicating how many messages are in that conversation --- important context for a user deciding how much they want to print. That line of text isn't programmatically associated with the radio button, so it's not announced by a screen reader when a user moves focus to the radio button. Since it's just a `p` paragraph of text that doesn't receive focus, a screen reader user who's tabbing through the interactive elements in the modal is likely to skip right over that text entirely without ever hearing it.
### Link, screenshot or steps to recreate
Example modal body:
```
<div class="modal-body">
<va-radio enable-analytics="true" class="form-radio-buttons hydrated" role="radiogroup" aria-invalid="true" aria-label="undefined" error="Please select an option to print.">
<va-radio-option data-testid="radio-print-one-message" label="Print only this message" value="PRINT_MAIN" name="this-message" aria-checked="false" role="radio" id="this-messagePRINT_MAIN" class="hydrated" tabindex="-1"></va-radio-option>
<va-radio-option data-testid="radio-print-all-messages" aria-label="Print all messages in this conversation (undefined messages)" label="Print all messages in this conversation" value="PRINT_THREAD" name="all-messages" aria-checked="true" role="radio" id="all-messagesPRINT_THREAD" class="hydrated" tabindex="0" style="display: flex;" checked=""></va-radio-option>
</va-radio>
<p><strong>(5 messages)</strong></p>
</div>
```
Note that there's no programmatic association between the `p` and the second `va-radio-option`. They appear in sequence, but that's it.
### VA.gov Experience Standard
[Category Number 04, Issue Number 07](https://depo-platform-documentation.scrollhelp.site/collaboration-cycle/VA.gov-experience-standards.1683980311.html)
### Other References
WCAG SC 3.2.4 AA
### Platform Recommendation
This is a perfect use case for the [description text property supported by the component](https://design.va.gov/components/form/radio-button#description-text).
---
### VFS Guidance
- Close the ticket when the issue has been resolved or validated by your Product Owner
- If your team has additional questions or needs Platform help validating the issue, please comment on the ticket
- Some feedback provided may be out of scope for your iteration of the product, however, Platform's OCTO leadership has stated that all identified issues need to be documented and it is still your responsibility to resolve the issue.
- If you do not believe that this Staging Review issue ticket is the responsibility of your team, comment below providing an explanation and who you believe is responsible. Please tag the Point of Contact/Reviewers. Governance team will research and will follow up. | defect | design components or patterns don t align with design system guidelines general information vfs team name mhv vfs product name my healthevet vfs feature name secure messaging point of contact reviewers brian deconinck briandeconinck accessibility for more information on how to interpret this ticket please refer to the guidance on platform website platform issue design components or patterns don t align with design system guidelines issue details when printing a message modal the second radio button print all messages in this conversation is followed by a line of text indicating how many messages are in that conversation important context for a user deciding how much they want to print that line of text isn t programmatically associated with the radio button so it s not announced by a screen reader when a user moves focus to the radio button since it s just a p paragraph of text that doesn t receive focus a screen reader user who s tabbing through the interactive elements in the modal is likely to skip right over that text entirely without ever hearing it link screenshot or steps to recreate example modal body messages note that there s no programmatic association between the p and the second va radio option they appear in sequence but that s it va gov experience standard other references wcag sc aa platform recommendation this is a perfect use case for the vfs guidance close the ticket when the issue has been resolved or validated by your product owner if your team has additional questions or needs platform help validating the issue please comment on the ticket some feedback provided may be out of scope for your iteration of the product however platform s octo leadership has stated that all identified issues need to be documented and it is still your responsibility to resolve the issue if you do not believe that this staging review issue ticket is the responsibility of your team comment below providing an explanation and who you believe is responsible please tag the point of contact reviewers governance team will research and will follow up | 1 |
74,375 | 25,096,363,653 | IssuesEvent | 2022-11-08 10:25:59 | vector-im/element-web | https://api.github.com/repos/vector-im/element-web | opened | Spotlight search gets unhelpfully stuck in 'public room' search mode if you typo a search | T-Defect | ### Steps to reproduce
1. Press cmd/ctrl-K
2. Rapidly type in someone's name and hit enter
3. Discover that you typoed the name, and you are now stuck in "Public rooms" filter (because the first item if you don't have any results is to select "public rooms"
4. Feel disoriented, and manually delete all the text including the filter (which means hitting delete several times to grab the tag), and start over
### Outcome
#### What did you expect?
Failing when you search shouldn't take you into a "search public rooms" filtering mode. Instead, there could be a "No matches" prompt as the first entry in the results, stopping you from accidentally selecting the "public rooms" filter.
#### What happened instead?
You step on a missing stair. This happens roughly once a day; it gets jarring.
### Operating system
macOS
### Application version
Nightly
### How did you install the app?
nightly
### Homeserver
matrix.org
### Will you send logs?
No | 1.0 | Spotlight search gets unhelpfully stuck in 'public room' search mode if you typo a search - ### Steps to reproduce
1. Press cmd/ctrl-K
2. Rapidly type in someone's name and hit enter
3. Discover that you typoed the name, and you are now stuck in "Public rooms" filter (because the first item if you don't have any results is to select "public rooms"
4. Feel disoriented, and manually delete all the text including the filter (which means hitting delete several times to grab the tag), and start over
### Outcome
#### What did you expect?
Failing when you search shouldn't take you into a "search public rooms" filtering mode. Instead, there could be a "No matches" prompt as the first entry in the results, stopping you from accidentally selecting the "public rooms" filter.
#### What happened instead?
You step on a missing stair. This happens roughly once a day; it gets jarring.
### Operating system
macOS
### Application version
Nightly
### How did you install the app?
nightly
### Homeserver
matrix.org
### Will you send logs?
No | defect | spotlight search gets unhelpfully stuck in public room search mode if you typo a search steps to reproduce press cmd ctrl k rapidly type in someone s name and hit enter discover that you typoed the name and you are now stuck in public rooms filter because the first item if you don t have any results is to select public rooms feel disoriented and manually delete all the text including the filter which means hitting delete several times to grab the tag and start over outcome what did you expect failing when you search shouldn t take you into a search public rooms filtering mode instead there could be a no matches prompt as the first entry in the results stopping you from accidentally selecting the public rooms filter what happened instead you step on a missing stair this happens roughly once a day it gets jarring operating system macos application version nightly how did you install the app nightly homeserver matrix org will you send logs no | 1 |
34,631 | 7,458,153,441 | IssuesEvent | 2018-03-30 08:55:42 | kerdokullamae/test_koik_issued | https://api.github.com/repos/kerdokullamae/test_koik_issued | closed | Lisada viimasest tarnest muutunud klassifikaatorid sql'idesse (osa 2) | C: AVAR P: highest R: fixed T: defect | **Reported by sven syld on 6 Oct 2014 13:04 UTC**
FILE_STORAGE_TYPE tõlked on vaja lisada. | 1.0 | Lisada viimasest tarnest muutunud klassifikaatorid sql'idesse (osa 2) - **Reported by sven syld on 6 Oct 2014 13:04 UTC**
FILE_STORAGE_TYPE tõlked on vaja lisada. | defect | lisada viimasest tarnest muutunud klassifikaatorid sql idesse osa reported by sven syld on oct utc file storage type tõlked on vaja lisada | 1 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.