Unnamed: 0
int64 0
832k
| id
float64 2.49B
32.1B
| type
stringclasses 1
value | created_at
stringlengths 19
19
| repo
stringlengths 5
112
| repo_url
stringlengths 34
141
| action
stringclasses 3
values | title
stringlengths 1
855
| labels
stringlengths 4
721
| body
stringlengths 1
261k
| index
stringclasses 13
values | text_combine
stringlengths 96
261k
| label
stringclasses 2
values | text
stringlengths 96
240k
| binary_label
int64 0
1
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
616,782
| 19,320,807,412
|
IssuesEvent
|
2021-12-14 05:11:46
|
RoboJackets/apiary-mobile
|
https://api.github.com/repos/RoboJackets/apiary-mobile
|
closed
|
Reduce strictness of BuzzCard contents regex
|
type / bug priority / high area / nfc
|
We don't use the prox ID including in BuzzCards but enforce the format of it. It would be better to only check the GTID component of the BuzzCard contents.
|
1.0
|
Reduce strictness of BuzzCard contents regex - We don't use the prox ID including in BuzzCards but enforce the format of it. It would be better to only check the GTID component of the BuzzCard contents.
|
priority
|
reduce strictness of buzzcard contents regex we don t use the prox id including in buzzcards but enforce the format of it it would be better to only check the gtid component of the buzzcard contents
| 1
|
469,301
| 13,505,179,186
|
IssuesEvent
|
2020-09-13 21:32:19
|
aps-8id-dys/ipython-8idiuser
|
https://api.github.com/repos/aps-8id-dys/ipython-8idiuser
|
closed
|
bluesky warnings from IMMout plugin
|
high priority
|
During the meeting today, @prjemian @ericmdufresne and I found that Bluesky spits out this error message (see drop down) randomly but about once in a few hours. We wanted to find the source and fix it since there's no telling if this will crash a scan. @prjemian pointed out that two PVs on Lambda EPICS are blank and I attached the screenshots for those two PVs. @ericmdufresne suggested that it could be a Lambda IOC problem and suggest that I investigate on the terminal where the IOC was spawned. @sureshnaps What's your opinion?
<details>
<summary> Warning message: </summary>
```
In [4]: CA.Client.Exception...............................................
Warning: "Virtual circuit disconnect"
Context: "lambda.xray.aps.anl.gov:5064"
Source File: ../cac.cpp line 1236
Current Time: Tue Sep 08 2020 13:52:27.403016831
..................................................................
CA.Client.Exception...............................................
Warning: "Virtual circuit disconnect"
Context: "lambda.xray.aps.anl.gov:5064"
Source File: ../cac.cpp line 1236
Current Time: Tue Sep 08 2020 18:37:30.884512284
..................................................................
```
</details>
<img width="332" alt="Screen Shot 2020-09-08 at 11 15 13 AM" src="https://user-images.githubusercontent.com/48140482/92548106-cae0f280-f21b-11ea-8104-c1eae0152533.png">
<img width="334" alt="Screen Shot 2020-09-08 at 11 15 29 AM" src="https://user-images.githubusercontent.com/48140482/92548109-cc121f80-f21b-11ea-9d78-f01f859af37f.png">
|
1.0
|
bluesky warnings from IMMout plugin -
During the meeting today, @prjemian @ericmdufresne and I found that Bluesky spits out this error message (see drop down) randomly but about once in a few hours. We wanted to find the source and fix it since there's no telling if this will crash a scan. @prjemian pointed out that two PVs on Lambda EPICS are blank and I attached the screenshots for those two PVs. @ericmdufresne suggested that it could be a Lambda IOC problem and suggest that I investigate on the terminal where the IOC was spawned. @sureshnaps What's your opinion?
<details>
<summary> Warning message: </summary>
```
In [4]: CA.Client.Exception...............................................
Warning: "Virtual circuit disconnect"
Context: "lambda.xray.aps.anl.gov:5064"
Source File: ../cac.cpp line 1236
Current Time: Tue Sep 08 2020 13:52:27.403016831
..................................................................
CA.Client.Exception...............................................
Warning: "Virtual circuit disconnect"
Context: "lambda.xray.aps.anl.gov:5064"
Source File: ../cac.cpp line 1236
Current Time: Tue Sep 08 2020 18:37:30.884512284
..................................................................
```
</details>
<img width="332" alt="Screen Shot 2020-09-08 at 11 15 13 AM" src="https://user-images.githubusercontent.com/48140482/92548106-cae0f280-f21b-11ea-8104-c1eae0152533.png">
<img width="334" alt="Screen Shot 2020-09-08 at 11 15 29 AM" src="https://user-images.githubusercontent.com/48140482/92548109-cc121f80-f21b-11ea-9d78-f01f859af37f.png">
|
priority
|
bluesky warnings from immout plugin during the meeting today prjemian ericmdufresne and i found that bluesky spits out this error message see drop down randomly but about once in a few hours we wanted to find the source and fix it since there s no telling if this will crash a scan prjemian pointed out that two pvs on lambda epics are blank and i attached the screenshots for those two pvs ericmdufresne suggested that it could be a lambda ioc problem and suggest that i investigate on the terminal where the ioc was spawned sureshnaps what s your opinion warning message in ca client exception warning virtual circuit disconnect context lambda xray aps anl gov source file cac cpp line current time tue sep ca client exception warning virtual circuit disconnect context lambda xray aps anl gov source file cac cpp line current time tue sep img width alt screen shot at am src img width alt screen shot at am src
| 1
|
830,414
| 32,007,297,460
|
IssuesEvent
|
2023-09-21 15:34:13
|
theDS3/Website
|
https://api.github.com/repos/theDS3/Website
|
opened
|
Sitemap
|
Priority: High Type: Feature Request Work: Clear
|
## Is your feature request related to a problem? Please describe
The site needs a sitemap to provide information about the structure and organization of a website to search engines
## Describe the solution you'd like
Create it based on the instructions here: https://docs.astro.build/en/guides/integrations-guide/sitemap/
|
1.0
|
Sitemap - ## Is your feature request related to a problem? Please describe
The site needs a sitemap to provide information about the structure and organization of a website to search engines
## Describe the solution you'd like
Create it based on the instructions here: https://docs.astro.build/en/guides/integrations-guide/sitemap/
|
priority
|
sitemap is your feature request related to a problem please describe the site needs a sitemap to provide information about the structure and organization of a website to search engines describe the solution you d like create it based on the instructions here
| 1
|
41,848
| 2,869,085,712
|
IssuesEvent
|
2015-06-05 23:13:06
|
dart-lang/polymer-dart
|
https://api.github.com/repos/dart-lang/polymer-dart
|
closed
|
Polymer library 0.10.x does not compile
|
bug CannotReproduce PolymerMilestone-Next Priority-High
|
_Originally opened as dart-lang/sdk#19234_
*This issue was originally filed by Renat.Valeev...@gmail.com*
_____
**What steps will reproduce the problem?**
Initially I thought that it is an issue in my code when I've tried to updated polymer library from 0.9.5+2 to 0.10.0(also tried 0.10.1).
But I've downloaded code of fancy_button here https://pub.dartlang.org/packages/fancy_button
Tried to run "pub build" and output you could see below.
The odd thing is that it says "build ok", but in the end there is no index.html in build folder. (I'm using dart-maven plugin and usually if pub fails to do smth, then the maven build fails, but not in this case. May be it is an issue of maven plugin or pub)
**What is the expected output? What do you see instead?**
Compiled app
**What version of the product are you using? On what operating system?**
Debian x63, Dart 1.4.2
**Please provide any additional information below.**
You don't have a lockfile, so we need to generate that:
Resolving dependencies... (8.8s)
Downloading html5lib 0.11.0+1...
Downloading path 1.2.1...
Downloading source_maps 0.9.1...
Downloading yaml 0.10.0...
Downloading collection 0.9.3+1...
Downloading stack_trace 0.9.3+2...
Downloading csslib 0.10.0+1...
Downloading string_scanner 0.0.2...
Got dependencies!
Loading source assets...
Loading smoke/src/default_transformer transformers... (1.8s)
Loading observe transformers... (1.2s)
Loading polymer/src/build/mirrors_remover transformers...
Loading polymer transformers...
[Observable on polymer|lib/src/instance.dart\]:
Closure call with mismatched arguments: function '_greaterThanFromInteger@0x36924d72'
NoSuchMethodError: incorrect number of arguments passed to method named '_greaterThanFromInteger@0x36924d72'
Receiver: Closure: () => int from Function 'length':.
Tried calling: \_greaterThanFromInteger@0x36924d72(0)
Found: \_greaterThanFromInteger@0x36924d72()
dart:core-patch/object_patch.dart 45 Object.noSuchMethod
dart:core-patch/integers.dart 75 int.>
dart:core-patch/integers.dart 78 int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 331 \_Future._completeWithValue
dart:async/future_impl.dart 393 \_Future._asyncComplete.<fn>
dart:async/schedule_microtask.dart 23 \_asyncRunCallbackLoop
dart:async/schedule_microtask.dart 32 \_asyncRunCallback
dart:isolate-patch/isolate_patch.dart 128 \_RawReceivePortImpl._handleMessage
dart:core int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:isolate \_RawReceivePortImpl._handleMessage
Building fancy_button...
Build error:
Transform Observable on polymer|lib/src/instance.dart threw error: Closure call with mismatched arguments: function '_greaterThanFromInteger@0x36924d72'
NoSuchMethodError: incorrect number of arguments passed to method named '_greaterThanFromInteger@0x36924d72'
Receiver: Closure: () => int from Function 'length':.
Tried calling: \_greaterThanFromInteger@0x36924d72(0)
Found: \_greaterThanFromInteger@0x36924d72()
dart:core-patch/object_patch.dart 45 Object.noSuchMethod
dart:core-patch/integers.dart 75 int.>
dart:core-patch/integers.dart 78 int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 331 \_Future._completeWithValue
dart:async/future_impl.dart 393 \_Future._asyncComplete.<fn>
dart:async/schedule_microtask.dart 23 \_asyncRunCallbackLoop
dart:async/schedule_microtask.dart 32 \_asyncRunCallback
dart:isolate-patch/isolate_patch.dart 128 \_RawReceivePortImpl._handleMessage
dart:core int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:isolate \_RawReceivePortImpl._handleMessage
[Error from ScriptCompactor on fancy_button|web/index.html\]:
Could not load asset polymer|lib/src/instance.dart
Build error:
Transform ScriptCompactor on fancy_button|web/index.html threw error: Bad state: Internal error in polymer-builder: couldn't find definition of PublishedProperty.
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 724:5 \_ResolvedTypes._definitionError
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 719:41 \_ResolvedTypes._lookupType
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 699:39 \_ResolvedTypes._ResolvedTypes
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 210:19 \_ScriptCompactor._initResolver.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 555 \_Future._propagateToListeners.handleWhenCompleteCallback.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 331 \_Future._completeWithValue
dart:async/future_impl.dart 393 \_Future._asyncComplete.<fn>
dart:async/schedule_microtask.dart 23 \_asyncRunCallbackLoop
dart:async/schedule_microtask.dart 32 \_asyncRunCallback
dart:isolate-patch/isolate_patch.dart 128 \_RawReceivePortImpl._handleMessage
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 724:5 \_ResolvedTypes._definitionError
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 719:41 \_ResolvedTypes._lookupType
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 699:39 \_ResolvedTypes._ResolvedTypes
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 210:19 \_ScriptCompactor._initResolver.<fn>
dart:isolate \_RawReceivePortImpl._handleMessage
Built 28 files to "build".
|
1.0
|
Polymer library 0.10.x does not compile - _Originally opened as dart-lang/sdk#19234_
*This issue was originally filed by Renat.Valeev...@gmail.com*
_____
**What steps will reproduce the problem?**
Initially I thought that it is an issue in my code when I've tried to updated polymer library from 0.9.5+2 to 0.10.0(also tried 0.10.1).
But I've downloaded code of fancy_button here https://pub.dartlang.org/packages/fancy_button
Tried to run "pub build" and output you could see below.
The odd thing is that it says "build ok", but in the end there is no index.html in build folder. (I'm using dart-maven plugin and usually if pub fails to do smth, then the maven build fails, but not in this case. May be it is an issue of maven plugin or pub)
**What is the expected output? What do you see instead?**
Compiled app
**What version of the product are you using? On what operating system?**
Debian x63, Dart 1.4.2
**Please provide any additional information below.**
You don't have a lockfile, so we need to generate that:
Resolving dependencies... (8.8s)
Downloading html5lib 0.11.0+1...
Downloading path 1.2.1...
Downloading source_maps 0.9.1...
Downloading yaml 0.10.0...
Downloading collection 0.9.3+1...
Downloading stack_trace 0.9.3+2...
Downloading csslib 0.10.0+1...
Downloading string_scanner 0.0.2...
Got dependencies!
Loading source assets...
Loading smoke/src/default_transformer transformers... (1.8s)
Loading observe transformers... (1.2s)
Loading polymer/src/build/mirrors_remover transformers...
Loading polymer transformers...
[Observable on polymer|lib/src/instance.dart\]:
Closure call with mismatched arguments: function '_greaterThanFromInteger@0x36924d72'
NoSuchMethodError: incorrect number of arguments passed to method named '_greaterThanFromInteger@0x36924d72'
Receiver: Closure: () => int from Function 'length':.
Tried calling: \_greaterThanFromInteger@0x36924d72(0)
Found: \_greaterThanFromInteger@0x36924d72()
dart:core-patch/object_patch.dart 45 Object.noSuchMethod
dart:core-patch/integers.dart 75 int.>
dart:core-patch/integers.dart 78 int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 331 \_Future._completeWithValue
dart:async/future_impl.dart 393 \_Future._asyncComplete.<fn>
dart:async/schedule_microtask.dart 23 \_asyncRunCallbackLoop
dart:async/schedule_microtask.dart 32 \_asyncRunCallback
dart:isolate-patch/isolate_patch.dart 128 \_RawReceivePortImpl._handleMessage
dart:core int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:isolate \_RawReceivePortImpl._handleMessage
Building fancy_button...
Build error:
Transform Observable on polymer|lib/src/instance.dart threw error: Closure call with mismatched arguments: function '_greaterThanFromInteger@0x36924d72'
NoSuchMethodError: incorrect number of arguments passed to method named '_greaterThanFromInteger@0x36924d72'
Receiver: Closure: () => int from Function 'length':.
Tried calling: \_greaterThanFromInteger@0x36924d72(0)
Found: \_greaterThanFromInteger@0x36924d72()
dart:core-patch/object_patch.dart 45 Object.noSuchMethod
dart:core-patch/integers.dart 75 int.>
dart:core-patch/integers.dart 78 int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 331 \_Future._completeWithValue
dart:async/future_impl.dart 393 \_Future._asyncComplete.<fn>
dart:async/schedule_microtask.dart 23 \_asyncRunCallbackLoop
dart:async/schedule_microtask.dart 32 \_asyncRunCallback
dart:isolate-patch/isolate_patch.dart 128 \_RawReceivePortImpl._handleMessage
dart:core int.>=
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 496:25 CharSequenceReader.advance
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 904:33 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/analyzer/src/generated/scanner.dart 912:7 Scanner.tokenize
http://127.0.0.1:51775/packages/observe/transformer.dart 118:31 \_parseCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 88:35 \_transformCompilationUnit
http://127.0.0.1:51775/packages/observe/transformer.dart 71:50 ObservableTransformer.apply.<fn>
dart:isolate \_RawReceivePortImpl._handleMessage
[Error from ScriptCompactor on fancy_button|web/index.html\]:
Could not load asset polymer|lib/src/instance.dart
Build error:
Transform ScriptCompactor on fancy_button|web/index.html threw error: Bad state: Internal error in polymer-builder: couldn't find definition of PublishedProperty.
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 724:5 \_ResolvedTypes._definitionError
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 719:41 \_ResolvedTypes._lookupType
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 699:39 \_ResolvedTypes._ResolvedTypes
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 210:19 \_ScriptCompactor._initResolver.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 555 \_Future._propagateToListeners.handleWhenCompleteCallback.<fn>
dart:async/zone.dart 730 \_rootRunUnary
dart:async/zone.dart 864 \_RootZone.runUnary
dart:async/future_impl.dart 488 \_Future._propagateToListeners.handleValueCallback
dart:async/future_impl.dart 571 \_Future._propagateToListeners
dart:async/future_impl.dart 331 \_Future._completeWithValue
dart:async/future_impl.dart 393 \_Future._asyncComplete.<fn>
dart:async/schedule_microtask.dart 23 \_asyncRunCallbackLoop
dart:async/schedule_microtask.dart 32 \_asyncRunCallback
dart:isolate-patch/isolate_patch.dart 128 \_RawReceivePortImpl._handleMessage
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 724:5 \_ResolvedTypes._definitionError
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 719:41 \_ResolvedTypes._lookupType
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 699:39 \_ResolvedTypes._ResolvedTypes
http://127.0.0.1:51775/packages/polymer/src/build/script_compactor.dart 210:19 \_ScriptCompactor._initResolver.<fn>
dart:isolate \_RawReceivePortImpl._handleMessage
Built 28 files to "build".
|
priority
|
polymer library x does not compile originally opened as dart lang sdk this issue was originally filed by renat valeev gmail com what steps will reproduce the problem initially i thought that it is an issue in my code when i ve tried to updated polymer library from to also tried but i ve downloaded code of fancy button here tried to run quot pub build quot and output you could see below the odd thing is that it says quot build ok quot but in the end there is no index html in build folder i m using dart maven plugin and usually if pub fails to do smth then the maven build fails but not in this case may be it is an issue of maven plugin or pub what is the expected output what do you see instead compiled app what version of the product are you using on what operating system debian dart please provide any additional information below you don t have a lockfile so we need to generate that resolving dependencies downloading downloading path downloading source maps downloading yaml downloading collection downloading stack trace downloading csslib downloading string scanner got dependencies loading source assets loading smoke src default transformer transformers loading observe transformers loading polymer src build mirrors remover transformers loading polymer transformers closure call with mismatched arguments function greaterthanfrominteger nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp nosuchmethoderror incorrect number of arguments passed to method named greaterthanfrominteger receiver closure gt int from function length tried calling greaterthanfrominteger found greaterthanfrominteger dart core patch object patch dart object nosuchmethod dart core patch integers dart int gt dart core patch integers dart int gt charsequencereader advance scanner tokenize scanner tokenize scanner tokenize parsecompilationunit transformcompilationunit observabletransformer apply lt fn gt dart async zone dart rootrununary dart async zone dart rootzone rununary dart async future impl dart future propagatetolisteners handlevaluecallback dart async future impl dart future propagatetolisteners dart async future impl dart future completewithvalue dart async future impl dart future asynccomplete lt fn gt dart async schedule microtask dart asyncruncallbackloop dart async schedule microtask dart asyncruncallback dart isolate patch isolate patch dart rawreceiveportimpl handlemessage dart core int gt charsequencereader advance scanner tokenize scanner tokenize scanner tokenize parsecompilationunit transformcompilationunit observabletransformer apply lt fn gt dart isolate rawreceiveportimpl handlemessage building fancy button build error transform observable on polymer lib src instance dart threw error closure call with mismatched arguments function greaterthanfrominteger nosuchmethoderror incorrect number of arguments passed to method named greaterthanfrominteger receiver closure gt int from function length tried calling greaterthanfrominteger found greaterthanfrominteger dart core patch object patch dart object nosuchmethod dart core patch integers dart int gt dart core patch integers dart int gt charsequencereader advance scanner tokenize scanner tokenize scanner tokenize parsecompilationunit transformcompilationunit observabletransformer apply lt fn gt dart async zone dart rootrununary dart async zone dart rootzone rununary dart async future impl dart future propagatetolisteners handlevaluecallback dart async future impl dart future propagatetolisteners dart async future impl dart future completewithvalue dart async future impl dart future asynccomplete lt fn gt dart async schedule microtask dart asyncruncallbackloop dart async schedule microtask dart asyncruncallback dart isolate patch isolate patch dart rawreceiveportimpl handlemessage dart core int gt charsequencereader advance scanner tokenize scanner tokenize scanner tokenize parsecompilationunit transformcompilationunit observabletransformer apply lt fn gt dart isolate rawreceiveportimpl handlemessage could not load asset polymer lib src instance dart build error transform scriptcompactor on fancy button web index html threw error bad state internal error in polymer builder couldn t find definition of publishedproperty resolvedtypes definitionerror resolvedtypes lookuptype resolvedtypes resolvedtypes scriptcompactor initresolver lt fn gt dart async zone dart rootrununary dart async zone dart rootzone rununary dart async future impl dart future propagatetolisteners handlevaluecallback dart async future impl dart future propagatetolisteners dart async future impl dart future propagatetolisteners handlewhencompletecallback lt fn gt dart async zone dart rootrununary dart async zone dart rootzone rununary dart async future impl dart future propagatetolisteners handlevaluecallback dart async future impl dart future propagatetolisteners dart async future impl dart future completewithvalue dart async future impl dart future asynccomplete lt fn gt dart async schedule microtask dart asyncruncallbackloop dart async schedule microtask dart asyncruncallback dart isolate patch isolate patch dart rawreceiveportimpl handlemessage resolvedtypes definitionerror resolvedtypes lookuptype resolvedtypes resolvedtypes scriptcompactor initresolver lt fn gt dart isolate rawreceiveportimpl handlemessage built files to quot build quot
| 1
|
195,561
| 6,913,104,514
|
IssuesEvent
|
2017-11-28 14:20:01
|
senaite/bika.lims
|
https://api.github.com/repos/senaite/bika.lims
|
closed
|
Reference Field JS removes Profile UIDs from copied ARs
|
issue-done priority: high
|
## Steps to reproduce
Copy an existing AR with an attached Profile
Relevant Code:
https://github.com/senaite/bika.lims/blob/master/bika/lims/skins/bika/bika_widgets/referencewidget.js#L210
## Current behavior
The profile UID of the hidden field is removed and thus, the profile is not set
## Expected behavior
The profile(s) of copied ARs are applied
## Screenshot (optional)
<img width="839" alt="referencefiledjs" src="https://user-images.githubusercontent.com/713193/33235922-bdd00cce-d244-11e7-8351-0eee0e8ed32f.png">
|
1.0
|
Reference Field JS removes Profile UIDs from copied ARs - ## Steps to reproduce
Copy an existing AR with an attached Profile
Relevant Code:
https://github.com/senaite/bika.lims/blob/master/bika/lims/skins/bika/bika_widgets/referencewidget.js#L210
## Current behavior
The profile UID of the hidden field is removed and thus, the profile is not set
## Expected behavior
The profile(s) of copied ARs are applied
## Screenshot (optional)
<img width="839" alt="referencefiledjs" src="https://user-images.githubusercontent.com/713193/33235922-bdd00cce-d244-11e7-8351-0eee0e8ed32f.png">
|
priority
|
reference field js removes profile uids from copied ars steps to reproduce copy an existing ar with an attached profile relevant code current behavior the profile uid of the hidden field is removed and thus the profile is not set expected behavior the profile s of copied ars are applied screenshot optional img width alt referencefiledjs src
| 1
|
186,314
| 6,735,238,497
|
IssuesEvent
|
2017-10-18 20:59:59
|
octobercms/october
|
https://api.github.com/repos/octobercms/october
|
reopened
|
Creating new model and relations using Mass Assign does not save relations (afterSave event not firing).
|
Priority: High Status: Review Needed Type: Maintenance
|
I would post this in Octobercms/Library but I cannot create issues there, so this will have to suffice.
##### Expected behavior
So for instance if I was to set the Rainlab/User groups relation to fillable and was to insert a new Rainlab/User through mass assign (containing an array of group ID's) in the model create method, it would normally create the user and setup the group relations automatically.
##### Actual behavior
After investigation it seems as though the model bind event for afterSave is never called, causing the sync on https://github.com/octobercms/library/blob/master/src/Database/Relations/BelongsToMany.php#L207 to never execute, causing the group relations to not be set up.
##### Reproduce steps
- Install latest build of OctoberCMS (Build 350)
- Install Rainlab.User plugin
- Set the Rainlab User groups relation to be fillable
```
$user= new User;
$data = [
...,
...,
'groups' => [
1
]
];
$user->fill($data);
$user->save();
OR
$user->create($data);
```
What is strange is that the relations are setup temporarily, $user->groups does populate when I do $user->fill($data), but because the afterSave method isn't called, syncing the relation isn't called.
##### October build
350
|
1.0
|
Creating new model and relations using Mass Assign does not save relations (afterSave event not firing). - I would post this in Octobercms/Library but I cannot create issues there, so this will have to suffice.
##### Expected behavior
So for instance if I was to set the Rainlab/User groups relation to fillable and was to insert a new Rainlab/User through mass assign (containing an array of group ID's) in the model create method, it would normally create the user and setup the group relations automatically.
##### Actual behavior
After investigation it seems as though the model bind event for afterSave is never called, causing the sync on https://github.com/octobercms/library/blob/master/src/Database/Relations/BelongsToMany.php#L207 to never execute, causing the group relations to not be set up.
##### Reproduce steps
- Install latest build of OctoberCMS (Build 350)
- Install Rainlab.User plugin
- Set the Rainlab User groups relation to be fillable
```
$user= new User;
$data = [
...,
...,
'groups' => [
1
]
];
$user->fill($data);
$user->save();
OR
$user->create($data);
```
What is strange is that the relations are setup temporarily, $user->groups does populate when I do $user->fill($data), but because the afterSave method isn't called, syncing the relation isn't called.
##### October build
350
|
priority
|
creating new model and relations using mass assign does not save relations aftersave event not firing i would post this in octobercms library but i cannot create issues there so this will have to suffice expected behavior so for instance if i was to set the rainlab user groups relation to fillable and was to insert a new rainlab user through mass assign containing an array of group id s in the model create method it would normally create the user and setup the group relations automatically actual behavior after investigation it seems as though the model bind event for aftersave is never called causing the sync on to never execute causing the group relations to not be set up reproduce steps install latest build of octobercms build install rainlab user plugin set the rainlab user groups relation to be fillable user new user data groups user fill data user save or user create data what is strange is that the relations are setup temporarily user groups does populate when i do user fill data but because the aftersave method isn t called syncing the relation isn t called october build
| 1
|
292,898
| 8,970,053,626
|
IssuesEvent
|
2019-01-29 12:36:26
|
conan-io/docs
|
https://api.github.com/repos/conan-io/docs
|
closed
|
Typo in hooks section
|
complex: low priority: high stage: review type: bug
|
I found a typo in the Hook doc (https://docs.conan.io/en/latest/extending/hooks.html)
- In the Storage, activation and sharing section, there is a `hook.conf` example where it is indicated this as valid
```
...
[hooks]
attribute_checker
conan-center
my_custom_hook/hook.py
```
however, there is a note claiming that .py extension should not be used, so probably it should be
```
...
[hooks]
attribute_checker
conan-center
my_custom_hook/hook
```
_Originally posted by @alacasta in https://github.com/conan-io/conan/issues/4196#issuecomment-450912038_
|
1.0
|
Typo in hooks section - I found a typo in the Hook doc (https://docs.conan.io/en/latest/extending/hooks.html)
- In the Storage, activation and sharing section, there is a `hook.conf` example where it is indicated this as valid
```
...
[hooks]
attribute_checker
conan-center
my_custom_hook/hook.py
```
however, there is a note claiming that .py extension should not be used, so probably it should be
```
...
[hooks]
attribute_checker
conan-center
my_custom_hook/hook
```
_Originally posted by @alacasta in https://github.com/conan-io/conan/issues/4196#issuecomment-450912038_
|
priority
|
typo in hooks section i found a typo in the hook doc in the storage activation and sharing section there is a hook conf example where it is indicated this as valid attribute checker conan center my custom hook hook py however there is a note claiming that py extension should not be used so probably it should be attribute checker conan center my custom hook hook originally posted by alacasta in
| 1
|
529,591
| 15,391,998,623
|
IssuesEvent
|
2021-03-03 15:09:59
|
graknlabs/grakn
|
https://api.github.com/repos/graknlabs/grakn
|
closed
|
Triggering an undefined rule throws NullPointerException
|
priority: high type: bug
|
## Description
Having Undefined any rule, making a query that would trigger the rule then throws a NullPointerException.
## Environment
1. OS (where Grakn server runs): Mac OS 10
2. Grakn version (and platform): Grakn Core 2.0 alpha 8
3. Grakn client: console
## Reproducible steps
1. Load the [docs schema](https://github.com/graknlabs/docs/blob/development/files/social-network/schema.gql)
2. We'll target this rule (any rule will do):
```
rule events-overlap:
when {
$e1 isa periodic-event;
$e1 has start-date $sd1, has end-date $ed1;
$e2 isa periodic-event;
$e2 has start-date $sd2, has end-date $ed2;
$sd2 > $sd1;
$sd2 < $ed1;
$e1 != $e2;
} then {
(overlapping: $e1, overlapping: $e2) isa event-overlap;
};
```
3. Undefine the rule, commit, and try to trigger the rule
```
> transaction social_network schema write
social_network::schema::write> undefine rule events-overlap;
Concepts have been undefined
social_network::schema::write> commit
Transaction changes committed
> transaction social_network data read
social_network::data::read> match (overlapping: $e1, overlapping: $e2) isa event-overlap;
java.lang.NullPointerException Please check server logs for the stack trace.
>
```
|
1.0
|
Triggering an undefined rule throws NullPointerException - ## Description
Having Undefined any rule, making a query that would trigger the rule then throws a NullPointerException.
## Environment
1. OS (where Grakn server runs): Mac OS 10
2. Grakn version (and platform): Grakn Core 2.0 alpha 8
3. Grakn client: console
## Reproducible steps
1. Load the [docs schema](https://github.com/graknlabs/docs/blob/development/files/social-network/schema.gql)
2. We'll target this rule (any rule will do):
```
rule events-overlap:
when {
$e1 isa periodic-event;
$e1 has start-date $sd1, has end-date $ed1;
$e2 isa periodic-event;
$e2 has start-date $sd2, has end-date $ed2;
$sd2 > $sd1;
$sd2 < $ed1;
$e1 != $e2;
} then {
(overlapping: $e1, overlapping: $e2) isa event-overlap;
};
```
3. Undefine the rule, commit, and try to trigger the rule
```
> transaction social_network schema write
social_network::schema::write> undefine rule events-overlap;
Concepts have been undefined
social_network::schema::write> commit
Transaction changes committed
> transaction social_network data read
social_network::data::read> match (overlapping: $e1, overlapping: $e2) isa event-overlap;
java.lang.NullPointerException Please check server logs for the stack trace.
>
```
|
priority
|
triggering an undefined rule throws nullpointerexception description having undefined any rule making a query that would trigger the rule then throws a nullpointerexception environment os where grakn server runs mac os grakn version and platform grakn core alpha grakn client console reproducible steps load the we ll target this rule any rule will do rule events overlap when isa periodic event has start date has end date isa periodic event has start date has end date then overlapping overlapping isa event overlap undefine the rule commit and try to trigger the rule transaction social network schema write social network schema write undefine rule events overlap concepts have been undefined social network schema write commit transaction changes committed transaction social network data read social network data read match overlapping overlapping isa event overlap java lang nullpointerexception please check server logs for the stack trace
| 1
|
479,819
| 13,805,973,995
|
IssuesEvent
|
2020-10-11 15:49:25
|
AY2021S1-CS2103T-T13-4/tp
|
https://api.github.com/repos/AY2021S1-CS2103T-T13-4/tp
|
closed
|
As a user, I want to be able to add my expenses/earnings to the userboard
|
priority.High type.Story
|
So that I can create and view a list of expenses
|
1.0
|
As a user, I want to be able to add my expenses/earnings to the userboard - So that I can create and view a list of expenses
|
priority
|
as a user i want to be able to add my expenses earnings to the userboard so that i can create and view a list of expenses
| 1
|
355,935
| 10,586,487,680
|
IssuesEvent
|
2019-10-08 19:51:16
|
CCSI-Toolset/FOQUS
|
https://api.github.com/repos/CCSI-Toolset/FOQUS
|
closed
|
Separate Examples?
|
Examples Priority:High question
|
Some of the example simulation files are pretty large. Would it be better to create a separate examples download? Or a page somewhere that was like an examples gallery?
|
1.0
|
Separate Examples? - Some of the example simulation files are pretty large. Would it be better to create a separate examples download? Or a page somewhere that was like an examples gallery?
|
priority
|
separate examples some of the example simulation files are pretty large would it be better to create a separate examples download or a page somewhere that was like an examples gallery
| 1
|
654,835
| 21,671,340,230
|
IssuesEvent
|
2022-05-08 01:50:27
|
drg-tools/karl.gg
|
https://api.github.com/repos/drg-tools/karl.gg
|
closed
|
Overclock names on mobile
|
enhancement high priority
|
As a mobile user of the site I want to be able to see which overclock is used in builds
currently I’m only able to see if its clean, unstable or balanced.
There seem to be a hover/ click that shows the description but it’s very unreliable and only showing for .5 sec
|
1.0
|
Overclock names on mobile - As a mobile user of the site I want to be able to see which overclock is used in builds
currently I’m only able to see if its clean, unstable or balanced.
There seem to be a hover/ click that shows the description but it’s very unreliable and only showing for .5 sec
|
priority
|
overclock names on mobile as a mobile user of the site i want to be able to see which overclock is used in builds currently i’m only able to see if its clean unstable or balanced there seem to be a hover click that shows the description but it’s very unreliable and only showing for sec
| 1
|
273,643
| 8,551,021,732
|
IssuesEvent
|
2018-11-07 16:54:43
|
CS2103-AY1819S1-T16-4/main
|
https://api.github.com/repos/CS2103-AY1819S1-T16-4/main
|
closed
|
As a student, I can add modules that I have taken
|
priority.High type.Story
|
... so that I can know what other modules I can take next based on the module prerequisites.
|
1.0
|
As a student, I can add modules that I have taken - ... so that I can know what other modules I can take next based on the module prerequisites.
|
priority
|
as a student i can add modules that i have taken so that i can know what other modules i can take next based on the module prerequisites
| 1
|
580,324
| 17,226,764,141
|
IssuesEvent
|
2021-07-20 03:39:10
|
dataware-tools/dataware-tools
|
https://api.github.com/repos/dataware-tools/dataware-tools
|
closed
|
[Data-browser] Difficult to understand that database list is scrollable
|
kind/feature priority/highest wg/web-app
|
たくさんデータがあるときに、スクロールできるか分かりづらいです
<img width="1536" alt="スクリーンショット 2021-07-02 13 05 34" src="https://user-images.githubusercontent.com/61043090/124219241-ed3f5600-db36-11eb-9eaa-1671574a1dbc.png">
_Originally posted by @yuri-sakai in https://github.com/dataware-tools/dataware-tools/issues/2#issuecomment-872698514_
|
1.0
|
[Data-browser] Difficult to understand that database list is scrollable - たくさんデータがあるときに、スクロールできるか分かりづらいです
<img width="1536" alt="スクリーンショット 2021-07-02 13 05 34" src="https://user-images.githubusercontent.com/61043090/124219241-ed3f5600-db36-11eb-9eaa-1671574a1dbc.png">
_Originally posted by @yuri-sakai in https://github.com/dataware-tools/dataware-tools/issues/2#issuecomment-872698514_
|
priority
|
difficult to understand that database list is scrollable たくさんデータがあるときに、スクロールできるか分かりづらいです img width alt スクリーンショット src originally posted by yuri sakai in
| 1
|
128,357
| 5,060,128,777
|
IssuesEvent
|
2016-12-22 10:43:07
|
odalic/sti
|
https://api.github.com/repos/odalic/sti
|
closed
|
Algorithm provides only one (and frequently wrong) candidate for the disambiguations
|
bug core disambiguation knowledge bases priority: High ready
|
It is strange, that in the case of artists2.csv ( https://drive.google.com/file/d/0B7AckGrBKzUtaGp1OTdKSGxTM0k/view?usp=sharing ), the algorithm only provides one candidate, and frequently not the most obvious one (like Haifa film instead of the city, Israel national team instead of the Israel state itself and so on).
|
1.0
|
Algorithm provides only one (and frequently wrong) candidate for the disambiguations - It is strange, that in the case of artists2.csv ( https://drive.google.com/file/d/0B7AckGrBKzUtaGp1OTdKSGxTM0k/view?usp=sharing ), the algorithm only provides one candidate, and frequently not the most obvious one (like Haifa film instead of the city, Israel national team instead of the Israel state itself and so on).
|
priority
|
algorithm provides only one and frequently wrong candidate for the disambiguations it is strange that in the case of csv the algorithm only provides one candidate and frequently not the most obvious one like haifa film instead of the city israel national team instead of the israel state itself and so on
| 1
|
701,896
| 24,113,843,222
|
IssuesEvent
|
2022-09-20 13:25:37
|
AY2223S1-CS2103T-W08-4/tp
|
https://api.github.com/repos/AY2223S1-CS2103T-W08-4/tp
|
closed
|
Update User Guide
|
priority.High type.Task
|
# Info
Details [here](https://nus-cs2103-ay2223s1.github.io/website/schedule/week7/project.html#3-update-the-ug)
- [x] Move the draft UG content into the User Guide page in your repository. Update the content as necessary. If a feature is not implemented in the current version, you can either omit it from the UG or mark it as 'Coming soon' (e.g., ## Archiving contacts [coming soon]).
As mentioned before, while it is more convenient for one person to update the entire UG, we recommend that each person updates their own part of the docs so that we can easily track the contribution of each member using [RepoSense](https://nus-cs2103-ay2223s1.github.io/tp-dashboard/?search=&sort=groupTitle&sortWithin=title&timeframe=commit&mergegroup=&groupSelect=groupByRepos&breakdown=true&checkedFileTypes=docs~functional-code~test-code~other).
## NOTE
- [x] Please follow the [forking workflow](https://nus-cs2103-ay2223s1.github.io/website/schedule/week7/project.html#2-update-project-website-aboutus-readme) for this iteration.
- [x] This will be collaborative among all team members
|
1.0
|
Update User Guide - # Info
Details [here](https://nus-cs2103-ay2223s1.github.io/website/schedule/week7/project.html#3-update-the-ug)
- [x] Move the draft UG content into the User Guide page in your repository. Update the content as necessary. If a feature is not implemented in the current version, you can either omit it from the UG or mark it as 'Coming soon' (e.g., ## Archiving contacts [coming soon]).
As mentioned before, while it is more convenient for one person to update the entire UG, we recommend that each person updates their own part of the docs so that we can easily track the contribution of each member using [RepoSense](https://nus-cs2103-ay2223s1.github.io/tp-dashboard/?search=&sort=groupTitle&sortWithin=title&timeframe=commit&mergegroup=&groupSelect=groupByRepos&breakdown=true&checkedFileTypes=docs~functional-code~test-code~other).
## NOTE
- [x] Please follow the [forking workflow](https://nus-cs2103-ay2223s1.github.io/website/schedule/week7/project.html#2-update-project-website-aboutus-readme) for this iteration.
- [x] This will be collaborative among all team members
|
priority
|
update user guide info details move the draft ug content into the user guide page in your repository update the content as necessary if a feature is not implemented in the current version you can either omit it from the ug or mark it as coming soon e g archiving contacts as mentioned before while it is more convenient for one person to update the entire ug we recommend that each person updates their own part of the docs so that we can easily track the contribution of each member using note please follow the for this iteration this will be collaborative among all team members
| 1
|
57,638
| 3,083,239,958
|
IssuesEvent
|
2015-08-24 07:31:38
|
enviroCar/enviroCar-www
|
https://api.github.com/repos/enviroCar/enviroCar-www
|
opened
|
Remove delete button on public track page
|
bug Priority - 1 - High
|
When opening a public track page, e.g. https://envirocar.org/gsoc-dev/route.php?id=51dfde52e4b0feb05dbecb54, it should not show the "Trash can" icon to delete it. Right now I can even click on it and the subsequent confirmation message, which then disappears without any effect or error message.
|
1.0
|
Remove delete button on public track page - When opening a public track page, e.g. https://envirocar.org/gsoc-dev/route.php?id=51dfde52e4b0feb05dbecb54, it should not show the "Trash can" icon to delete it. Right now I can even click on it and the subsequent confirmation message, which then disappears without any effect or error message.
|
priority
|
remove delete button on public track page when opening a public track page e g it should not show the trash can icon to delete it right now i can even click on it and the subsequent confirmation message which then disappears without any effect or error message
| 1
|
785,268
| 27,606,840,623
|
IssuesEvent
|
2023-03-09 13:32:25
|
OpenCyphal/yukon
|
https://api.github.com/repos/OpenCyphal/yukon
|
closed
|
Improve the node graph
|
class-maintenance priority-high
|
Roughly speaking, this is the general direction in which we're going: https://forum.opencyphal.org/t/gui-tool-next-generation/229/53
One option is ImGui compiled to WebAssembly. It may be a bad one on the technical level, but as I user, I like it a lot.
|
1.0
|
Improve the node graph - Roughly speaking, this is the general direction in which we're going: https://forum.opencyphal.org/t/gui-tool-next-generation/229/53
One option is ImGui compiled to WebAssembly. It may be a bad one on the technical level, but as I user, I like it a lot.
|
priority
|
improve the node graph roughly speaking this is the general direction in which we re going one option is imgui compiled to webassembly it may be a bad one on the technical level but as i user i like it a lot
| 1
|
498,878
| 14,434,962,436
|
IssuesEvent
|
2020-12-07 08:01:04
|
ahmedkaludi/accelerated-mobile-pages
|
https://api.github.com/repos/ahmedkaludi/accelerated-mobile-pages
|
closed
|
The post pages are redirecting to the 404 page after the update.
|
NEXT UPDATE [Priority: HIGH] bug
|
Ref: https://secure.helpscout.net/conversation/1349104409/166918?folderId=2770545
The issue occurred when the user is switching from the 1.0.62.2 version to the 1.0.69.1 version.
URL: https://folhago.com.br/entretenimento/separacao-de-zeze-di-camargo-e-luciano-e-anunciada-por-fonte-proxima-e-surpreende-a-web/36573/amp/
The issue is very rare.
|
1.0
|
The post pages are redirecting to the 404 page after the update. - Ref: https://secure.helpscout.net/conversation/1349104409/166918?folderId=2770545
The issue occurred when the user is switching from the 1.0.62.2 version to the 1.0.69.1 version.
URL: https://folhago.com.br/entretenimento/separacao-de-zeze-di-camargo-e-luciano-e-anunciada-por-fonte-proxima-e-surpreende-a-web/36573/amp/
The issue is very rare.
|
priority
|
the post pages are redirecting to the page after the update ref the issue occurred when the user is switching from the version to the version url the issue is very rare
| 1
|
188,698
| 6,780,089,676
|
IssuesEvent
|
2017-10-29 09:47:22
|
AnSyn/ansyn
|
https://api.github.com/repos/AnSyn/ansyn
|
closed
|
Share URL - after rotating an overlay, zoom level (map extent) is wrong
|
Bug Priority: Medium Severity: High
|
Current:
1. open an overlay and zoom in and rotate (tab 1)
2. share url (tab 1)
3. open url in new tab (tab2)
4. rotation angle is identical to tab 1 , zoom level is **different** to tab 1
Expected:
1. open an overlay and zoom in and rotate (tab 1)
2. share url (tab 1)
3. open url in new tab (tab2)
4. rotation angle is identical to tab 1 , zoom level is **identical** to tab 1
Reproduction:
1. open state: https://goo.gl/zNJwC3
2. press share url button
3. open url in new tab - all is good!
4. now back to https://goo.gl/zNJwC3
5. rotate overlay
6. press share url button
7. open url in new tab - **zoom level is different!**
|
1.0
|
Share URL - after rotating an overlay, zoom level (map extent) is wrong - Current:
1. open an overlay and zoom in and rotate (tab 1)
2. share url (tab 1)
3. open url in new tab (tab2)
4. rotation angle is identical to tab 1 , zoom level is **different** to tab 1
Expected:
1. open an overlay and zoom in and rotate (tab 1)
2. share url (tab 1)
3. open url in new tab (tab2)
4. rotation angle is identical to tab 1 , zoom level is **identical** to tab 1
Reproduction:
1. open state: https://goo.gl/zNJwC3
2. press share url button
3. open url in new tab - all is good!
4. now back to https://goo.gl/zNJwC3
5. rotate overlay
6. press share url button
7. open url in new tab - **zoom level is different!**
|
priority
|
share url after rotating an overlay zoom level map extent is wrong current open an overlay and zoom in and rotate tab share url tab open url in new tab rotation angle is identical to tab zoom level is different to tab expected open an overlay and zoom in and rotate tab share url tab open url in new tab rotation angle is identical to tab zoom level is identical to tab reproduction open state press share url button open url in new tab all is good now back to rotate overlay press share url button open url in new tab zoom level is different
| 1
|
760,255
| 26,634,764,375
|
IssuesEvent
|
2023-01-24 20:54:19
|
quickwit-oss/quickwit
|
https://api.github.com/repos/quickwit-oss/quickwit
|
closed
|
Update indexers clients pool on members changes
|
bug high-priority
|
The indexers' clients pool has a leak as we don't remove dead clients from it.
|
1.0
|
Update indexers clients pool on members changes - The indexers' clients pool has a leak as we don't remove dead clients from it.
|
priority
|
update indexers clients pool on members changes the indexers clients pool has a leak as we don t remove dead clients from it
| 1
|
511,022
| 14,851,931,036
|
IssuesEvent
|
2021-01-18 07:48:59
|
CST-technology/cstweb
|
https://api.github.com/repos/CST-technology/cstweb
|
closed
|
Main AM dashboard shows no data
|
bug high priority invalid
|
The "home" (http://35.247.175.5/Dashboard?baseID=1) page for AMs is showing no data for some Area Managers. It seems that the date selector is not working correctly. I can see visits in completed visits list, but the main page shows no records.
|
1.0
|
Main AM dashboard shows no data - The "home" (http://35.247.175.5/Dashboard?baseID=1) page for AMs is showing no data for some Area Managers. It seems that the date selector is not working correctly. I can see visits in completed visits list, but the main page shows no records.
|
priority
|
main am dashboard shows no data the home page for ams is showing no data for some area managers it seems that the date selector is not working correctly i can see visits in completed visits list but the main page shows no records
| 1
|
568,350
| 16,976,766,868
|
IssuesEvent
|
2021-06-30 00:54:08
|
gather-community/gather
|
https://api.github.com/repos/gather-community/gather
|
opened
|
Unique key violation on group update
|
area:groups priority:high quick win type:bug
|
At approximately 4:50 PM EDT earlier today (Monday, June 28), Mike B (who is a designated manager of two Shepherd Village groups -- LST Permaculture and LST Ecology Circle) attempted to add eight new members to the LST Ecology Circle group by editing the group page and adding the members. He also changed the name of the group before pressing the Save button. When he pressed the Save button, he received the “Something went wrong” error on a separate Web page. No changes were saved.
Then he tried adding just a few changes at a time, pressing the Save button and then adding more changes incrementally. Using this approach all of his Save commands worked without an error.
|
1.0
|
Unique key violation on group update - At approximately 4:50 PM EDT earlier today (Monday, June 28), Mike B (who is a designated manager of two Shepherd Village groups -- LST Permaculture and LST Ecology Circle) attempted to add eight new members to the LST Ecology Circle group by editing the group page and adding the members. He also changed the name of the group before pressing the Save button. When he pressed the Save button, he received the “Something went wrong” error on a separate Web page. No changes were saved.
Then he tried adding just a few changes at a time, pressing the Save button and then adding more changes incrementally. Using this approach all of his Save commands worked without an error.
|
priority
|
unique key violation on group update at approximately pm edt earlier today monday june mike b who is a designated manager of two shepherd village groups lst permaculture and lst ecology circle attempted to add eight new members to the lst ecology circle group by editing the group page and adding the members he also changed the name of the group before pressing the save button when he pressed the save button he received the “something went wrong” error on a separate web page no changes were saved then he tried adding just a few changes at a time pressing the save button and then adding more changes incrementally using this approach all of his save commands worked without an error
| 1
|
705,578
| 24,239,630,999
|
IssuesEvent
|
2022-09-27 04:58:32
|
ballerina-platform/ballerina-distribution
|
https://api.github.com/repos/ballerina-platform/ballerina-distribution
|
closed
|
Mac installer time increases with number of distributions
|
Type/Bug Priority/High Area/Installers
|
**Description:**
One of the reasons this happens is due to post [install script ](https://github.com/ballerina-platform/ballerina-distribution/blob/master/installers/mac/darwin/scripts/postinstall) with heavy `find` operations. There is no need to set permissions on existing distributions by the installer. Therefore we need to skip them.
Since the installer is touching unwanted files for the current installation this can be categorised as a bug.
I believe we solutions like below
## solution 1
```
cd __BALLERINA_VERSION__
find . -type d -exec chmod ugo+rx \{\} \;
find . -exec chmod ugo+r \{\} \;
```
## solution 2
We can also parallelise this stage into threads.
We should also analyse if there are more reasons for the slowdown at this stage of the installer.
**Steps to reproduce:**
**Affected Versions:**
**OS, DB, other environment details and versions:**
**Related Issues (optional):**
<!-- Any related issues such as sub tasks, issues reported in other repositories (e.g component repositories), similar problems, etc. -->
**Suggested Labels (optional):**
<!-- Optional comma separated list of suggested labels. Non committers can’t assign labels to issues, so this will help issue creators who are not a committer to suggest possible labels-->
**Suggested Assignees (optional):**
<!--Optional comma separated list of suggested team members who should attend the issue. Non committers can’t assign issues to assignees, so this will help issue creators who are not a committer to suggest possible assignees-->
|
1.0
|
Mac installer time increases with number of distributions - **Description:**
One of the reasons this happens is due to post [install script ](https://github.com/ballerina-platform/ballerina-distribution/blob/master/installers/mac/darwin/scripts/postinstall) with heavy `find` operations. There is no need to set permissions on existing distributions by the installer. Therefore we need to skip them.
Since the installer is touching unwanted files for the current installation this can be categorised as a bug.
I believe we solutions like below
## solution 1
```
cd __BALLERINA_VERSION__
find . -type d -exec chmod ugo+rx \{\} \;
find . -exec chmod ugo+r \{\} \;
```
## solution 2
We can also parallelise this stage into threads.
We should also analyse if there are more reasons for the slowdown at this stage of the installer.
**Steps to reproduce:**
**Affected Versions:**
**OS, DB, other environment details and versions:**
**Related Issues (optional):**
<!-- Any related issues such as sub tasks, issues reported in other repositories (e.g component repositories), similar problems, etc. -->
**Suggested Labels (optional):**
<!-- Optional comma separated list of suggested labels. Non committers can’t assign labels to issues, so this will help issue creators who are not a committer to suggest possible labels-->
**Suggested Assignees (optional):**
<!--Optional comma separated list of suggested team members who should attend the issue. Non committers can’t assign issues to assignees, so this will help issue creators who are not a committer to suggest possible assignees-->
|
priority
|
mac installer time increases with number of distributions description one of the reasons this happens is due to post with heavy find operations there is no need to set permissions on existing distributions by the installer therefore we need to skip them since the installer is touching unwanted files for the current installation this can be categorised as a bug i believe we solutions like below solution cd ballerina version find type d exec chmod ugo rx find exec chmod ugo r solution we can also parallelise this stage into threads we should also analyse if there are more reasons for the slowdown at this stage of the installer steps to reproduce affected versions os db other environment details and versions related issues optional suggested labels optional suggested assignees optional
| 1
|
205,960
| 7,107,635,826
|
IssuesEvent
|
2018-01-16 20:43:02
|
smartdevicelink/sdl_core
|
https://api.github.com/repos/smartdevicelink/sdl_core
|
closed
|
SDL doesn't apply sequence SUSPEND -> OnSDLAwake -> SUSPEND -> IGN_OFF for saving resumption data
|
Bug Contributor priority 1: High Maintainer priority 3: Major Occurrence 1: Always Severity 1: High
|
## Occurrence:
Always
## Steps to reproduce:
1. Make sure SDL is built with default flags
2. Start SDL and HMI
3. Connect mobile device
4. Register mobile application
5. Activate application in order to switch it to FULL HMI level
6. Add some data according to data resumption requirements, e.g. AddCommand
7. Send OnExitAllApplications(SUSPEND)
8. Send some resumption data again
## Expected result:
SDL does:
1. Store all applications resumption-related data on the file system
2. Send BC.OnSDLPersistenceComplete to HMI on data persistance complete
3. Continue remembering resumption related data (in case getting some from mobile application)
without sending OnHashChanged notification to mobile app. - OnHashChanged should be sent
only after OnSDLAwake notification.
## Actual result:
SDL does:
1. Save data in app_info.dat and send OnHashChanged notification
## Test script:
[1395_Resumption_data_IGN_OFF.lua](https://github.com/smartdevicelink/sdl_atf_test_scripts/blob/develop/test_scripts/Defects/4_5/1395_Resumption_data_IGN_OFF.lua)
## Environment:
SDL repo: https://github.com/smartdevicelink/sdl_core/tree/feature/extended_policy_functionality
SDL commit: 7bd5326
OS with SDL: Ubuntu 14.04
VM used for OS with SDL (yes/no): no
ATF version: aa5beae6ab1726a9b43ed2fa15f66c20d7f7883f
Transport: WiFi
## Attachments
[Uploading SmartDeviceLinkCore.log.zip…]()
Requirements:
[Data Resumption]:OnExitAllApplications(SUSPEND) in terms of resumption
[Data Resumption]:OnExitAllApplications(IGNITION_OFF) in terms of resumption
## Expected delivery
- [ ] Source code updates
- [ ] Code comments
- [ ] UTs add/update
- [ ] ATF tests add/update
- [ ] Manual tests
- [ ] Add/update CI plans/jobs
- [ ] SDD updates
- [ ] Guidelines update (sdl_core_guides)
- [ ] Guidelines update (sdl_hmi_integration_guidelines)
|
2.0
|
SDL doesn't apply sequence SUSPEND -> OnSDLAwake -> SUSPEND -> IGN_OFF for saving resumption data - ## Occurrence:
Always
## Steps to reproduce:
1. Make sure SDL is built with default flags
2. Start SDL and HMI
3. Connect mobile device
4. Register mobile application
5. Activate application in order to switch it to FULL HMI level
6. Add some data according to data resumption requirements, e.g. AddCommand
7. Send OnExitAllApplications(SUSPEND)
8. Send some resumption data again
## Expected result:
SDL does:
1. Store all applications resumption-related data on the file system
2. Send BC.OnSDLPersistenceComplete to HMI on data persistance complete
3. Continue remembering resumption related data (in case getting some from mobile application)
without sending OnHashChanged notification to mobile app. - OnHashChanged should be sent
only after OnSDLAwake notification.
## Actual result:
SDL does:
1. Save data in app_info.dat and send OnHashChanged notification
## Test script:
[1395_Resumption_data_IGN_OFF.lua](https://github.com/smartdevicelink/sdl_atf_test_scripts/blob/develop/test_scripts/Defects/4_5/1395_Resumption_data_IGN_OFF.lua)
## Environment:
SDL repo: https://github.com/smartdevicelink/sdl_core/tree/feature/extended_policy_functionality
SDL commit: 7bd5326
OS with SDL: Ubuntu 14.04
VM used for OS with SDL (yes/no): no
ATF version: aa5beae6ab1726a9b43ed2fa15f66c20d7f7883f
Transport: WiFi
## Attachments
[Uploading SmartDeviceLinkCore.log.zip…]()
Requirements:
[Data Resumption]:OnExitAllApplications(SUSPEND) in terms of resumption
[Data Resumption]:OnExitAllApplications(IGNITION_OFF) in terms of resumption
## Expected delivery
- [ ] Source code updates
- [ ] Code comments
- [ ] UTs add/update
- [ ] ATF tests add/update
- [ ] Manual tests
- [ ] Add/update CI plans/jobs
- [ ] SDD updates
- [ ] Guidelines update (sdl_core_guides)
- [ ] Guidelines update (sdl_hmi_integration_guidelines)
|
priority
|
sdl doesn t apply sequence suspend onsdlawake suspend ign off for saving resumption data occurrence always steps to reproduce make sure sdl is built with default flags start sdl and hmi connect mobile device register mobile application activate application in order to switch it to full hmi level add some data according to data resumption requirements e g addcommand send onexitallapplications suspend send some resumption data again expected result sdl does store all applications resumption related data on the file system send bc onsdlpersistencecomplete to hmi on data persistance complete continue remembering resumption related data in case getting some from mobile application without sending onhashchanged notification to mobile app onhashchanged should be sent only after onsdlawake notification actual result sdl does save data in app info dat and send onhashchanged notification test script environment sdl repo sdl commit os with sdl ubuntu vm used for os with sdl yes no no atf version transport wifi attachments requirements onexitallapplications suspend in terms of resumption onexitallapplications ignition off in terms of resumption expected delivery source code updates code comments uts add update atf tests add update manual tests add update ci plans jobs sdd updates guidelines update sdl core guides guidelines update sdl hmi integration guidelines
| 1
|
400,968
| 11,783,672,669
|
IssuesEvent
|
2020-03-17 06:21:55
|
webcompat/web-bugs
|
https://api.github.com/repos/webcompat/web-bugs
|
closed
|
www.washingtonpost.com - see bug description
|
browser-focus-geckoview engine-gecko ml-needsdiagnosis-false ml-probability-high priority-important
|
<!-- @browser: Firefox Mobile 74.0 -->
<!-- @ua_header: Mozilla/5.0 (Android 9; Mobile; rv:74.0) Gecko/74.0 Firefox/74.0 -->
<!-- @reported_with: -->
<!-- @public_url: https://github.com/webcompat/web-bugs/issues/50298 -->
<!-- @extra_labels: browser-focus-geckoview -->
**URL**: https://www.washingtonpost.com/gdpr-consent/?next_url=https://www.washingtonpost.com/graphics/2020/world/corona-simulator/
**Browser / Version**: Firefox Mobile 74.0
**Operating System**: Android
**Tested Another Browser**: Unknown
**Problem type**: Something else
**Description**: i dont see the checkbox keft from i Agree
**Steps to Reproduce**:
<details>
<summary>Browser Configuration</summary>
<ul>
<li>None</li>
</ul>
</details>
_From [webcompat.com](https://webcompat.com/) with ❤️_
|
1.0
|
www.washingtonpost.com - see bug description - <!-- @browser: Firefox Mobile 74.0 -->
<!-- @ua_header: Mozilla/5.0 (Android 9; Mobile; rv:74.0) Gecko/74.0 Firefox/74.0 -->
<!-- @reported_with: -->
<!-- @public_url: https://github.com/webcompat/web-bugs/issues/50298 -->
<!-- @extra_labels: browser-focus-geckoview -->
**URL**: https://www.washingtonpost.com/gdpr-consent/?next_url=https://www.washingtonpost.com/graphics/2020/world/corona-simulator/
**Browser / Version**: Firefox Mobile 74.0
**Operating System**: Android
**Tested Another Browser**: Unknown
**Problem type**: Something else
**Description**: i dont see the checkbox keft from i Agree
**Steps to Reproduce**:
<details>
<summary>Browser Configuration</summary>
<ul>
<li>None</li>
</ul>
</details>
_From [webcompat.com](https://webcompat.com/) with ❤️_
|
priority
|
see bug description url browser version firefox mobile operating system android tested another browser unknown problem type something else description i dont see the checkbox keft from i agree steps to reproduce browser configuration none from with ❤️
| 1
|
164,211
| 6,221,441,002
|
IssuesEvent
|
2017-07-10 05:43:56
|
EyeSeeTea/dhis2-android-dashboard
|
https://api.github.com/repos/EyeSeeTea/dhis2-android-dashboard
|
closed
|
Rotating orientation crashes
|
complexity - med (1-5hr) priority - high type - bug
|
User reports this:
Testing on three different devices (LG G5 7.0, Sony Z3 6.0, Yuntab E706 5.1) I have found the following:
When in the dashboard tab, rotating orientation will cause a crash across all devices on all server versions (Current 2.27, Prev1 2.26 and Prev2 2.25). On the interpretation tab, I was able to rotate on all devices without any problems.
Switching to the interpretations tab on the Yuntab E706 (5.1) on the Current 2.27 server also causes an instant crash. It is fine on my other two devices on 2.27 and there are no problems with previous server versions on the Yuntab.
|
1.0
|
Rotating orientation crashes - User reports this:
Testing on three different devices (LG G5 7.0, Sony Z3 6.0, Yuntab E706 5.1) I have found the following:
When in the dashboard tab, rotating orientation will cause a crash across all devices on all server versions (Current 2.27, Prev1 2.26 and Prev2 2.25). On the interpretation tab, I was able to rotate on all devices without any problems.
Switching to the interpretations tab on the Yuntab E706 (5.1) on the Current 2.27 server also causes an instant crash. It is fine on my other two devices on 2.27 and there are no problems with previous server versions on the Yuntab.
|
priority
|
rotating orientation crashes user reports this testing on three different devices lg sony yuntab i have found the following when in the dashboard tab rotating orientation will cause a crash across all devices on all server versions current and on the interpretation tab i was able to rotate on all devices without any problems switching to the interpretations tab on the yuntab on the current server also causes an instant crash it is fine on my other two devices on and there are no problems with previous server versions on the yuntab
| 1
|
592,337
| 17,875,894,480
|
IssuesEvent
|
2021-09-07 03:35:13
|
staynomad/Nomad-Front
|
https://api.github.com/repos/staynomad/Nomad-Front
|
opened
|
Best Budget and Family Size containers not displaying listings
|
dev:bug difficulty:medium priority:high
|
# Background
<!--- Put any relevant background information here. --->
Network tab displays 3 successful calls to the `filteredListings` route which is expected. Could possibly be a backend issue.
# Task
<!--- Put the task here (ideally bullet points). --->
- Investigate issue causing Best Budget and Family Size containers under Explore page to not render any listings
- Update route or API call to properly return:
- 5 cheapest listings for Best Budget
- 5 largest (most maxGuests) listings for Family Size
# Done When
<!--- Put the completion criteria for the issue here. --->
- Best Budget displays 5 cheapest listings
- Family Size displays 5 largest (most maxGuests) listings
|
1.0
|
Best Budget and Family Size containers not displaying listings - # Background
<!--- Put any relevant background information here. --->
Network tab displays 3 successful calls to the `filteredListings` route which is expected. Could possibly be a backend issue.
# Task
<!--- Put the task here (ideally bullet points). --->
- Investigate issue causing Best Budget and Family Size containers under Explore page to not render any listings
- Update route or API call to properly return:
- 5 cheapest listings for Best Budget
- 5 largest (most maxGuests) listings for Family Size
# Done When
<!--- Put the completion criteria for the issue here. --->
- Best Budget displays 5 cheapest listings
- Family Size displays 5 largest (most maxGuests) listings
|
priority
|
best budget and family size containers not displaying listings background network tab displays successful calls to the filteredlistings route which is expected could possibly be a backend issue task investigate issue causing best budget and family size containers under explore page to not render any listings update route or api call to properly return cheapest listings for best budget largest most maxguests listings for family size done when best budget displays cheapest listings family size displays largest most maxguests listings
| 1
|
346,187
| 10,409,167,322
|
IssuesEvent
|
2019-09-13 08:02:15
|
AY1920S1-CS2113T-W17-1/main
|
https://api.github.com/repos/AY1920S1-CS2113T-W17-1/main
|
opened
|
[Todo]A-Gradle
|
priority.High
|
To implement:
Gradle with all dependencies & plugin found in https://github.com/AY1920S1-CS2113T-W17-1/main/blob/master/tutorials/gradleTutorial.md#introduction
Plugin
- CheckStyle
- Shadow
Dependencies
- JUnit
|
1.0
|
[Todo]A-Gradle - To implement:
Gradle with all dependencies & plugin found in https://github.com/AY1920S1-CS2113T-W17-1/main/blob/master/tutorials/gradleTutorial.md#introduction
Plugin
- CheckStyle
- Shadow
Dependencies
- JUnit
|
priority
|
a gradle to implement gradle with all dependencies plugin found in plugin checkstyle shadow dependencies junit
| 1
|
824,827
| 31,224,894,493
|
IssuesEvent
|
2023-08-19 01:20:44
|
dnd-side-project/dnd-9th-9-frontend
|
https://api.github.com/repos/dnd-side-project/dnd-9th-9-frontend
|
opened
|
[FEAT]운동 기록하기 추가
|
🔥 high priority 💫 feature
|
## Description
운동 기록 페이지에서 운동 기록하기 서비스를 추가합니다.
## To-do
- [ ] 특정 날짜 운동 기록하기 기능 추가
- [ ] 메모하기 기능 추가
## ETC
|
1.0
|
[FEAT]운동 기록하기 추가 - ## Description
운동 기록 페이지에서 운동 기록하기 서비스를 추가합니다.
## To-do
- [ ] 특정 날짜 운동 기록하기 기능 추가
- [ ] 메모하기 기능 추가
## ETC
|
priority
|
운동 기록하기 추가 description 운동 기록 페이지에서 운동 기록하기 서비스를 추가합니다 to do 특정 날짜 운동 기록하기 기능 추가 메모하기 기능 추가 etc
| 1
|
157,508
| 6,007,704,877
|
IssuesEvent
|
2017-06-06 04:46:47
|
Kademi/kademi-dev
|
https://api.github.com/repos/Kademi/kademi-dev
|
opened
|
Demo: Cannot step through password reset workflow
|
Demo workflow High priority
|
I created this email and fired it off: http://rewardtest1.admin.kademi.us/groupEmails/12591225/#sendInfo-tab
I received the email and clicked through to the wrong tempalte, even though I chose the correct website.
It should have opened our shiny password reset form here: http://owensdemo1.kademi.us//theme/apps/user/contenteditor?fileName=passwordReset.html&miltonUserUrl=/users/patrick-707421&miltonUserUrlHash=5506e72d-c7f7-47ae-ba1d-c430225db0cd:VZZHvPpm4UMEwwEjhoOxdGxJ0oI
After completing the reset form, I got this error:
It should either send me to the login page, or direct me to my dashboard. Open to what this latter workflow show be.
|
1.0
|
Demo: Cannot step through password reset workflow - I created this email and fired it off: http://rewardtest1.admin.kademi.us/groupEmails/12591225/#sendInfo-tab
I received the email and clicked through to the wrong tempalte, even though I chose the correct website.
It should have opened our shiny password reset form here: http://owensdemo1.kademi.us//theme/apps/user/contenteditor?fileName=passwordReset.html&miltonUserUrl=/users/patrick-707421&miltonUserUrlHash=5506e72d-c7f7-47ae-ba1d-c430225db0cd:VZZHvPpm4UMEwwEjhoOxdGxJ0oI
After completing the reset form, I got this error:
It should either send me to the login page, or direct me to my dashboard. Open to what this latter workflow show be.
|
priority
|
demo cannot step through password reset workflow i created this email and fired it off i received the email and clicked through to the wrong tempalte even though i chose the correct website it should have opened our shiny password reset form here after completing the reset form i got this error it should either send me to the login page or direct me to my dashboard open to what this latter workflow show be
| 1
|
830,899
| 32,029,606,079
|
IssuesEvent
|
2023-09-22 11:20:43
|
woocommerce/woocommerce
|
https://api.github.com/repos/woocommerce/woocommerce
|
opened
|
[Epic] Pre-publish modal
|
priority: high Epic focus: new product ux [team:Mothra] team: Mothra
|
Let's add a few more missing features and come up with a way to handle errors across different tabs in the new product editing experience. As discussed on multiple occasions elsewhere, we'll go with a customized version of the post editor's pre-publish modal. We'll add a new section with errors that the user can view and interact with before publishing a product in their store.
**Design (temporary link)**
AkVNGImLgSqCObTQ3idVn7-fi-3359_344908
<img width="877" alt="image" src="https://github.com/woocommerce/woocommerce/assets/79307566/b033fa19-e938-491d-aeb9-174c3b1c79fa">
**Acceptance criteria**
- [ ] Visibility and scheduling
- [ ] When the user clicks `Add to store` in the top right corner, a panel slides out from the right edge of the screen. It looks and works exactly like the pre-publish modal in the post/site editor.
- [ ] The `Visibility` section contains the same options as the one in the Organization tab. They look and work the same, e.g., when the Require a password box is checked, the user can enter the password directly in the panel. The section and the block in the Organization tab are fully synced.
- [ ] The title `Visibility: Public` changes to `Visibility: Hidden` if `Hide in product catalog` or `Hide from search results` as checked (there’s also a badge in the title bar)
- [ ] The `Add: xxx` section works exactly as in the post/site editor. When expanded, the user can select the time and date. If no custom time and date is selected, the section says `Add: Immediately`. If the user adds a custom time and date, it says: `Add: [date] [time]`, just like in the post/site editor.
- [ ] When the user selects a future time and date, the top button's label changes from `Add` to `Schedule`.
- [ ] The `Always show pre-publish checks` disables the pre-publish modal and publishes the product immediately when the user clicks `Add to store`. The only exception is when the form contains errors that the user must take action on.
- [ ] Error handling
- [ ] The section title includes the total number of identified issues. If there's just one issue, the title says: `1 issue found`. If there are more, it says: `X issues found`.
- [ ] When the pre-publish modal is open, the `Add` button is disabled until all issues are resolved.
- [ ] We list validation messages for all affected fields the same as they're displayed below them.
- [ ] User can click on each message or use the arrows in the corner to go between affected fields and solve them one by one.
- [ ] If there are no more next or previous errors, the arrow button is disabled and changes color to Gutenberg-400.
- [ ] When an error is solved, it immediately disappears from the list.
- [ ] If the` Always show pre-publish checks` box was unchecked before, we don't show it at the bottom of the panel (the panel is only shown because of the errors).
|
1.0
|
[Epic] Pre-publish modal - Let's add a few more missing features and come up with a way to handle errors across different tabs in the new product editing experience. As discussed on multiple occasions elsewhere, we'll go with a customized version of the post editor's pre-publish modal. We'll add a new section with errors that the user can view and interact with before publishing a product in their store.
**Design (temporary link)**
AkVNGImLgSqCObTQ3idVn7-fi-3359_344908
<img width="877" alt="image" src="https://github.com/woocommerce/woocommerce/assets/79307566/b033fa19-e938-491d-aeb9-174c3b1c79fa">
**Acceptance criteria**
- [ ] Visibility and scheduling
- [ ] When the user clicks `Add to store` in the top right corner, a panel slides out from the right edge of the screen. It looks and works exactly like the pre-publish modal in the post/site editor.
- [ ] The `Visibility` section contains the same options as the one in the Organization tab. They look and work the same, e.g., when the Require a password box is checked, the user can enter the password directly in the panel. The section and the block in the Organization tab are fully synced.
- [ ] The title `Visibility: Public` changes to `Visibility: Hidden` if `Hide in product catalog` or `Hide from search results` as checked (there’s also a badge in the title bar)
- [ ] The `Add: xxx` section works exactly as in the post/site editor. When expanded, the user can select the time and date. If no custom time and date is selected, the section says `Add: Immediately`. If the user adds a custom time and date, it says: `Add: [date] [time]`, just like in the post/site editor.
- [ ] When the user selects a future time and date, the top button's label changes from `Add` to `Schedule`.
- [ ] The `Always show pre-publish checks` disables the pre-publish modal and publishes the product immediately when the user clicks `Add to store`. The only exception is when the form contains errors that the user must take action on.
- [ ] Error handling
- [ ] The section title includes the total number of identified issues. If there's just one issue, the title says: `1 issue found`. If there are more, it says: `X issues found`.
- [ ] When the pre-publish modal is open, the `Add` button is disabled until all issues are resolved.
- [ ] We list validation messages for all affected fields the same as they're displayed below them.
- [ ] User can click on each message or use the arrows in the corner to go between affected fields and solve them one by one.
- [ ] If there are no more next or previous errors, the arrow button is disabled and changes color to Gutenberg-400.
- [ ] When an error is solved, it immediately disappears from the list.
- [ ] If the` Always show pre-publish checks` box was unchecked before, we don't show it at the bottom of the panel (the panel is only shown because of the errors).
|
priority
|
pre publish modal let s add a few more missing features and come up with a way to handle errors across different tabs in the new product editing experience as discussed on multiple occasions elsewhere we ll go with a customized version of the post editor s pre publish modal we ll add a new section with errors that the user can view and interact with before publishing a product in their store design temporary link fi img width alt image src acceptance criteria visibility and scheduling when the user clicks add to store in the top right corner a panel slides out from the right edge of the screen it looks and works exactly like the pre publish modal in the post site editor the visibility section contains the same options as the one in the organization tab they look and work the same e g when the require a password box is checked the user can enter the password directly in the panel the section and the block in the organization tab are fully synced the title visibility public changes to visibility hidden if hide in product catalog or hide from search results as checked there’s also a badge in the title bar the add xxx section works exactly as in the post site editor when expanded the user can select the time and date if no custom time and date is selected the section says add immediately if the user adds a custom time and date it says add just like in the post site editor when the user selects a future time and date the top button s label changes from add to schedule the always show pre publish checks disables the pre publish modal and publishes the product immediately when the user clicks add to store the only exception is when the form contains errors that the user must take action on error handling the section title includes the total number of identified issues if there s just one issue the title says issue found if there are more it says x issues found when the pre publish modal is open the add button is disabled until all issues are resolved we list validation messages for all affected fields the same as they re displayed below them user can click on each message or use the arrows in the corner to go between affected fields and solve them one by one if there are no more next or previous errors the arrow button is disabled and changes color to gutenberg when an error is solved it immediately disappears from the list if the always show pre publish checks box was unchecked before we don t show it at the bottom of the panel the panel is only shown because of the errors
| 1
|
293,214
| 8,973,714,488
|
IssuesEvent
|
2019-01-29 21:48:47
|
TylerBarnes/wordsby
|
https://api.github.com/repos/TylerBarnes/wordsby
|
closed
|
Add option for "instant" builds so clients don't have to wait to see changes
|
enhancement high priority
|
This option will allow for an "instant" build of the site.
Admins will publish content and see it on the live site immediately.
If the option is enabled, wordsby will store the last build time/date. WordPress will also have a last published date at a new rest api endpoint which should return only a few lines.
**For ex:**
```json
{
"last_publish": 1487730600000,
"endpoint": {
"collections": 1487730600000,
"menus": 1487730000000,
"options": 1487730000000,
"media": 1487730600000
}
}
```
When a user visits a page on the gatsby frontend, the site will compare the last build time to the last publish time to determine if a build is currently underway.
If the last publish time was after the last build time, wordsby will pull live data from the WP rest api in the same way previews currently work. This data will be stored in sessionstorage along with a timestamp of when the data was pulled so it isn't reloaded on every load of the same page.
If the last publish date is before the last build date AND there is sessionstorage, we will remove the sessionstorage data and use the regular gatsby data. Otherwise, we wont do anything.
**Steps to create this feature:**
- [x] Add a new endpoint that gets the last publish time by page id `wp-json/wp/v1/last_publish/4556`
- [x] Make sure there are active endpoints for single collections by ID
- [x] add an option to `gatsby-plugin-wordsby` for "instantPublish"
- [x] In `gatsby-node`, use [`sourceNodes`](https://www.gatsbyjs.org/docs/node-apis/#sourceNodes) api to create a `lastBuild` graphql endpoint.
- [x] wrap a component around pages which passes through all page data to pages untouched
- [x] in this component, get the `lastBuild` data from graphql and make a fetch to `/wp-json/v1/last_publish` to determine if the current data is stale
- [x] If the data is stale, check if there is non-stale data in localstorage, if there is non-stale data use it, else fetch the necessary rest api data and modify the page data to replace the stale content with updated content. Store this data in localstorage with the current timestamp and last publish timestamp.
- [x] If the data is not stale don't do anything BUT check localstorage and delete the data there if there is some.
- [x] return srcset from wordpress + base64 LQIP when getting data for instant build
- [x] update wordsby img to use this new WP image data
- [x] Add env variable to prevent instant publish in development
- [ ] TEST
|
1.0
|
Add option for "instant" builds so clients don't have to wait to see changes - This option will allow for an "instant" build of the site.
Admins will publish content and see it on the live site immediately.
If the option is enabled, wordsby will store the last build time/date. WordPress will also have a last published date at a new rest api endpoint which should return only a few lines.
**For ex:**
```json
{
"last_publish": 1487730600000,
"endpoint": {
"collections": 1487730600000,
"menus": 1487730000000,
"options": 1487730000000,
"media": 1487730600000
}
}
```
When a user visits a page on the gatsby frontend, the site will compare the last build time to the last publish time to determine if a build is currently underway.
If the last publish time was after the last build time, wordsby will pull live data from the WP rest api in the same way previews currently work. This data will be stored in sessionstorage along with a timestamp of when the data was pulled so it isn't reloaded on every load of the same page.
If the last publish date is before the last build date AND there is sessionstorage, we will remove the sessionstorage data and use the regular gatsby data. Otherwise, we wont do anything.
**Steps to create this feature:**
- [x] Add a new endpoint that gets the last publish time by page id `wp-json/wp/v1/last_publish/4556`
- [x] Make sure there are active endpoints for single collections by ID
- [x] add an option to `gatsby-plugin-wordsby` for "instantPublish"
- [x] In `gatsby-node`, use [`sourceNodes`](https://www.gatsbyjs.org/docs/node-apis/#sourceNodes) api to create a `lastBuild` graphql endpoint.
- [x] wrap a component around pages which passes through all page data to pages untouched
- [x] in this component, get the `lastBuild` data from graphql and make a fetch to `/wp-json/v1/last_publish` to determine if the current data is stale
- [x] If the data is stale, check if there is non-stale data in localstorage, if there is non-stale data use it, else fetch the necessary rest api data and modify the page data to replace the stale content with updated content. Store this data in localstorage with the current timestamp and last publish timestamp.
- [x] If the data is not stale don't do anything BUT check localstorage and delete the data there if there is some.
- [x] return srcset from wordpress + base64 LQIP when getting data for instant build
- [x] update wordsby img to use this new WP image data
- [x] Add env variable to prevent instant publish in development
- [ ] TEST
|
priority
|
add option for instant builds so clients don t have to wait to see changes this option will allow for an instant build of the site admins will publish content and see it on the live site immediately if the option is enabled wordsby will store the last build time date wordpress will also have a last published date at a new rest api endpoint which should return only a few lines for ex json last publish endpoint collections menus options media when a user visits a page on the gatsby frontend the site will compare the last build time to the last publish time to determine if a build is currently underway if the last publish time was after the last build time wordsby will pull live data from the wp rest api in the same way previews currently work this data will be stored in sessionstorage along with a timestamp of when the data was pulled so it isn t reloaded on every load of the same page if the last publish date is before the last build date and there is sessionstorage we will remove the sessionstorage data and use the regular gatsby data otherwise we wont do anything steps to create this feature add a new endpoint that gets the last publish time by page id wp json wp last publish make sure there are active endpoints for single collections by id add an option to gatsby plugin wordsby for instantpublish in gatsby node use api to create a lastbuild graphql endpoint wrap a component around pages which passes through all page data to pages untouched in this component get the lastbuild data from graphql and make a fetch to wp json last publish to determine if the current data is stale if the data is stale check if there is non stale data in localstorage if there is non stale data use it else fetch the necessary rest api data and modify the page data to replace the stale content with updated content store this data in localstorage with the current timestamp and last publish timestamp if the data is not stale don t do anything but check localstorage and delete the data there if there is some return srcset from wordpress lqip when getting data for instant build update wordsby img to use this new wp image data add env variable to prevent instant publish in development test
| 1
|
714,641
| 24,568,820,788
|
IssuesEvent
|
2022-10-13 06:54:25
|
Fammeo/EasyCloudBooks
|
https://api.github.com/repos/Fammeo/EasyCloudBooks
|
closed
|
Project Page - Custom Field View - Role Required
|
IMP approved High Priority
|
Problem -
1. Previously "Report" was Role name that provides Role requirement to this functionality
2. Previous design Menu name was Report for All Custom Field View for Contact , Company, Project so Role name was Report
3. After "Report" role removal, Project Custom Field List Role is missing
4. so New User can not assign Role for This page
5. Company and Contact Custom Fields are aligned with Company / Contact Edit Role, so no problem for them, They also previously had Report Role, but now using Edit Role
Solution-
Bring back Report Role for Project only, as Company / Contact works correctly, they do not require any further change
Technical Details-
1. New Role / API changed required to accommodate this
initiated by @mitulpanch
verified by @vinpahilwani
|
1.0
|
Project Page - Custom Field View - Role Required - Problem -
1. Previously "Report" was Role name that provides Role requirement to this functionality
2. Previous design Menu name was Report for All Custom Field View for Contact , Company, Project so Role name was Report
3. After "Report" role removal, Project Custom Field List Role is missing
4. so New User can not assign Role for This page
5. Company and Contact Custom Fields are aligned with Company / Contact Edit Role, so no problem for them, They also previously had Report Role, but now using Edit Role
Solution-
Bring back Report Role for Project only, as Company / Contact works correctly, they do not require any further change
Technical Details-
1. New Role / API changed required to accommodate this
initiated by @mitulpanch
verified by @vinpahilwani
|
priority
|
project page custom field view role required problem previously report was role name that provides role requirement to this functionality previous design menu name was report for all custom field view for contact company project so role name was report after report role removal project custom field list role is missing so new user can not assign role for this page company and contact custom fields are aligned with company contact edit role so no problem for them they also previously had report role but now using edit role solution bring back report role for project only as company contact works correctly they do not require any further change technical details new role api changed required to accommodate this initiated by mitulpanch verified by vinpahilwani
| 1
|
163,891
| 6,216,455,365
|
IssuesEvent
|
2017-07-08 03:59:57
|
scality/Arsenal
|
https://api.github.com/repos/scality/Arsenal
|
closed
|
Listing Implementation Issue
|
bug priority high
|
versions of the product: all
affects: bucketfile and bucketclient backend
We should be able to list with both a 'prefix' and a 'marker' while having a delimiter.
Get now, _getStartIndex() masks the prefix if you have a marker.
E.g.
```
?prefix=X11/&marker=X11%2FResConfigP.h
```
gives for file names
```
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 3.6 kB ResourceI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 2.9 kB SM/SM.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 11.0 kB SM/SMlib.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 4.7 kB SM/SMproto.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 5.1 kB SelectionI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 17.0 kB Shell.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 0.2 kB ShellI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 12.4 kB ShellP.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 29.7 kB StringDefs.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 3.9 kB Sunkeysym.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 4.2 kB ThreadsI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 16.8 kB TranslateI.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.3 kB VarargsI.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.7 kB Vendor.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 3.5 kB VendorP.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 19.7 kB X.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 13.2 kB XF86keysym.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 30.3 kB XKBlib.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 3.9 kB XWDFile.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 4.5 kB Xalloca.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.9 kB Xarch.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.5 kB Xatom.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 3.7 kB Xauth.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 20.8 kB Xcms.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.3 kB Xdefs.h
```
As we see some CommonPrefixes are listed as files.
The bug is located here: https://github.com/scality/Arsenal/blob/master/lib/algos/list/delimiter.js
It seems there are other inconsistencies in the code.
Please provide consistent functional (for bucketfile) and end-to-end (for metadata) test scenarios.
|
1.0
|
Listing Implementation Issue - versions of the product: all
affects: bucketfile and bucketclient backend
We should be able to list with both a 'prefix' and a 'marker' while having a delimiter.
Get now, _getStartIndex() masks the prefix if you have a marker.
E.g.
```
?prefix=X11/&marker=X11%2FResConfigP.h
```
gives for file names
```
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 3.6 kB ResourceI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 2.9 kB SM/SM.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 11.0 kB SM/SMlib.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 4.7 kB SM/SMproto.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 5.1 kB SelectionI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 17.0 kB Shell.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 0.2 kB ShellI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 12.4 kB ShellP.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 29.7 kB StringDefs.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 3.9 kB Sunkeysym.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 4.2 kB ThreadsI.h
Mon Aug 29 2016 23:53:50 GMT+0200 (CEST) 16.8 kB TranslateI.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.3 kB VarargsI.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.7 kB Vendor.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 3.5 kB VendorP.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 19.7 kB X.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 13.2 kB XF86keysym.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 30.3 kB XKBlib.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 3.9 kB XWDFile.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 4.5 kB Xalloca.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.9 kB Xarch.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.5 kB Xatom.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 3.7 kB Xauth.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 20.8 kB Xcms.h
Mon Aug 29 2016 23:53:51 GMT+0200 (CEST) 2.3 kB Xdefs.h
```
As we see some CommonPrefixes are listed as files.
The bug is located here: https://github.com/scality/Arsenal/blob/master/lib/algos/list/delimiter.js
It seems there are other inconsistencies in the code.
Please provide consistent functional (for bucketfile) and end-to-end (for metadata) test scenarios.
|
priority
|
listing implementation issue versions of the product all affects bucketfile and bucketclient backend we should be able to list with both a prefix and a marker while having a delimiter get now getstartindex masks the prefix if you have a marker e g prefix marker h gives for file names mon aug gmt cest kb resourcei h mon aug gmt cest kb sm sm h mon aug gmt cest kb sm smlib h mon aug gmt cest kb sm smproto h mon aug gmt cest kb selectioni h mon aug gmt cest kb shell h mon aug gmt cest kb shelli h mon aug gmt cest kb shellp h mon aug gmt cest kb stringdefs h mon aug gmt cest kb sunkeysym h mon aug gmt cest kb threadsi h mon aug gmt cest kb translatei h mon aug gmt cest kb varargsi h mon aug gmt cest kb vendor h mon aug gmt cest kb vendorp h mon aug gmt cest kb x h mon aug gmt cest kb h mon aug gmt cest kb xkblib h mon aug gmt cest kb xwdfile h mon aug gmt cest kb xalloca h mon aug gmt cest kb xarch h mon aug gmt cest kb xatom h mon aug gmt cest kb xauth h mon aug gmt cest kb xcms h mon aug gmt cest kb xdefs h as we see some commonprefixes are listed as files the bug is located here it seems there are other inconsistencies in the code please provide consistent functional for bucketfile and end to end for metadata test scenarios
| 1
|
580,839
| 17,268,224,314
|
IssuesEvent
|
2021-07-22 16:09:29
|
GiganticMinecraft/SeichiAssist
|
https://api.github.com/repos/GiganticMinecraft/SeichiAssist
|
closed
|
不定期にTPSが極端に低下する(1〜2前後)
|
Place: Production Priority: High bug
|
発生トリガーは不明。一度発生すると、再起動をかけるまでは高負荷の状態が継続する。
timingsの結果を元にホッパーの機能抑制対応を行なったが、それでも発生することを確認。その際に取ったTimingsに主な負荷要因がSeichiAssistである旨が現れた為、チケット起票しました。
```
SeichiAssist v1.8.3 Total: 37.416 s Pct: 28.31%
Pct Total Pct Tick Total Avg PerTick Count Event
20.19% 98.79% 26.67 s 49.39 ms 1.0 0.5k Task: OnBukkitServerThread$$Lambda$1752/1083274279(Single)
4.46% 81.79% 5.89 s 40.90 ms 0.3 0.1k PlayerBlockBreakListener::onPlayerBreakBlockFinally(BlockBreakEvent)
3.51% 62.25% 4.64 s 31.12 ms 0.3 0.2k PlayerBlockBreakListener::onPlayerActiveSkillEvent(BlockBreakEvent)
0.05% 0.25% 0.07 s 0.13 ms 6.2 3.3k PlayerClickListener::onPlayerRightClickIronTrapDoor(PlayerInteractEvent)
0.03% 0.13% 0.03 s 0.06 ms 6.2 3.3k PlayerClickListener::onPlayerActiveSkillToggleEvent(PlayerInteractEvent)
0.02% 0.09% 0.02 s 0.04 ms 9.0 4.8k RescuePlayerListener::onPlayerFallenToVoid(PlayerMoveEvent)
0.02% 0.30% 0.02 s 0.15 ms 0.3 0.2k MebiusInteractionResponder::onBlockBreak(BlockBreakEvent)
0.01% 10.78% 0.01 s 5.39 ms 0.0 0.0k PlayerDeathEventListener::onDeath(PlayerDeathEvent)
0.01% 0.04% 0.01 s 0.02 ms 6.2 3.3k HalloweenItemListener$::onPlayerRightClickWithHalloweenHoe(PlayerInteractEvent)
0.01% 0.10% 0.01 s 0.05 ms 0.3 0.1k MebiusLevelUpTrialListener::tryMebiusLevelUpOn(BlockBreakEvent)
0.00% 0.07% 0.01 s 0.04 ms 0.3 0.2k BuildExpIncrementer::onEvent(BlockPlaceEvent)
0.00% 0.02% 0.00 s 0.01 ms 6.2 3.3k BuildMainMenuOpener::onPlayerLeftClickWithStick(PlayerInteractEvent)
0.00% 0.02% 0.00 s 0.01 ms 6.2 3.3k PlayerClickListener::onPlayerActiveSkillEvent(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.01 ms 6.2 3.3k PlayerClickListener::onPlayerMenuEvent(PlayerInteractEvent)
0.00% 0.05% 0.00 s 0.03 ms 0.3 0.1k MebiusDropTrialListener::tryMebiusDropOn(BlockBreakEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k BlockLineUpTriggerListener::onBlockLineUpSkillTrigger(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k PlayerClickListener::onPlayerRightClickMineHeadEvent(PlayerInteractEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.3 0.2k PlayerBlockBreakListener::onPlayerBlockHalf(BlockBreakEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k TilingSkillTriggerListener::onTilingSkillTrigger(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k PlayerClickListener::onPlayerRightClickGachaEvent(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k OpenPocketInventoryOnPlacingEnderPortalFrame::onInteractEvent(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k ExpBottleStackUsageController::onPlayerRightClickExpBottleEvent(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k PlayerClickListener::onPlayerOpenMenuWithSomething(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k SpawnRegionProjectileInterceptor$::beforeProjectileLaunch(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k ChristmasItemListener::onPlayerConsumeChristmasCake(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.01 ms 0.3 0.1k ChristmasItemListener::onChristmasSockPopped(BlockBreakEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.1 3.3k AnniversaryListener::onPlayerRightClickMendingBook(PlayerInteractEvent)
0.00% 0.03% 0.00 s 0.01 ms 0.1 0.1k PlayerPickupItemListener::onPickupMineStackItem(PlayerPickupItemEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.3 0.1k NewYearListener::onNewYearBagPopped(BlockBreakEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.3 0.2k PlayerItemMigrationController::onBlockPlace(BlockPlaceEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.1 0.1k PlayerInventoryListener::onGachaRingoEvent(InventoryCloseEvent)
0.00% 0.24% 0.00 s 0.12 ms 0.0 0.0k AnniversaryListener::onPlayerDeath(PlayerDeathEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.1 0.0k MenuHandler::onInventoryClick(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.3 0.2k AnniversaryListener::onPlayerPlaceSapling(BlockPlaceEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.3 0.2k AnniversaryListener::onPlayerBreakBlockWithAnniversaryShovel(BlockBreakEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.1k PlayerInventoryListener::onOreTradeEvent(InventoryCloseEvent)
0.00% 0.19% 0.00 s 0.10 ms 0.0 0.0k BungeeSemaphoreCooperator::onQuit(PlayerQuitEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onGiganticBerserkMenuEvent(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k RegionInventoryListener::onPlayerClickRegionTemplateMenu(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.1k PlayerInventoryListener::onTitanRepairEvent(InventoryCloseEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k RegionInventoryListener::onPlayerClickGridMenu(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onVotingMenuEvent(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onPlayerClickBlockLineUpEvent(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onPlayerClickTitleMenuEvent(InventoryClickEvent)
0.00% 0.04% 0.00 s 0.02 ms 0.0 0.0k EntityListener::onDeath(EntityDeathEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.1k PlayerInventoryListener::onGachaTradeEvent(InventoryCloseEvent)
0.00% 0.09% 0.00 s 0.05 ms 0.0 0.0k ChatInterceptor::onPlayerQuit(PlayerQuitEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.0 0.0k PlayerItemMigrationController::onInventoryOpen(InventoryOpenEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k MebiusRenamePreventionListener::onRenameOnAnvil(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k MebiusRenamePreventionListener::onSwap(InventoryClickEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.0 0.0k ValentineListener::onEntityDeath(EntityDamageByEntityEvent)
0.00% 0.01% 0.00 s 0.01 ms 0.0 0.0k ChristmasItemListener::onStrayDeath(EntityDeathEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.0 0.0k PlayerJoinListener::onPlayerChangedWorld(PlayerChangedWorldEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.0 0.0k MebiusInteractionResponder::onKill(EntityDeathEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.0 0.0k TemporaryDataInitializer::onQuit(PlayerQuitEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k SeizonsikiListener::onZombieKilledByPlayer(EntityDeathEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k MebiusInteractionResponder::onDamage(EntityDamageByEntityEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k MebiusRenamePreventionListener::onDragInAnvil(InventoryDragEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k EntityListener::onEntityDamageByEntityEvent(EntityDamageByEntityEvent)
Show rest...
```
|
1.0
|
不定期にTPSが極端に低下する(1〜2前後) - 発生トリガーは不明。一度発生すると、再起動をかけるまでは高負荷の状態が継続する。
timingsの結果を元にホッパーの機能抑制対応を行なったが、それでも発生することを確認。その際に取ったTimingsに主な負荷要因がSeichiAssistである旨が現れた為、チケット起票しました。
```
SeichiAssist v1.8.3 Total: 37.416 s Pct: 28.31%
Pct Total Pct Tick Total Avg PerTick Count Event
20.19% 98.79% 26.67 s 49.39 ms 1.0 0.5k Task: OnBukkitServerThread$$Lambda$1752/1083274279(Single)
4.46% 81.79% 5.89 s 40.90 ms 0.3 0.1k PlayerBlockBreakListener::onPlayerBreakBlockFinally(BlockBreakEvent)
3.51% 62.25% 4.64 s 31.12 ms 0.3 0.2k PlayerBlockBreakListener::onPlayerActiveSkillEvent(BlockBreakEvent)
0.05% 0.25% 0.07 s 0.13 ms 6.2 3.3k PlayerClickListener::onPlayerRightClickIronTrapDoor(PlayerInteractEvent)
0.03% 0.13% 0.03 s 0.06 ms 6.2 3.3k PlayerClickListener::onPlayerActiveSkillToggleEvent(PlayerInteractEvent)
0.02% 0.09% 0.02 s 0.04 ms 9.0 4.8k RescuePlayerListener::onPlayerFallenToVoid(PlayerMoveEvent)
0.02% 0.30% 0.02 s 0.15 ms 0.3 0.2k MebiusInteractionResponder::onBlockBreak(BlockBreakEvent)
0.01% 10.78% 0.01 s 5.39 ms 0.0 0.0k PlayerDeathEventListener::onDeath(PlayerDeathEvent)
0.01% 0.04% 0.01 s 0.02 ms 6.2 3.3k HalloweenItemListener$::onPlayerRightClickWithHalloweenHoe(PlayerInteractEvent)
0.01% 0.10% 0.01 s 0.05 ms 0.3 0.1k MebiusLevelUpTrialListener::tryMebiusLevelUpOn(BlockBreakEvent)
0.00% 0.07% 0.01 s 0.04 ms 0.3 0.2k BuildExpIncrementer::onEvent(BlockPlaceEvent)
0.00% 0.02% 0.00 s 0.01 ms 6.2 3.3k BuildMainMenuOpener::onPlayerLeftClickWithStick(PlayerInteractEvent)
0.00% 0.02% 0.00 s 0.01 ms 6.2 3.3k PlayerClickListener::onPlayerActiveSkillEvent(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.01 ms 6.2 3.3k PlayerClickListener::onPlayerMenuEvent(PlayerInteractEvent)
0.00% 0.05% 0.00 s 0.03 ms 0.3 0.1k MebiusDropTrialListener::tryMebiusDropOn(BlockBreakEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k BlockLineUpTriggerListener::onBlockLineUpSkillTrigger(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k PlayerClickListener::onPlayerRightClickMineHeadEvent(PlayerInteractEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.3 0.2k PlayerBlockBreakListener::onPlayerBlockHalf(BlockBreakEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k TilingSkillTriggerListener::onTilingSkillTrigger(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.00 ms 6.2 3.3k PlayerClickListener::onPlayerRightClickGachaEvent(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k OpenPocketInventoryOnPlacingEnderPortalFrame::onInteractEvent(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k ExpBottleStackUsageController::onPlayerRightClickExpBottleEvent(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k PlayerClickListener::onPlayerOpenMenuWithSomething(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k SpawnRegionProjectileInterceptor$::beforeProjectileLaunch(PlayerInteractEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.2 3.3k ChristmasItemListener::onPlayerConsumeChristmasCake(PlayerInteractEvent)
0.00% 0.01% 0.00 s 0.01 ms 0.3 0.1k ChristmasItemListener::onChristmasSockPopped(BlockBreakEvent)
0.00% 0.00% 0.00 s 0.00 ms 6.1 3.3k AnniversaryListener::onPlayerRightClickMendingBook(PlayerInteractEvent)
0.00% 0.03% 0.00 s 0.01 ms 0.1 0.1k PlayerPickupItemListener::onPickupMineStackItem(PlayerPickupItemEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.3 0.1k NewYearListener::onNewYearBagPopped(BlockBreakEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.3 0.2k PlayerItemMigrationController::onBlockPlace(BlockPlaceEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.1 0.1k PlayerInventoryListener::onGachaRingoEvent(InventoryCloseEvent)
0.00% 0.24% 0.00 s 0.12 ms 0.0 0.0k AnniversaryListener::onPlayerDeath(PlayerDeathEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.1 0.0k MenuHandler::onInventoryClick(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.3 0.2k AnniversaryListener::onPlayerPlaceSapling(BlockPlaceEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.3 0.2k AnniversaryListener::onPlayerBreakBlockWithAnniversaryShovel(BlockBreakEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.1k PlayerInventoryListener::onOreTradeEvent(InventoryCloseEvent)
0.00% 0.19% 0.00 s 0.10 ms 0.0 0.0k BungeeSemaphoreCooperator::onQuit(PlayerQuitEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onGiganticBerserkMenuEvent(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k RegionInventoryListener::onPlayerClickRegionTemplateMenu(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.1k PlayerInventoryListener::onTitanRepairEvent(InventoryCloseEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k RegionInventoryListener::onPlayerClickGridMenu(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onVotingMenuEvent(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onPlayerClickBlockLineUpEvent(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k PlayerInventoryListener::onPlayerClickTitleMenuEvent(InventoryClickEvent)
0.00% 0.04% 0.00 s 0.02 ms 0.0 0.0k EntityListener::onDeath(EntityDeathEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.1k PlayerInventoryListener::onGachaTradeEvent(InventoryCloseEvent)
0.00% 0.09% 0.00 s 0.05 ms 0.0 0.0k ChatInterceptor::onPlayerQuit(PlayerQuitEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.0 0.0k PlayerItemMigrationController::onInventoryOpen(InventoryOpenEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k MebiusRenamePreventionListener::onRenameOnAnvil(InventoryClickEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.1 0.0k MebiusRenamePreventionListener::onSwap(InventoryClickEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.0 0.0k ValentineListener::onEntityDeath(EntityDamageByEntityEvent)
0.00% 0.01% 0.00 s 0.01 ms 0.0 0.0k ChristmasItemListener::onStrayDeath(EntityDeathEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.0 0.0k PlayerJoinListener::onPlayerChangedWorld(PlayerChangedWorldEvent)
0.00% 0.01% 0.00 s 0.00 ms 0.0 0.0k MebiusInteractionResponder::onKill(EntityDeathEvent)
0.00% 0.02% 0.00 s 0.01 ms 0.0 0.0k TemporaryDataInitializer::onQuit(PlayerQuitEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k SeizonsikiListener::onZombieKilledByPlayer(EntityDeathEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k MebiusInteractionResponder::onDamage(EntityDamageByEntityEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k MebiusRenamePreventionListener::onDragInAnvil(InventoryDragEvent)
0.00% 0.00% 0.00 s 0.00 ms 0.0 0.0k EntityListener::onEntityDamageByEntityEvent(EntityDamageByEntityEvent)
Show rest...
```
|
priority
|
不定期にtpsが極端に低下する 〜 発生トリガーは不明。一度発生すると、再起動をかけるまでは高負荷の状態が継続する。 timingsの結果を元にホッパーの機能抑制対応を行なったが、それでも発生することを確認。その際に取ったtimingsに主な負荷要因がseichiassistである旨が現れた為、チケット起票しました。 seichiassist total s pct pct total pct tick total avg pertick count event s ms task onbukkitserverthread lambda single s ms playerblockbreaklistener onplayerbreakblockfinally blockbreakevent s ms playerblockbreaklistener onplayeractiveskillevent blockbreakevent s ms playerclicklistener onplayerrightclickirontrapdoor playerinteractevent s ms playerclicklistener onplayeractiveskilltoggleevent playerinteractevent s ms rescueplayerlistener onplayerfallentovoid playermoveevent s ms mebiusinteractionresponder onblockbreak blockbreakevent s ms playerdeatheventlistener ondeath playerdeathevent s ms halloweenitemlistener onplayerrightclickwithhalloweenhoe playerinteractevent s ms mebiusleveluptriallistener trymebiuslevelupon blockbreakevent s ms buildexpincrementer onevent blockplaceevent s ms buildmainmenuopener onplayerleftclickwithstick playerinteractevent s ms playerclicklistener onplayeractiveskillevent playerinteractevent s ms playerclicklistener onplayermenuevent playerinteractevent s ms mebiusdroptriallistener trymebiusdropon blockbreakevent s ms blocklineuptriggerlistener onblocklineupskilltrigger playerinteractevent s ms playerclicklistener onplayerrightclickmineheadevent playerinteractevent s ms playerblockbreaklistener onplayerblockhalf blockbreakevent s ms tilingskilltriggerlistener ontilingskilltrigger playerinteractevent s ms playerclicklistener onplayerrightclickgachaevent playerinteractevent s ms openpocketinventoryonplacingenderportalframe oninteractevent playerinteractevent s ms expbottlestackusagecontroller onplayerrightclickexpbottleevent playerinteractevent s ms playerclicklistener onplayeropenmenuwithsomething playerinteractevent s ms spawnregionprojectileinterceptor beforeprojectilelaunch playerinteractevent s ms christmasitemlistener onplayerconsumechristmascake playerinteractevent s ms christmasitemlistener onchristmassockpopped blockbreakevent s ms anniversarylistener onplayerrightclickmendingbook playerinteractevent s ms playerpickupitemlistener onpickupminestackitem playerpickupitemevent s ms newyearlistener onnewyearbagpopped blockbreakevent s ms playeritemmigrationcontroller onblockplace blockplaceevent s ms playerinventorylistener ongacharingoevent inventorycloseevent s ms anniversarylistener onplayerdeath playerdeathevent s ms menuhandler oninventoryclick inventoryclickevent s ms anniversarylistener onplayerplacesapling blockplaceevent s ms anniversarylistener onplayerbreakblockwithanniversaryshovel blockbreakevent s ms playerinventorylistener onoretradeevent inventorycloseevent s ms bungeesemaphorecooperator onquit playerquitevent s ms playerinventorylistener ongiganticberserkmenuevent inventoryclickevent s ms regioninventorylistener onplayerclickregiontemplatemenu inventoryclickevent s ms playerinventorylistener ontitanrepairevent inventorycloseevent s ms regioninventorylistener onplayerclickgridmenu inventoryclickevent s ms playerinventorylistener onvotingmenuevent inventoryclickevent s ms playerinventorylistener onplayerclickblocklineupevent inventoryclickevent s ms playerinventorylistener onplayerclicktitlemenuevent inventoryclickevent s ms entitylistener ondeath entitydeathevent s ms playerinventorylistener ongachatradeevent inventorycloseevent s ms chatinterceptor onplayerquit playerquitevent s ms playeritemmigrationcontroller oninventoryopen inventoryopenevent s ms mebiusrenamepreventionlistener onrenameonanvil inventoryclickevent s ms mebiusrenamepreventionlistener onswap inventoryclickevent s ms valentinelistener onentitydeath entitydamagebyentityevent s ms christmasitemlistener onstraydeath entitydeathevent s ms playerjoinlistener onplayerchangedworld playerchangedworldevent s ms mebiusinteractionresponder onkill entitydeathevent s ms temporarydatainitializer onquit playerquitevent s ms seizonsikilistener onzombiekilledbyplayer entitydeathevent s ms mebiusinteractionresponder ondamage entitydamagebyentityevent s ms mebiusrenamepreventionlistener ondraginanvil inventorydragevent s ms entitylistener onentitydamagebyentityevent entitydamagebyentityevent show rest
| 1
|
754,238
| 26,377,763,041
|
IssuesEvent
|
2023-01-12 05:10:22
|
ballerina-platform/ballerina-lang
|
https://api.github.com/repos/ballerina-platform/ballerina-lang
|
closed
|
[New Feature]: Add Semantic API support for annotation-attachment in tuple types
|
Type/NewFeature Priority/High Status/Blocked Team/CompilerFETools Points/4 Area/SemanticAPI userCategory/Compilation
|
### Description
Need to add support for annotation-attachment from Semantic API in tuple types.
```ballerina
type T1 [int, @member int, string...];
```
Compiler changes: https://github.com/ballerina-platform/ballerina-lang/pull/36638
WIP branch: https://github.com/ballerina-platform/ballerina-lang/tree/annot-tuple-members
### Describe your problem(s)
_No response_
### Describe your solution(s)
_No response_
### Related area
-> Compilation
### Related issue(s) (optional)
_No response_
### Suggested label(s) (optional)
_No response_
### Suggested assignee(s) (optional)
_No response_
|
1.0
|
[New Feature]: Add Semantic API support for annotation-attachment in tuple types - ### Description
Need to add support for annotation-attachment from Semantic API in tuple types.
```ballerina
type T1 [int, @member int, string...];
```
Compiler changes: https://github.com/ballerina-platform/ballerina-lang/pull/36638
WIP branch: https://github.com/ballerina-platform/ballerina-lang/tree/annot-tuple-members
### Describe your problem(s)
_No response_
### Describe your solution(s)
_No response_
### Related area
-> Compilation
### Related issue(s) (optional)
_No response_
### Suggested label(s) (optional)
_No response_
### Suggested assignee(s) (optional)
_No response_
|
priority
|
add semantic api support for annotation attachment in tuple types description need to add support for annotation attachment from semantic api in tuple types ballerina type compiler changes wip branch describe your problem s no response describe your solution s no response related area compilation related issue s optional no response suggested label s optional no response suggested assignee s optional no response
| 1
|
553,656
| 16,376,221,298
|
IssuesEvent
|
2021-05-16 06:19:22
|
StrangeLoopGames/EcoIssues
|
https://api.github.com/repos/StrangeLoopGames/EcoIssues
|
closed
|
Users banned from voting, but not banned from playing ingame or loading election page.
|
Priority: Critical Priority: High Squad: Pumpkin Status: Fixed
|
happening for all users on server.
fixed by linking their steam account to slg
https://www.reddit.com/r/EcoGlobalSurvival/comments/msjdmi/prevented_from_voting/
needs more info
|
2.0
|
Users banned from voting, but not banned from playing ingame or loading election page. - happening for all users on server.
fixed by linking their steam account to slg
https://www.reddit.com/r/EcoGlobalSurvival/comments/msjdmi/prevented_from_voting/
needs more info
|
priority
|
users banned from voting but not banned from playing ingame or loading election page happening for all users on server fixed by linking their steam account to slg needs more info
| 1
|
377,274
| 11,167,103,924
|
IssuesEvent
|
2019-12-27 15:49:48
|
bounswe/bounswe2019group8
|
https://api.github.com/repos/bounswe/bounswe2019group8
|
closed
|
Trade (Buy/Sell) Feature
|
Backend Effort: High Priority: High Type: Feature
|
**Actions:**
Implement endpoints for:
1. querying assets
1. buying and selling trading equipments
1. loading cash
**Notes:**
- Loading cash: /users/<id>/cash --> POST the amount
- Asset buy: --> /users/<id>/assets --> POST asset id and amount
- Assets list --> /users/<id>/assets --> GET
**Deadline:** 18.12.2019
|
1.0
|
Trade (Buy/Sell) Feature - **Actions:**
Implement endpoints for:
1. querying assets
1. buying and selling trading equipments
1. loading cash
**Notes:**
- Loading cash: /users/<id>/cash --> POST the amount
- Asset buy: --> /users/<id>/assets --> POST asset id and amount
- Assets list --> /users/<id>/assets --> GET
**Deadline:** 18.12.2019
|
priority
|
trade buy sell feature actions implement endpoints for querying assets buying and selling trading equipments loading cash notes loading cash users cash post the amount asset buy users assets post asset id and amount assets list users assets get deadline
| 1
|
60,218
| 3,121,000,061
|
IssuesEvent
|
2015-09-05 07:15:12
|
OpenSourceMalaria/OSM_To_Do_List
|
https://api.github.com/repos/OpenSourceMalaria/OSM_To_Do_List
|
closed
|
Competition for Making a Graphical Abstract
|
Collaboration Request Competition High Priority Paper 1
|
[Open Source Malaria (OSM)](http://opensourcemalaria.org/) is a consortium of researchers who are trying to find a new medicine for malaria in a new way...we're working in 'the open’, sharing all of our experiments and results on the internet and anyone can take part.
Because we’re open, communication of our work is especially important and now we need some help from talented artists.
**What's Needed**
OSM needs a graphical abstract image for its first paper, which is ready for submission to a journal. **We’re offering a cash prize** for the best and we hope this might be the first of many collaborations between artists and scientists!
The paper describes how we made a number of molecules, and the measurement of the ability of those molecules to kill the parasite that causes malaria. All the data and ideas involved in the project have been publicly available throughout. Many people have contributed from around the world (47 authors, 8 countries) including an undergraduate lab class. The molecules we discovered were very capable of killing the parasite, but didn’t quite perform well enough in a malaria-infected mouse to proceed any further. Maybe someone in the future will take the OSM data and find a way round this problem.
The text of the paper’s abstract is shown below. We need one graphical image to capture this paper in spirit. i.e. to convey that the paper is about molecules [these ones](http://openwetware.org/wiki/OpenSourceMalaria:GSK_Arylpyrrole_Series), that the project adhered to open source principles, and that the worldwide community was able to participate in the research as it was happening. The Six Laws of the consortium are [here](http://openwetware.org/wiki/Open_Source_Research).
In order to convey the spirit/story of the paper, there are certain things that MUST be included in the design:
1. A representation (in some form) of the molecule [OSM-S-5](http://malaria.ourexperiment.org/osm_procedures/7054/Preparation_of_OSMS5.html)
2. An image of/allusion to the [electronic lab notebook](http://malaria.ourexperiment.org/?allblogs), which is where people can find all the data
3. A sense of sharing data between multiple people around the world in real time
There are some existing OSM images shared in [this repo](https://github.com/OpenSourceMalaria/OSM_Website_Code/tree/master/images), such as OSM’s logo, which can be used if you like.
We're an open project and so this is an open art prize, which means that the rules might sound a little unusual. But here they are:
**Rules:**
1. Submissions must be public, as must all source files used to make the image.
2. The license governing all submissions must be [CC-BY-4.0](https://creativecommons.org/licenses/by/4.0/).
3. Anyone else is free to take those files and rework them into their own image after the competition. Files can be uploaded anywhere where such reuse is possible, but we have a [Github repository](https://github.com/OpenSourceMalaria/OSMSeries1Paper1/tree/master/Graphical%20Abstract) that can be used.
4. If files are uploaded before the deadline, other entrants can use those files and incorporate them into their own entry but the prize will be split accordingly.
4. The submitter of the winning image must be willing after the close of the competition to alter the final image into a form (size, format) that is acceptable to the journal where the article is to be submitted. Here are some [example guidelines](http://journals.plos.org/plosmedicine/s/figures)
**Deadline:** August 21st 2015 at 5pm Sydney Time, which is [these times](http://www.timeanddate.com/worldclock/meetingdetails.html?year=2015&month=8&day=21&hour=7&min=0&sec=0&p1=240&p2=176&p3=87&p4=136&p5=179&p6=224) elsewhere.
**Prize money:**
Winning Image $600 (even if we don’t end up using it as it is)
Two other key contributors: $100 each
Judges will be Mat Todd (OSM), Alice Williamson (OSM), [Justine Alltimes](http://www.childrenslaureate.org.au/about/#team) (works in children's publishing and is the project manager for the Australian Children's Laureate) and 2 other members of the Open Source Malaria Consortium who are authors on the paper.
To get a further feel for the paper, here is the accompanying abstract text:
Abstract Text
The development of new antimalarial compounds remains a pivotal part of the strategy for malaria elimination. Recent large-scale phenotypic screens have provided a wealth of potential starting points for hit-to-lead campaigns. One such public set is explored, employing an open source research mechanism in which all data and ideas were shared in real time, anyone was able to participate and patents were not sought. One chemical sub-series was found to exhibit oral activity but contained a labile ester that could not be replaced without loss of activity, and the original hit exhibited remarkable sensitivity to minor structural change. A second sub-series displayed high potency, including activity within a late stage gametocyte assay, but at the cost of low solubility. As an open source research project, unexplored avenues are clearly identified and may be explored further by the community; new findings may be cumulatively added to the present work.
Good Luck!
|
1.0
|
Competition for Making a Graphical Abstract - [Open Source Malaria (OSM)](http://opensourcemalaria.org/) is a consortium of researchers who are trying to find a new medicine for malaria in a new way...we're working in 'the open’, sharing all of our experiments and results on the internet and anyone can take part.
Because we’re open, communication of our work is especially important and now we need some help from talented artists.
**What's Needed**
OSM needs a graphical abstract image for its first paper, which is ready for submission to a journal. **We’re offering a cash prize** for the best and we hope this might be the first of many collaborations between artists and scientists!
The paper describes how we made a number of molecules, and the measurement of the ability of those molecules to kill the parasite that causes malaria. All the data and ideas involved in the project have been publicly available throughout. Many people have contributed from around the world (47 authors, 8 countries) including an undergraduate lab class. The molecules we discovered were very capable of killing the parasite, but didn’t quite perform well enough in a malaria-infected mouse to proceed any further. Maybe someone in the future will take the OSM data and find a way round this problem.
The text of the paper’s abstract is shown below. We need one graphical image to capture this paper in spirit. i.e. to convey that the paper is about molecules [these ones](http://openwetware.org/wiki/OpenSourceMalaria:GSK_Arylpyrrole_Series), that the project adhered to open source principles, and that the worldwide community was able to participate in the research as it was happening. The Six Laws of the consortium are [here](http://openwetware.org/wiki/Open_Source_Research).
In order to convey the spirit/story of the paper, there are certain things that MUST be included in the design:
1. A representation (in some form) of the molecule [OSM-S-5](http://malaria.ourexperiment.org/osm_procedures/7054/Preparation_of_OSMS5.html)
2. An image of/allusion to the [electronic lab notebook](http://malaria.ourexperiment.org/?allblogs), which is where people can find all the data
3. A sense of sharing data between multiple people around the world in real time
There are some existing OSM images shared in [this repo](https://github.com/OpenSourceMalaria/OSM_Website_Code/tree/master/images), such as OSM’s logo, which can be used if you like.
We're an open project and so this is an open art prize, which means that the rules might sound a little unusual. But here they are:
**Rules:**
1. Submissions must be public, as must all source files used to make the image.
2. The license governing all submissions must be [CC-BY-4.0](https://creativecommons.org/licenses/by/4.0/).
3. Anyone else is free to take those files and rework them into their own image after the competition. Files can be uploaded anywhere where such reuse is possible, but we have a [Github repository](https://github.com/OpenSourceMalaria/OSMSeries1Paper1/tree/master/Graphical%20Abstract) that can be used.
4. If files are uploaded before the deadline, other entrants can use those files and incorporate them into their own entry but the prize will be split accordingly.
4. The submitter of the winning image must be willing after the close of the competition to alter the final image into a form (size, format) that is acceptable to the journal where the article is to be submitted. Here are some [example guidelines](http://journals.plos.org/plosmedicine/s/figures)
**Deadline:** August 21st 2015 at 5pm Sydney Time, which is [these times](http://www.timeanddate.com/worldclock/meetingdetails.html?year=2015&month=8&day=21&hour=7&min=0&sec=0&p1=240&p2=176&p3=87&p4=136&p5=179&p6=224) elsewhere.
**Prize money:**
Winning Image $600 (even if we don’t end up using it as it is)
Two other key contributors: $100 each
Judges will be Mat Todd (OSM), Alice Williamson (OSM), [Justine Alltimes](http://www.childrenslaureate.org.au/about/#team) (works in children's publishing and is the project manager for the Australian Children's Laureate) and 2 other members of the Open Source Malaria Consortium who are authors on the paper.
To get a further feel for the paper, here is the accompanying abstract text:
Abstract Text
The development of new antimalarial compounds remains a pivotal part of the strategy for malaria elimination. Recent large-scale phenotypic screens have provided a wealth of potential starting points for hit-to-lead campaigns. One such public set is explored, employing an open source research mechanism in which all data and ideas were shared in real time, anyone was able to participate and patents were not sought. One chemical sub-series was found to exhibit oral activity but contained a labile ester that could not be replaced without loss of activity, and the original hit exhibited remarkable sensitivity to minor structural change. A second sub-series displayed high potency, including activity within a late stage gametocyte assay, but at the cost of low solubility. As an open source research project, unexplored avenues are clearly identified and may be explored further by the community; new findings may be cumulatively added to the present work.
Good Luck!
|
priority
|
competition for making a graphical abstract is a consortium of researchers who are trying to find a new medicine for malaria in a new way we re working in the open’ sharing all of our experiments and results on the internet and anyone can take part because we’re open communication of our work is especially important and now we need some help from talented artists what s needed osm needs a graphical abstract image for its first paper which is ready for submission to a journal we’re offering a cash prize for the best and we hope this might be the first of many collaborations between artists and scientists the paper describes how we made a number of molecules and the measurement of the ability of those molecules to kill the parasite that causes malaria all the data and ideas involved in the project have been publicly available throughout many people have contributed from around the world authors countries including an undergraduate lab class the molecules we discovered were very capable of killing the parasite but didn’t quite perform well enough in a malaria infected mouse to proceed any further maybe someone in the future will take the osm data and find a way round this problem the text of the paper’s abstract is shown below we need one graphical image to capture this paper in spirit i e to convey that the paper is about molecules that the project adhered to open source principles and that the worldwide community was able to participate in the research as it was happening the six laws of the consortium are in order to convey the spirit story of the paper there are certain things that must be included in the design a representation in some form of the molecule an image of allusion to the which is where people can find all the data a sense of sharing data between multiple people around the world in real time there are some existing osm images shared in such as osm’s logo which can be used if you like we re an open project and so this is an open art prize which means that the rules might sound a little unusual but here they are rules submissions must be public as must all source files used to make the image the license governing all submissions must be anyone else is free to take those files and rework them into their own image after the competition files can be uploaded anywhere where such reuse is possible but we have a that can be used if files are uploaded before the deadline other entrants can use those files and incorporate them into their own entry but the prize will be split accordingly the submitter of the winning image must be willing after the close of the competition to alter the final image into a form size format that is acceptable to the journal where the article is to be submitted here are some deadline august at sydney time which is elsewhere prize money winning image even if we don’t end up using it as it is two other key contributors each judges will be mat todd osm alice williamson osm works in children s publishing and is the project manager for the australian children s laureate and other members of the open source malaria consortium who are authors on the paper to get a further feel for the paper here is the accompanying abstract text abstract text the development of new antimalarial compounds remains a pivotal part of the strategy for malaria elimination recent large scale phenotypic screens have provided a wealth of potential starting points for hit to lead campaigns one such public set is explored employing an open source research mechanism in which all data and ideas were shared in real time anyone was able to participate and patents were not sought one chemical sub series was found to exhibit oral activity but contained a labile ester that could not be replaced without loss of activity and the original hit exhibited remarkable sensitivity to minor structural change a second sub series displayed high potency including activity within a late stage gametocyte assay but at the cost of low solubility as an open source research project unexplored avenues are clearly identified and may be explored further by the community new findings may be cumulatively added to the present work good luck
| 1
|
201,992
| 7,043,003,510
|
IssuesEvent
|
2017-12-30 21:29:03
|
ppy/osu-wiki
|
https://api.github.com/repos/ppy/osu-wiki
|
closed
|
World Cup Season Schedule 2013/14 forum link in the Tournaments article is unavailable
|
high priority
|
probably delete it
|
1.0
|
World Cup Season Schedule 2013/14 forum link in the Tournaments article is unavailable - probably delete it
|
priority
|
world cup season schedule forum link in the tournaments article is unavailable probably delete it
| 1
|
320,600
| 9,783,671,286
|
IssuesEvent
|
2019-06-08 12:31:35
|
apexcharts/apexcharts.js
|
https://api.github.com/repos/apexcharts/apexcharts.js
|
closed
|
Automatically change the scale of the y-axis when zooming
|
enhancement high-priority
|
When zooming on a line/area chart, it would be cool to automatically change the y-axis scale
|
1.0
|
Automatically change the scale of the y-axis when zooming - When zooming on a line/area chart, it would be cool to automatically change the y-axis scale
|
priority
|
automatically change the scale of the y axis when zooming when zooming on a line area chart it would be cool to automatically change the y axis scale
| 1
|
614,270
| 19,178,484,291
|
IssuesEvent
|
2021-12-04 01:44:31
|
vertica/spark-connector
|
https://api.github.com/repos/vertica/spark-connector
|
closed
|
Include compression codec used in parquet file name
|
enhancement size: 2 High Priority
|
When writing parquet files, the connector uses snappy encoding for parquet files. We should include .snappy in the parquet file name, similar to the format used by the default spark parquet writer.
|
1.0
|
Include compression codec used in parquet file name - When writing parquet files, the connector uses snappy encoding for parquet files. We should include .snappy in the parquet file name, similar to the format used by the default spark parquet writer.
|
priority
|
include compression codec used in parquet file name when writing parquet files the connector uses snappy encoding for parquet files we should include snappy in the parquet file name similar to the format used by the default spark parquet writer
| 1
|
139,074
| 5,356,124,636
|
IssuesEvent
|
2017-02-20 14:53:38
|
Activisme-be/Internals
|
https://api.github.com/repos/Activisme-be/Internals
|
opened
|
Provide documents for graphical work.
|
enhancement help wanted High priority
|
@alfamongrel can u supply me documents with description for the graphical artiwork. So i can start my search for humans that can provide that work.
|
1.0
|
Provide documents for graphical work. - @alfamongrel can u supply me documents with description for the graphical artiwork. So i can start my search for humans that can provide that work.
|
priority
|
provide documents for graphical work alfamongrel can u supply me documents with description for the graphical artiwork so i can start my search for humans that can provide that work
| 1
|
324,183
| 9,885,539,098
|
IssuesEvent
|
2019-06-25 02:56:49
|
nhn/tui.grid
|
https://api.github.com/repos/nhn/tui.grid
|
opened
|
Can register custom editor's DOM element through the optional method
|
4.0.x Enhancement NHN Priority: High
|
<!--
Thank you for your contribution.
When it comes to write an issue, please, use the template below.
To use the template is mandatory for submit new issue and we won't reply the issue that without the template.
And you can write template's contents in Korean also.
-->
<!-- TEMPLATE -->
## Version
<!-- Write the version of the grid you are currently using. -->
* 4.0.2
## Development Environment
<!-- Write the browser type, OS and so on -->
* OS: mac
* Browser: Chrome
## Current Behavior
<!-- Write a description of the current operation. You can add sample code, 'CodePen' or 'jsfiddle' links. -->
```js
class CustomTextEditor {
constructor(props) {
const el = document.createElement('input');
const { maxLength } = props.columnInfo.editor.options;
el.type = 'text';
el.maxLength = maxLength;
el.value = String(props.value);
this.el = el;
}
getElement() {
return this.el;
}
getValue() {
return this.el.value;
}
mounted() {
this.el.select();
}
}
```
## Expected Behavior
<!-- Write a description of the future action. -->
Users need to register custom editor's DOM element. Sometimes, they have to select or modify editor's value thorough their custom layer created outside our custom editor area.
For example, `element ui date-picker` is that case. Due to date-picker dropdown attached document as an another root element, cannot modify the editing grid value. Because editing layer would be destroyed when mousedown event emitted outside editing area(based DOM element). So we will provide method or option for solving this situation.
|
1.0
|
Can register custom editor's DOM element through the optional method - <!--
Thank you for your contribution.
When it comes to write an issue, please, use the template below.
To use the template is mandatory for submit new issue and we won't reply the issue that without the template.
And you can write template's contents in Korean also.
-->
<!-- TEMPLATE -->
## Version
<!-- Write the version of the grid you are currently using. -->
* 4.0.2
## Development Environment
<!-- Write the browser type, OS and so on -->
* OS: mac
* Browser: Chrome
## Current Behavior
<!-- Write a description of the current operation. You can add sample code, 'CodePen' or 'jsfiddle' links. -->
```js
class CustomTextEditor {
constructor(props) {
const el = document.createElement('input');
const { maxLength } = props.columnInfo.editor.options;
el.type = 'text';
el.maxLength = maxLength;
el.value = String(props.value);
this.el = el;
}
getElement() {
return this.el;
}
getValue() {
return this.el.value;
}
mounted() {
this.el.select();
}
}
```
## Expected Behavior
<!-- Write a description of the future action. -->
Users need to register custom editor's DOM element. Sometimes, they have to select or modify editor's value thorough their custom layer created outside our custom editor area.
For example, `element ui date-picker` is that case. Due to date-picker dropdown attached document as an another root element, cannot modify the editing grid value. Because editing layer would be destroyed when mousedown event emitted outside editing area(based DOM element). So we will provide method or option for solving this situation.
|
priority
|
can register custom editor s dom element through the optional method thank you for your contribution when it comes to write an issue please use the template below to use the template is mandatory for submit new issue and we won t reply the issue that without the template and you can write template s contents in korean also version development environment os mac browser chrome current behavior js class customtexteditor constructor props const el document createelement input const maxlength props columninfo editor options el type text el maxlength maxlength el value string props value this el el getelement return this el getvalue return this el value mounted this el select expected behavior users need to register custom editor s dom element sometimes they have to select or modify editor s value thorough their custom layer created outside our custom editor area for example element ui date picker is that case due to date picker dropdown attached document as an another root element cannot modify the editing grid value because editing layer would be destroyed when mousedown event emitted outside editing area based dom element so we will provide method or option for solving this situation
| 1
|
163,270
| 6,194,953,508
|
IssuesEvent
|
2017-07-05 11:16:49
|
dhowe/RELC3
|
https://api.github.com/repos/dhowe/RELC3
|
closed
|
Add executables to website
|
Priority: High
|
Need to add the downloadable executables to this page: http://thereadersproject.org/elc3.html#ELC3
and do minor redesign/text-updates (should also add the instructions from the rtf)
https://github.com/dhowe/RELC3/tree/Readers2016_asPosted/applications
|
1.0
|
Add executables to website - Need to add the downloadable executables to this page: http://thereadersproject.org/elc3.html#ELC3
and do minor redesign/text-updates (should also add the instructions from the rtf)
https://github.com/dhowe/RELC3/tree/Readers2016_asPosted/applications
|
priority
|
add executables to website need to add the downloadable executables to this page and do minor redesign text updates should also add the instructions from the rtf
| 1
|
141,181
| 5,431,379,736
|
IssuesEvent
|
2017-03-04 00:34:03
|
Angblah/The-Comparator
|
https://api.github.com/repos/Angblah/The-Comparator
|
opened
|
Load Comparisons into Redux Workspace
|
Priority: High Stack: Frontend Status: In Progress Type: Feature
|
Grab comparison data from database and load it into the initial state.
|
1.0
|
Load Comparisons into Redux Workspace - Grab comparison data from database and load it into the initial state.
|
priority
|
load comparisons into redux workspace grab comparison data from database and load it into the initial state
| 1
|
796,140
| 28,100,000,564
|
IssuesEvent
|
2023-03-30 18:41:21
|
kevin-cgc/xk-web-midair-haptic-designer
|
https://api.github.com/repos/kevin-cgc/xk-web-midair-haptic-designer
|
opened
|
Create flags visible in timeline for cjumps
|
enhancement high-priority feature
|
allow these flags to be selectable/draggable along with the keyframes in the timeline
|
1.0
|
Create flags visible in timeline for cjumps - allow these flags to be selectable/draggable along with the keyframes in the timeline
|
priority
|
create flags visible in timeline for cjumps allow these flags to be selectable draggable along with the keyframes in the timeline
| 1
|
721,511
| 24,829,571,100
|
IssuesEvent
|
2022-10-26 01:17:27
|
AY2223S1-CS2103T-T15-3/tp
|
https://api.github.com/repos/AY2223S1-CS2103T-T15-3/tp
|
closed
|
As a user, I can copy information from the tutor profile
|
type.Story priority.High
|
... so that I can paste it somewhere else.
|
1.0
|
As a user, I can copy information from the tutor profile - ... so that I can paste it somewhere else.
|
priority
|
as a user i can copy information from the tutor profile so that i can paste it somewhere else
| 1
|
521,667
| 15,113,391,334
|
IssuesEvent
|
2021-02-08 23:35:11
|
townhallproject/mutual-aid-networks
|
https://api.github.com/repos/townhallproject/mutual-aid-networks
|
closed
|
Add "Share your story" banner
|
enhancement high priority
|
COPY
Expanded Unemployment Benefits expire on July 31. If you -- or a loved one -- is depending in this support to make rent, mortgage, and other essentials, help us lift up your story to lawmakers. **[SHARE YOUR STORY TODAY.]**(https://twitter.com/GoddardRiv/status/1278757777511518211)
|
1.0
|
Add "Share your story" banner - COPY
Expanded Unemployment Benefits expire on July 31. If you -- or a loved one -- is depending in this support to make rent, mortgage, and other essentials, help us lift up your story to lawmakers. **[SHARE YOUR STORY TODAY.]**(https://twitter.com/GoddardRiv/status/1278757777511518211)
|
priority
|
add share your story banner copy expanded unemployment benefits expire on july if you or a loved one is depending in this support to make rent mortgage and other essentials help us lift up your story to lawmakers
| 1
|
722,442
| 24,862,187,462
|
IssuesEvent
|
2022-10-27 09:07:44
|
geosolutions-it/MapStore2
|
https://api.github.com/repos/geosolutions-it/MapStore2
|
closed
|
Error on Contexts
|
bug Priority: High Accepted AppContext C040-COMUNE_GE-2022-CUSTOM-SUPPORT
|
On the Context Manager page, it is not possible to go back to the home page or log out and a newly created context is not displayed (the loading wheel continues indefinitely).
Error on console:
> Uncaught TypeError: r.map is not a function
at R (mapstore2.js?3cb7cdaaf25d3012a4ed:2:1268575)
at e (mapstore2.js?3cb7cdaaf25d3012a4ed:2:965180)
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4189131
at reduce (mapstore2.js?3cb7cdaaf25d3012a4ed:2:1233077)
at br (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4707531)
at S (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4668932)
at Object.w [as dispatch] (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4187254)
at i (mapstore2.js?3cb7cdaaf25d3012a4ed:2:2716)
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4666484
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4181979
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4181979
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4182816
at t.dispatch [as _next] (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4190081)
at t.__tryOrUnsub (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4217314)
at t.next (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4216640)
at t._next (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4215721)
|
1.0
|
Error on Contexts - On the Context Manager page, it is not possible to go back to the home page or log out and a newly created context is not displayed (the loading wheel continues indefinitely).
Error on console:
> Uncaught TypeError: r.map is not a function
at R (mapstore2.js?3cb7cdaaf25d3012a4ed:2:1268575)
at e (mapstore2.js?3cb7cdaaf25d3012a4ed:2:965180)
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4189131
at reduce (mapstore2.js?3cb7cdaaf25d3012a4ed:2:1233077)
at br (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4707531)
at S (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4668932)
at Object.w [as dispatch] (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4187254)
at i (mapstore2.js?3cb7cdaaf25d3012a4ed:2:2716)
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4666484
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4181979
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4181979
at mapstore2.js?3cb7cdaaf25d3012a4ed:2:4182816
at t.dispatch [as _next] (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4190081)
at t.__tryOrUnsub (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4217314)
at t.next (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4216640)
at t._next (mapstore2.js?3cb7cdaaf25d3012a4ed:2:4215721)
|
priority
|
error on contexts on the context manager page it is not possible to go back to the home page or log out and a newly created context is not displayed the loading wheel continues indefinitely error on console uncaught typeerror r map is not a function at r js at e js at js at reduce js at br js at s js at object w js at i js at js at js at js at js at t dispatch js at t tryorunsub js at t next js at t next js
| 1
|
610,613
| 18,912,302,966
|
IssuesEvent
|
2021-11-16 15:13:23
|
bitsofgood/pencils-for-success
|
https://api.github.com/repos/bitsofgood/pencils-for-success
|
closed
|
Supply request list for a Recipient (Chapter Dashboard)
|
task frontend high-priority
|
### Problem Description
#46 will add a list of recipient cards that are associated with a Chapter. As a chapter user, I want to be able to view the list of supply requests for each recipient.
#### Mockups ([link to Figma](https://www.figma.com/file/Yx4yPD5PvtkHAs4FbKzZgH/Pencils-for-Success-%2F-Fall21?node-id=1351%3A1362))
<img width="568" alt="Screen Shot 2021-11-06 at 4 09 15 PM" src="https://user-images.githubusercontent.com/11952174/140622550-73950e1e-d8cc-4f56-94e9-759fdde8feed.png">
### Your Goal
- For this task, you will only need to be concerned with initializing the page and making the supply request list illustrated in the second screenshot. All other components in the page will be created in other tasks
- The list of supply requests will need to be paginated. I recommend implementing this list as a styled HTML table and using external libraries to make pagination easier.
- [Chakra UI + React Table pagination example](https://codesandbox.io/s/fxx0v)
- [Chakra UI + React table example
](https://chakra-ui.com/guides/integrations/with-react-table)
### Acceptance Criteria
- Initialize recipient list page at `/chapter`. You will need to modify the dynamic route code to create a dynamic route with two dynamic path components
- Some resources that might help:
- https://stackoverflow.com/questions/65988686/nextjs-nested-dynamic-folder-routing
- https://nextjs.org/docs/routing/dynamic-routes
- The "..." at the right of each list item is an icon button that will open a dropdown with a list of actions
- Include the dropdown actions (dropdown menu items)"Edit" and "Delete" (no need to add any behavior to these actions)
- Hardcode supply request data, or fetch them from the API after #64 is complete
- Pagination
- Page size of 10
|
1.0
|
Supply request list for a Recipient (Chapter Dashboard) - ### Problem Description
#46 will add a list of recipient cards that are associated with a Chapter. As a chapter user, I want to be able to view the list of supply requests for each recipient.
#### Mockups ([link to Figma](https://www.figma.com/file/Yx4yPD5PvtkHAs4FbKzZgH/Pencils-for-Success-%2F-Fall21?node-id=1351%3A1362))
<img width="568" alt="Screen Shot 2021-11-06 at 4 09 15 PM" src="https://user-images.githubusercontent.com/11952174/140622550-73950e1e-d8cc-4f56-94e9-759fdde8feed.png">
### Your Goal
- For this task, you will only need to be concerned with initializing the page and making the supply request list illustrated in the second screenshot. All other components in the page will be created in other tasks
- The list of supply requests will need to be paginated. I recommend implementing this list as a styled HTML table and using external libraries to make pagination easier.
- [Chakra UI + React Table pagination example](https://codesandbox.io/s/fxx0v)
- [Chakra UI + React table example
](https://chakra-ui.com/guides/integrations/with-react-table)
### Acceptance Criteria
- Initialize recipient list page at `/chapter`. You will need to modify the dynamic route code to create a dynamic route with two dynamic path components
- Some resources that might help:
- https://stackoverflow.com/questions/65988686/nextjs-nested-dynamic-folder-routing
- https://nextjs.org/docs/routing/dynamic-routes
- The "..." at the right of each list item is an icon button that will open a dropdown with a list of actions
- Include the dropdown actions (dropdown menu items)"Edit" and "Delete" (no need to add any behavior to these actions)
- Hardcode supply request data, or fetch them from the API after #64 is complete
- Pagination
- Page size of 10
|
priority
|
supply request list for a recipient chapter dashboard problem description will add a list of recipient cards that are associated with a chapter as a chapter user i want to be able to view the list of supply requests for each recipient mockups img width alt screen shot at pm src your goal for this task you will only need to be concerned with initializing the page and making the supply request list illustrated in the second screenshot all other components in the page will be created in other tasks the list of supply requests will need to be paginated i recommend implementing this list as a styled html table and using external libraries to make pagination easier chakra ui react table example acceptance criteria initialize recipient list page at chapter you will need to modify the dynamic route code to create a dynamic route with two dynamic path components some resources that might help the at the right of each list item is an icon button that will open a dropdown with a list of actions include the dropdown actions dropdown menu items edit and delete no need to add any behavior to these actions hardcode supply request data or fetch them from the api after is complete pagination page size of
| 1
|
353,960
| 10,561,150,063
|
IssuesEvent
|
2019-10-04 15:17:00
|
carbon-design-system/carbon
|
https://api.github.com/repos/carbon-design-system/carbon
|
reopened
|
[Inline Loading] renders "error message" and "in field" symbols
|
Severity 2 package: components priority: high project: components type: enhancement 💡
|
Does **InlineLoading** component render following two Carbon Design Tool Kit symbols:
**loading / inline loading / in field**
**loading / inline loading / error message**
Don't see samples for them.
|
1.0
|
[Inline Loading] renders "error message" and "in field" symbols - Does **InlineLoading** component render following two Carbon Design Tool Kit symbols:
**loading / inline loading / in field**
**loading / inline loading / error message**
Don't see samples for them.
|
priority
|
renders error message and in field symbols does inlineloading component render following two carbon design tool kit symbols loading inline loading in field loading inline loading error message don t see samples for them
| 1
|
615,906
| 19,279,290,098
|
IssuesEvent
|
2021-12-10 15:24:25
|
Rammelkast/AntiCheatReloaded
|
https://api.github.com/repos/Rammelkast/AntiCheatReloaded
|
closed
|
Swimming in kelp in 1.17.1 triggers AirFlight
|
high priority false-positive unverified
|
Players are triggering airflight on my server from swimming in kelp on 1.17
This server is running Airplane version git-Airplane-87 (MC: 1.17.1) (Implementing API version 1.17.1-R0.1-SNAPSHOT) (Git: 002f470 on HEAD)
On ACR 1.9.8
|
1.0
|
Swimming in kelp in 1.17.1 triggers AirFlight - Players are triggering airflight on my server from swimming in kelp on 1.17
This server is running Airplane version git-Airplane-87 (MC: 1.17.1) (Implementing API version 1.17.1-R0.1-SNAPSHOT) (Git: 002f470 on HEAD)
On ACR 1.9.8
|
priority
|
swimming in kelp in triggers airflight players are triggering airflight on my server from swimming in kelp on this server is running airplane version git airplane mc implementing api version snapshot git on head on acr
| 1
|
809,028
| 30,121,403,387
|
IssuesEvent
|
2023-06-30 15:26:52
|
geopm/geopm
|
https://api.github.com/repos/geopm/geopm
|
closed
|
There are issues with reporter when no application connects
|
bug bug-priority-high bug-exposure-high bug-quality-low
|
**Describe the bug**
Several integration tests are failing due to issues with reporter and application sampler when no application connects
**GEOPM version**
76b6acd735d8e6f7c8771e3418f6d1c413058cb2
|
1.0
|
There are issues with reporter when no application connects - **Describe the bug**
Several integration tests are failing due to issues with reporter and application sampler when no application connects
**GEOPM version**
76b6acd735d8e6f7c8771e3418f6d1c413058cb2
|
priority
|
there are issues with reporter when no application connects describe the bug several integration tests are failing due to issues with reporter and application sampler when no application connects geopm version
| 1
|
430,009
| 12,439,807,349
|
IssuesEvent
|
2020-05-26 10:47:06
|
ooni/probe
|
https://api.github.com/repos/ooni/probe
|
closed
|
Add logic for detecting which circumvention strategy should be used when speaking to backends
|
priority/high
|
Related to: https://github.com/ooni/probe/issues/886
|
1.0
|
Add logic for detecting which circumvention strategy should be used when speaking to backends - Related to: https://github.com/ooni/probe/issues/886
|
priority
|
add logic for detecting which circumvention strategy should be used when speaking to backends related to
| 1
|
733,572
| 25,311,938,505
|
IssuesEvent
|
2022-11-17 18:10:16
|
monarch-initiative/mondo
|
https://api.github.com/repos/monarch-initiative/mondo
|
reopened
|
Atlantic cod allergy
|
obsolete high priority
|
This is currently listed under Infectious disease.
I would say that "Atopy" or "Allergy" is a disease, and individual allergies are phenotypic features, it is unlikely that an individual has just one specific allergy, and if somebody has 20 allergies, like I had as a kid, then we would be modelling them as having 20 distinct diseases.
|
1.0
|
Atlantic cod allergy - This is currently listed under Infectious disease.
I would say that "Atopy" or "Allergy" is a disease, and individual allergies are phenotypic features, it is unlikely that an individual has just one specific allergy, and if somebody has 20 allergies, like I had as a kid, then we would be modelling them as having 20 distinct diseases.
|
priority
|
atlantic cod allergy this is currently listed under infectious disease i would say that atopy or allergy is a disease and individual allergies are phenotypic features it is unlikely that an individual has just one specific allergy and if somebody has allergies like i had as a kid then we would be modelling them as having distinct diseases
| 1
|
628,058
| 19,974,661,693
|
IssuesEvent
|
2022-01-29 00:14:31
|
MattTheLegoman/RealmsInExile
|
https://api.github.com/repos/MattTheLegoman/RealmsInExile
|
closed
|
The Golden King has wrong headgear on bookmark screen
|
bug oddity priority: high
|
reported this yesterday on discord, but i thought to make it an issue so it ain't forgotten.
|
1.0
|
The Golden King has wrong headgear on bookmark screen - reported this yesterday on discord, but i thought to make it an issue so it ain't forgotten.
|
priority
|
the golden king has wrong headgear on bookmark screen reported this yesterday on discord but i thought to make it an issue so it ain t forgotten
| 1
|
35,605
| 2,791,491,429
|
IssuesEvent
|
2015-05-10 05:59:49
|
afollestad/cabinet-issue-tracker
|
https://api.github.com/repos/afollestad/cabinet-issue-tracker
|
opened
|
Use SortedList for RecyclerView file listing
|
enhancement high priority in progress
|
This will make updating the list with new info much easier (e.g. first run of `ls` to get file names, second run of `ls -l` to get detailed info such as file sizes). Also the animations will be taken care of, so that's nice.
Noting these resources for myself while I work on this:
Official demo
https://github.com/android/platform_development/blob/master/samples/Support7Demos/src/com/example/android/supportv7/util/SortedListActivity.java
Some useful info
http://stackoverflow.com/questions/29795299/what-is-the-sortedlistt-working-with-recyclerview-adapter
Docs
http://developer.android.com/reference/android/support/v7/util/SortedList.html
|
1.0
|
Use SortedList for RecyclerView file listing - This will make updating the list with new info much easier (e.g. first run of `ls` to get file names, second run of `ls -l` to get detailed info such as file sizes). Also the animations will be taken care of, so that's nice.
Noting these resources for myself while I work on this:
Official demo
https://github.com/android/platform_development/blob/master/samples/Support7Demos/src/com/example/android/supportv7/util/SortedListActivity.java
Some useful info
http://stackoverflow.com/questions/29795299/what-is-the-sortedlistt-working-with-recyclerview-adapter
Docs
http://developer.android.com/reference/android/support/v7/util/SortedList.html
|
priority
|
use sortedlist for recyclerview file listing this will make updating the list with new info much easier e g first run of ls to get file names second run of ls l to get detailed info such as file sizes also the animations will be taken care of so that s nice noting these resources for myself while i work on this official demo some useful info docs
| 1
|
36,506
| 2,800,293,073
|
IssuesEvent
|
2015-05-13 09:06:33
|
OCHA-DAP/hdx-ckan
|
https://api.github.com/repos/OCHA-DAP/hdx-ckan
|
closed
|
geo-preview: geo transformation via ogre not triggered for private datasets
|
bug Priority-High
|
1. Create a private dataset
2. add a resource (zipped shapefile)
3. check dataset - no geo-preview
4. make dataset public
5. save again the resource (not need to reupload it)
6. check dataset - geo-preview is enabled
|
1.0
|
geo-preview: geo transformation via ogre not triggered for private datasets - 1. Create a private dataset
2. add a resource (zipped shapefile)
3. check dataset - no geo-preview
4. make dataset public
5. save again the resource (not need to reupload it)
6. check dataset - geo-preview is enabled
|
priority
|
geo preview geo transformation via ogre not triggered for private datasets create a private dataset add a resource zipped shapefile check dataset no geo preview make dataset public save again the resource not need to reupload it check dataset geo preview is enabled
| 1
|
681,628
| 23,318,496,556
|
IssuesEvent
|
2022-08-08 14:26:13
|
redhat-developer/odo
|
https://api.github.com/repos/redhat-developer/odo
|
closed
|
`odo dev`: react to changes as soon as possible
|
priority/High kind/user-story
|
/kind user-story
## User Story
- As an odo user
- I want to make changes to my source code and Devfile (or even external cluster resources)
- So that the changes are considered as soon as possible
## Acceptance Criteria
- [ ] It should handle Devfile changes when a Pod is in an Error state
- [ ] It should not wait for a specific state in the reconcile loop
- [ ] It should watch for all interesting resources (Deployment, ServiceBindings, ...) permanently, i.e. as long as `odo dev` is running
- [ ] It should notify users of the current application state
- [ ] If `odo dev` is running with the `no-watch` flag, it should not watch for files but still continue to watch cluster resources
- [ ] ~It should wait until the container is listening on the intended port before stating the application is ready (see https://github.com/redhat-developer/odo/issues/5877) => tracked in #5877~
## Notes
- Use new approach based on reconcile loop POC: https://github.com/feloy/odo-dev-controller-poc
- Manual trigger will be done in https://github.com/redhat-developer/odo/issues/5634
## Links
- Related Epic (mandatory): https://github.com/redhat-developer/odo/issues/5848
- Parent User Story: https://github.com/redhat-developer/odo/issues/5728
/kind user-story
|
1.0
|
`odo dev`: react to changes as soon as possible - /kind user-story
## User Story
- As an odo user
- I want to make changes to my source code and Devfile (or even external cluster resources)
- So that the changes are considered as soon as possible
## Acceptance Criteria
- [ ] It should handle Devfile changes when a Pod is in an Error state
- [ ] It should not wait for a specific state in the reconcile loop
- [ ] It should watch for all interesting resources (Deployment, ServiceBindings, ...) permanently, i.e. as long as `odo dev` is running
- [ ] It should notify users of the current application state
- [ ] If `odo dev` is running with the `no-watch` flag, it should not watch for files but still continue to watch cluster resources
- [ ] ~It should wait until the container is listening on the intended port before stating the application is ready (see https://github.com/redhat-developer/odo/issues/5877) => tracked in #5877~
## Notes
- Use new approach based on reconcile loop POC: https://github.com/feloy/odo-dev-controller-poc
- Manual trigger will be done in https://github.com/redhat-developer/odo/issues/5634
## Links
- Related Epic (mandatory): https://github.com/redhat-developer/odo/issues/5848
- Parent User Story: https://github.com/redhat-developer/odo/issues/5728
/kind user-story
|
priority
|
odo dev react to changes as soon as possible kind user story user story as an odo user i want to make changes to my source code and devfile or even external cluster resources so that the changes are considered as soon as possible acceptance criteria it should handle devfile changes when a pod is in an error state it should not wait for a specific state in the reconcile loop it should watch for all interesting resources deployment servicebindings permanently i e as long as odo dev is running it should notify users of the current application state if odo dev is running with the no watch flag it should not watch for files but still continue to watch cluster resources it should wait until the container is listening on the intended port before stating the application is ready see tracked in notes use new approach based on reconcile loop poc manual trigger will be done in links related epic mandatory parent user story kind user story
| 1
|
407,870
| 11,938,461,060
|
IssuesEvent
|
2020-04-02 13:49:28
|
sunpy/sunpy
|
https://api.github.com/repos/sunpy/sunpy
|
closed
|
UnicodeDecodeError With Querying sunpy.net.hek.HEKClient() on Particular Dates
|
Affects Release Bug(?) Close? Effort High Package Novice Priority Medium net
|
I'm trying to query HEK using sunpy.net.hek.HEKClient(), but I'm getting a UnicodeDecodeError when I try to query some dates. Example query with traceback:
```python
In [13]: from datetime import timedelta
In [14]: start = sunpy.time.parse_time('2013/12/23')
In [15]: end = start + timedelta(days=1)
In [16]: from sunpy.net import hek
In [17]: client = hek.HEKClient()
In [18]: result = client.query(hek.attrs.Time(start, end),hek.attrs.EventType('FL'))
---------------------------------------------------------------------------
UnicodeDecodeError Traceback (most recent call last)
<ipython-input-18-5488d4f586ca> in <module>()
----> 1 result = client.query(hek.attrs.Time(start, end),hek.attrs.EventType('FL'))
/Users/pauly/anaconda3/lib/python3.5/site-packages/sunpy/net/hek/hek.py in query(self, *query)
92
93 if len(ndata) == 1:
---> 94 return self._download(ndata[0])
95 else:
96 return self._merge(self._download(data) for data in ndata)
/Users/pauly/anaconda3/lib/python3.5/site-packages/sunpy/net/hek/hek.py in _download(self, data)
68 self.url, urllib.parse.urlencode(data).encode('utf-8'))
69 try:
---> 70 result = json.load(reader(fd))
71 finally:
72 fd.close()
/Users/pauly/anaconda3/lib/python3.5/json/__init__.py in load(fp, cls, object_hook, parse_float, parse_int, parse_constant, object_pairs_hook, **kw)
263
264 #"""
--> 265 return loads(fp.read(),
266 cls=cls, object_hook=object_hook,
267 parse_float=parse_float, parse_int=parse_int,
/Users/pauly/anaconda3/lib/python3.5/codecs.py in read(self, size, chars, firstline)
499 break
500 try:
--> 501 newchars, decodedbytes = self.decode(data, self.errors)
502 except UnicodeDecodeError as exc:
503 if firstline:
UnicodeDecodeError: 'utf-8' codec can't decode byte 0xc5 in position 94615: invalid continuation byte
```
It only seems to occur on certain dates, but it does that consistently with the dates it does fail on. I can provide a list of some of the dates that it fails on if it would be helpful. I am using Sunpy 0.7.3.
|
1.0
|
UnicodeDecodeError With Querying sunpy.net.hek.HEKClient() on Particular Dates - I'm trying to query HEK using sunpy.net.hek.HEKClient(), but I'm getting a UnicodeDecodeError when I try to query some dates. Example query with traceback:
```python
In [13]: from datetime import timedelta
In [14]: start = sunpy.time.parse_time('2013/12/23')
In [15]: end = start + timedelta(days=1)
In [16]: from sunpy.net import hek
In [17]: client = hek.HEKClient()
In [18]: result = client.query(hek.attrs.Time(start, end),hek.attrs.EventType('FL'))
---------------------------------------------------------------------------
UnicodeDecodeError Traceback (most recent call last)
<ipython-input-18-5488d4f586ca> in <module>()
----> 1 result = client.query(hek.attrs.Time(start, end),hek.attrs.EventType('FL'))
/Users/pauly/anaconda3/lib/python3.5/site-packages/sunpy/net/hek/hek.py in query(self, *query)
92
93 if len(ndata) == 1:
---> 94 return self._download(ndata[0])
95 else:
96 return self._merge(self._download(data) for data in ndata)
/Users/pauly/anaconda3/lib/python3.5/site-packages/sunpy/net/hek/hek.py in _download(self, data)
68 self.url, urllib.parse.urlencode(data).encode('utf-8'))
69 try:
---> 70 result = json.load(reader(fd))
71 finally:
72 fd.close()
/Users/pauly/anaconda3/lib/python3.5/json/__init__.py in load(fp, cls, object_hook, parse_float, parse_int, parse_constant, object_pairs_hook, **kw)
263
264 #"""
--> 265 return loads(fp.read(),
266 cls=cls, object_hook=object_hook,
267 parse_float=parse_float, parse_int=parse_int,
/Users/pauly/anaconda3/lib/python3.5/codecs.py in read(self, size, chars, firstline)
499 break
500 try:
--> 501 newchars, decodedbytes = self.decode(data, self.errors)
502 except UnicodeDecodeError as exc:
503 if firstline:
UnicodeDecodeError: 'utf-8' codec can't decode byte 0xc5 in position 94615: invalid continuation byte
```
It only seems to occur on certain dates, but it does that consistently with the dates it does fail on. I can provide a list of some of the dates that it fails on if it would be helpful. I am using Sunpy 0.7.3.
|
priority
|
unicodedecodeerror with querying sunpy net hek hekclient on particular dates i m trying to query hek using sunpy net hek hekclient but i m getting a unicodedecodeerror when i try to query some dates example query with traceback python in from datetime import timedelta in start sunpy time parse time in end start timedelta days in from sunpy net import hek in client hek hekclient in result client query hek attrs time start end hek attrs eventtype fl unicodedecodeerror traceback most recent call last in result client query hek attrs time start end hek attrs eventtype fl users pauly lib site packages sunpy net hek hek py in query self query if len ndata return self download ndata else return self merge self download data for data in ndata users pauly lib site packages sunpy net hek hek py in download self data self url urllib parse urlencode data encode utf try result json load reader fd finally fd close users pauly lib json init py in load fp cls object hook parse float parse int parse constant object pairs hook kw return loads fp read cls cls object hook object hook parse float parse float parse int parse int users pauly lib codecs py in read self size chars firstline break try newchars decodedbytes self decode data self errors except unicodedecodeerror as exc if firstline unicodedecodeerror utf codec can t decode byte in position invalid continuation byte it only seems to occur on certain dates but it does that consistently with the dates it does fail on i can provide a list of some of the dates that it fails on if it would be helpful i am using sunpy
| 1
|
119,777
| 4,775,835,473
|
IssuesEvent
|
2016-10-27 11:53:00
|
ObjectiveSubject/cgu
|
https://api.github.com/repos/ObjectiveSubject/cgu
|
closed
|
Shortcodes: issues with nested shortcodes
|
From Client High Priority
|
@kpettinga From Hollis:
http://cgu.wpengine.com/school/drucker-school-of-management/careers/
Click on the "For Current Students & Alumni" dropdown - the column shortcodes don't work. If I move them outside the dropdown, they start working again.
|
1.0
|
Shortcodes: issues with nested shortcodes - @kpettinga From Hollis:
http://cgu.wpengine.com/school/drucker-school-of-management/careers/
Click on the "For Current Students & Alumni" dropdown - the column shortcodes don't work. If I move them outside the dropdown, they start working again.
|
priority
|
shortcodes issues with nested shortcodes kpettinga from hollis click on the for current students alumni dropdown the column shortcodes don t work if i move them outside the dropdown they start working again
| 1
|
362,349
| 10,726,360,742
|
IssuesEvent
|
2019-10-28 09:14:13
|
AY1920S1-CS2103-T11-1/main
|
https://api.github.com/repos/AY1920S1-CS2103-T11-1/main
|
closed
|
Update User Guide for Fill and Submit commands
|
priority.High status.Ongoing type.Task
|
- mention the two modes usage and WHY they have are useful
- mention how the index referencing works
|
1.0
|
Update User Guide for Fill and Submit commands - - mention the two modes usage and WHY they have are useful
- mention how the index referencing works
|
priority
|
update user guide for fill and submit commands mention the two modes usage and why they have are useful mention how the index referencing works
| 1
|
610,021
| 18,892,500,998
|
IssuesEvent
|
2021-11-15 14:39:27
|
carbon-design-system/carbon-for-ibm-dotcom
|
https://api.github.com/repos/carbon-design-system/carbon-for-ibm-dotcom
|
closed
|
[Filter panel] design-build-document new component
|
Feature request priority: high adopter support epic adopter: AEM
|
## Filter panel - new component
This component has shown up in various forms in many new dotcom sites:
- Products landing (Martin) https://www.ibm.com/products
- Dotcom search results (Martin) https://www.ibm.com/search?lang=en&cc=us&q=db2&tabType[0]=Products
- Cloud learn landing (Pavol Prok, [see a slightly outdated version here](https://xd.adobe.com/view/7dc2dc38-71d2-476f-8be6-570f178b04e0-2891/screen/1ed147c6-8f82-4bc7-9e39-0e2890462f18?fullscreen&hints=off ))
- Cloud case studies landing (Niko Georgantas)
- DAM (Seth Carnes)
### Key design considerations to sort out:
- Grid usage. This bar likely sits outside the grid
- Type size. Ideally 14px to reduce text line wrapping, which complicates expressive theme
- States. This bar need several states of expansion, toggle select, and a way to reset to default state
- Search. Many use cases have this bar in conjunction to search, citing users needing both to find what they are looking far.
### Initial & incomplete audit of existing designs:
Only for visual reference. A complete audit is still needed.
### Resources
[Filter panel](https://ibm.ent.box.com/folder/136914860547?s=19a0hjn61gh3qh59kbgxba43y8uymuqy) Design specs
[Filter group](https://ibm.ent.box.com/folder/137685560033) Design specs
[Input select](https://ibm.ent.box.com/folder/137327521624) Design spec
[Filter group](https://github.com/carbon-design-system/carbon-for-ibm-dotcom-website/wiki/Filter-group) functional specs
[Filter panel](https://github.com/carbon-design-system/carbon-for-ibm-dotcom-website/wiki/Filter-panel) functional specs
[Filer panel input select](https://github.com/carbon-design-system/carbon-for-ibm-dotcom-website/wiki/Input-select) functional specs
#### Final designs
- [DDS Design Box folder link](https://ibm.box.com/s/19a0hjn61gh3qh59kbgxba43y8uymuqy)
|
1.0
|
[Filter panel] design-build-document new component - ## Filter panel - new component
This component has shown up in various forms in many new dotcom sites:
- Products landing (Martin) https://www.ibm.com/products
- Dotcom search results (Martin) https://www.ibm.com/search?lang=en&cc=us&q=db2&tabType[0]=Products
- Cloud learn landing (Pavol Prok, [see a slightly outdated version here](https://xd.adobe.com/view/7dc2dc38-71d2-476f-8be6-570f178b04e0-2891/screen/1ed147c6-8f82-4bc7-9e39-0e2890462f18?fullscreen&hints=off ))
- Cloud case studies landing (Niko Georgantas)
- DAM (Seth Carnes)
### Key design considerations to sort out:
- Grid usage. This bar likely sits outside the grid
- Type size. Ideally 14px to reduce text line wrapping, which complicates expressive theme
- States. This bar need several states of expansion, toggle select, and a way to reset to default state
- Search. Many use cases have this bar in conjunction to search, citing users needing both to find what they are looking far.
### Initial & incomplete audit of existing designs:
Only for visual reference. A complete audit is still needed.
### Resources
[Filter panel](https://ibm.ent.box.com/folder/136914860547?s=19a0hjn61gh3qh59kbgxba43y8uymuqy) Design specs
[Filter group](https://ibm.ent.box.com/folder/137685560033) Design specs
[Input select](https://ibm.ent.box.com/folder/137327521624) Design spec
[Filter group](https://github.com/carbon-design-system/carbon-for-ibm-dotcom-website/wiki/Filter-group) functional specs
[Filter panel](https://github.com/carbon-design-system/carbon-for-ibm-dotcom-website/wiki/Filter-panel) functional specs
[Filer panel input select](https://github.com/carbon-design-system/carbon-for-ibm-dotcom-website/wiki/Input-select) functional specs
#### Final designs
- [DDS Design Box folder link](https://ibm.box.com/s/19a0hjn61gh3qh59kbgxba43y8uymuqy)
|
priority
|
design build document new component filter panel new component this component has shown up in various forms in many new dotcom sites products landing martin dotcom search results martin products cloud learn landing pavol prok cloud case studies landing niko georgantas dam seth carnes key design considerations to sort out grid usage this bar likely sits outside the grid type size ideally to reduce text line wrapping which complicates expressive theme states this bar need several states of expansion toggle select and a way to reset to default state search many use cases have this bar in conjunction to search citing users needing both to find what they are looking far initial incomplete audit of existing designs only for visual reference a complete audit is still needed resources design specs design specs design spec functional specs functional specs functional specs final designs
| 1
|
786,554
| 27,658,679,223
|
IssuesEvent
|
2023-03-12 09:07:30
|
devvsakib/power-the-web
|
https://api.github.com/repos/devvsakib/power-the-web
|
opened
|
[FEAT]: add Nextjs interview question
|
enhancement help wanted good first issue [priority: high] EddieHub:good-first-issue
|
**Is your feature request related to a problem? Please describe.**
We are collecting often-asked interview questions for Web Developers. Before adding questions and answers, please make sure if the question is already added or not. Use the search option to search your questions Ctlr+F/ cmd+F
path `src/json/interviewquestions.json`
Topics:
<!-- Do not delete this -->
**IMPORTANT**
If it's your first Contribution to this project, please add your details to the Contributors file
File Path: `src/json/Contributors.json`
> If you do not add your details, your PR will be Close
|
1.0
|
[FEAT]: add Nextjs interview question - **Is your feature request related to a problem? Please describe.**
We are collecting often-asked interview questions for Web Developers. Before adding questions and answers, please make sure if the question is already added or not. Use the search option to search your questions Ctlr+F/ cmd+F
path `src/json/interviewquestions.json`
Topics:
<!-- Do not delete this -->
**IMPORTANT**
If it's your first Contribution to this project, please add your details to the Contributors file
File Path: `src/json/Contributors.json`
> If you do not add your details, your PR will be Close
|
priority
|
add nextjs interview question is your feature request related to a problem please describe we are collecting often asked interview questions for web developers before adding questions and answers please make sure if the question is already added or not use the search option to search your questions ctlr f cmd f path src json interviewquestions json topics important if it s your first contribution to this project please add your details to the contributors file file path src json contributors json if you do not add your details your pr will be close
| 1
|
122,992
| 4,848,102,806
|
IssuesEvent
|
2016-11-10 16:37:58
|
mantidproject/mantid
|
https://api.github.com/repos/mantidproject/mantid
|
closed
|
Numpy version upgrade
|
Component: Framework Misc: Archived Priority: High
|
This issue was originally [TRAC 8002](http://trac.mantidproject.org/mantid/ticket/8002)
This has been raised by Rob (cc'd). The versions of Numpy that we use are quite different. This makes saving numpy arrays and reloading them on different platforms impossible.
Looks like we get/use the following versions on platforms I've looked at so far:
1.6.1 Mountain Lion
1.6.2 Windows 7 x64
1.4.1 RHEL6
A standardised Numpy version would probably solve the issue that Rob is experiencing. Not sure what the wider caveats of this will be. Could we do something about this for release 3.0?
|
1.0
|
Numpy version upgrade - This issue was originally [TRAC 8002](http://trac.mantidproject.org/mantid/ticket/8002)
This has been raised by Rob (cc'd). The versions of Numpy that we use are quite different. This makes saving numpy arrays and reloading them on different platforms impossible.
Looks like we get/use the following versions on platforms I've looked at so far:
1.6.1 Mountain Lion
1.6.2 Windows 7 x64
1.4.1 RHEL6
A standardised Numpy version would probably solve the issue that Rob is experiencing. Not sure what the wider caveats of this will be. Could we do something about this for release 3.0?
|
priority
|
numpy version upgrade this issue was originally this has been raised by rob cc d the versions of numpy that we use are quite different this makes saving numpy arrays and reloading them on different platforms impossible looks like we get use the following versions on platforms i ve looked at so far mountain lion windows a standardised numpy version would probably solve the issue that rob is experiencing not sure what the wider caveats of this will be could we do something about this for release
| 1
|
623,215
| 19,663,337,465
|
IssuesEvent
|
2022-01-10 19:26:02
|
CarnegieLearningWeb/UpGrade
|
https://api.github.com/repos/CarnegieLearningWeb/UpGrade
|
closed
|
Reloading of the experiment detail page does not work
|
bug priority: high
|
Right now, when you reload the experiment detail page, you only get the left menu back but the detail section goes blank. See below:
In the network tab, we see a 404 error that might be related:
Vivek suggested a solution where we create a new route in the backend that is missing.
|
1.0
|
Reloading of the experiment detail page does not work - Right now, when you reload the experiment detail page, you only get the left menu back but the detail section goes blank. See below:
In the network tab, we see a 404 error that might be related:
Vivek suggested a solution where we create a new route in the backend that is missing.
|
priority
|
reloading of the experiment detail page does not work right now when you reload the experiment detail page you only get the left menu back but the detail section goes blank see below in the network tab we see a error that might be related vivek suggested a solution where we create a new route in the backend that is missing
| 1
|
463,391
| 13,264,546,453
|
IssuesEvent
|
2020-08-21 04:01:09
|
MyDataTaiwan/mylog14
|
https://api.github.com/repos/MyDataTaiwan/mylog14
|
closed
|
[Bug Report] i18n related - changing language to Japanese & French the setting page displayed in English
|
QA fix commited fix verified priority-high
|
**Description**
changing language to Japanese & French the setting page displayed in English
**Environment**
* MyLog: v 0.9.0
* OS: Android 8.1.0 , ios 13.3.1
|
1.0
|
[Bug Report] i18n related - changing language to Japanese & French the setting page displayed in English - **Description**
changing language to Japanese & French the setting page displayed in English
**Environment**
* MyLog: v 0.9.0
* OS: Android 8.1.0 , ios 13.3.1
|
priority
|
related changing language to japanese french the setting page displayed in english description changing language to japanese french the setting page displayed in english environment mylog v os android ios
| 1
|
797,711
| 28,152,558,919
|
IssuesEvent
|
2023-04-03 03:32:11
|
ADACS-Australia/TraceT
|
https://api.github.com/repos/ADACS-Australia/TraceT
|
closed
|
Migrate to kafka VOEvent/json clients
|
enhancement High Priority
|
The 4pisky.org broker that we connect to with comet is not only unreliable (#97) but as of 2 weeks ago it is simply offline.
Subscribing to multiple VOEvent brokers (eg, dc3 as per d582577) is a partial solution, however the VOEvent network itself still seems flaky.
Andrew has suggested that we subscribe to the GCN to receive events directly, however they are now migrating distribute via kafka (see [here](https://gcn.nasa.gov/)) and are no longer accepting new "site configurations".
[grace-db](https://gracedb.ligo.org/) are also using a kafka based distribution method.
Both the GCN and grace-db networks have a client available to receive the events, but the registration process and implementation are different/
|
1.0
|
Migrate to kafka VOEvent/json clients - The 4pisky.org broker that we connect to with comet is not only unreliable (#97) but as of 2 weeks ago it is simply offline.
Subscribing to multiple VOEvent brokers (eg, dc3 as per d582577) is a partial solution, however the VOEvent network itself still seems flaky.
Andrew has suggested that we subscribe to the GCN to receive events directly, however they are now migrating distribute via kafka (see [here](https://gcn.nasa.gov/)) and are no longer accepting new "site configurations".
[grace-db](https://gracedb.ligo.org/) are also using a kafka based distribution method.
Both the GCN and grace-db networks have a client available to receive the events, but the registration process and implementation are different/
|
priority
|
migrate to kafka voevent json clients the org broker that we connect to with comet is not only unreliable but as of weeks ago it is simply offline subscribing to multiple voevent brokers eg as per is a partial solution however the voevent network itself still seems flaky andrew has suggested that we subscribe to the gcn to receive events directly however they are now migrating distribute via kafka see and are no longer accepting new site configurations are also using a kafka based distribution method both the gcn and grace db networks have a client available to receive the events but the registration process and implementation are different
| 1
|
266,446
| 8,367,761,904
|
IssuesEvent
|
2018-10-04 13:10:50
|
ballerina-platform/ballerina-lang
|
https://api.github.com/repos/ballerina-platform/ballerina-lang
|
closed
|
Need to scroll a lot horizontally to see the full xml message when debugging
|
Component/Composer Component/Debugger Imported Priority/High Type/Improvement
|
<a href="https://github.com/dilinisg"><img src="https://avatars2.githubusercontent.com/u/1845370?v=4" align="left" width="96" height="96" hspace="10"></img></a> **Issue by [dilinisg](https://github.com/dilinisg)**
_Tuesday Aug 29, 2017 at 09:32 GMT_
_Originally opened as https://github.com/ballerina-lang/composer/issues/2954_
----
Release 0.93
Need to scroll a lot horizontally to see the full xml message when there are multiple namespaces
|
1.0
|
Need to scroll a lot horizontally to see the full xml message when debugging - <a href="https://github.com/dilinisg"><img src="https://avatars2.githubusercontent.com/u/1845370?v=4" align="left" width="96" height="96" hspace="10"></img></a> **Issue by [dilinisg](https://github.com/dilinisg)**
_Tuesday Aug 29, 2017 at 09:32 GMT_
_Originally opened as https://github.com/ballerina-lang/composer/issues/2954_
----
Release 0.93
Need to scroll a lot horizontally to see the full xml message when there are multiple namespaces
|
priority
|
need to scroll a lot horizontally to see the full xml message when debugging issue by tuesday aug at gmt originally opened as release need to scroll a lot horizontally to see the full xml message when there are multiple namespaces
| 1
|
370,158
| 10,926,043,363
|
IssuesEvent
|
2019-11-22 13:55:56
|
ahmedkaludi/accelerated-mobile-pages
|
https://api.github.com/repos/ahmedkaludi/accelerated-mobile-pages
|
closed
|
Tree-shaking issue when user using "Clearfy optimization plugin" plugin(need to build compatibility).
|
[Priority: HIGH] bug
|
When a user using the "Clearfy optimization plugin" plugin then clear cache in performance is not working properly. Need to build compatibility with Clearfy cache plugin.
Note: In order to recreate the issue enable users Clearfy optimization plugin's settings.
Ref URL: https://secure.helpscout.net/conversation/1008388028/0/?folderId=3126461
|
1.0
|
Tree-shaking issue when user using "Clearfy optimization plugin" plugin(need to build compatibility). - When a user using the "Clearfy optimization plugin" plugin then clear cache in performance is not working properly. Need to build compatibility with Clearfy cache plugin.
Note: In order to recreate the issue enable users Clearfy optimization plugin's settings.
Ref URL: https://secure.helpscout.net/conversation/1008388028/0/?folderId=3126461
|
priority
|
tree shaking issue when user using clearfy optimization plugin plugin need to build compatibility when a user using the clearfy optimization plugin plugin then clear cache in performance is not working properly need to build compatibility with clearfy cache plugin note in order to recreate the issue enable users clearfy optimization plugin s settings ref url
| 1
|
608,396
| 18,837,632,917
|
IssuesEvent
|
2021-11-11 04:19:50
|
boostcampwm-2021/iOS05-Escaper
|
https://api.github.com/repos/boostcampwm-2021/iOS05-Escaper
|
closed
|
[E8 S1 T1] 사용자 방 UI를 구현한다.
|
feature High Priority
|
### Epic - Story - Task
Epic : 상세 페이지
Story : 사용자가 방에 대한 정보를 볼 수 있다
Task : 사용자 방 UI를 구현한다.
### 완료조건
- [ ] 디테일 화면 기본 UI를 완성한다. 방에 대한 기본정보가 들어가면 된다.
|
1.0
|
[E8 S1 T1] 사용자 방 UI를 구현한다. - ### Epic - Story - Task
Epic : 상세 페이지
Story : 사용자가 방에 대한 정보를 볼 수 있다
Task : 사용자 방 UI를 구현한다.
### 완료조건
- [ ] 디테일 화면 기본 UI를 완성한다. 방에 대한 기본정보가 들어가면 된다.
|
priority
|
사용자 방 ui를 구현한다 epic story task epic 상세 페이지 story 사용자가 방에 대한 정보를 볼 수 있다 task 사용자 방 ui를 구현한다 완료조건 디테일 화면 기본 ui를 완성한다 방에 대한 기본정보가 들어가면 된다
| 1
|
264,982
| 8,329,127,902
|
IssuesEvent
|
2018-09-27 04:49:31
|
AtlasOfLivingAustralia/biocollect
|
https://api.github.com/repos/AtlasOfLivingAustralia/biocollect
|
closed
|
View data - Buttons to view in occurrence explorer and spatial portal not working for most projects
|
Priority - high Product - BioCollect Source - client request Status - completed Type - bug
|
The buttons to view data in the ALA occurrence explorer and spatial portal are only working for the sightings.ala.org.au project. We need for these to work for all projects and filtered selections of data from BioCollect.
High importance because a client is dependent on it being fixed asap.
|
1.0
|
View data - Buttons to view in occurrence explorer and spatial portal not working for most projects - The buttons to view data in the ALA occurrence explorer and spatial portal are only working for the sightings.ala.org.au project. We need for these to work for all projects and filtered selections of data from BioCollect.
High importance because a client is dependent on it being fixed asap.
|
priority
|
view data buttons to view in occurrence explorer and spatial portal not working for most projects the buttons to view data in the ala occurrence explorer and spatial portal are only working for the sightings ala org au project we need for these to work for all projects and filtered selections of data from biocollect high importance because a client is dependent on it being fixed asap
| 1
|
51,067
| 3,010,512,049
|
IssuesEvent
|
2015-07-28 13:38:12
|
ankidroid/Anki-Android
|
https://api.github.com/repos/ankidroid/Anki-Android
|
closed
|
Implement log collector
|
accepted enhancement Priority-High
|
Originally reported on Google Code with ID 2062
```
Since Android 4.1, Android apps can not only see their own log.
Apps like LogCollector don't work anymore.
It becomes very difficult to debug user problems.
A solution could be to implement a mini LogCollector inside AnkiDroid, which would
allow users to send their log.
Should it POST to a server, or send an email, or a copy/paste?
I think data should only be visible by a few developers, not public.
Feedback welcome!
```
Reported by `nicolas.raoul` on 2014-04-03 09:53:36
|
1.0
|
Implement log collector - Originally reported on Google Code with ID 2062
```
Since Android 4.1, Android apps can not only see their own log.
Apps like LogCollector don't work anymore.
It becomes very difficult to debug user problems.
A solution could be to implement a mini LogCollector inside AnkiDroid, which would
allow users to send their log.
Should it POST to a server, or send an email, or a copy/paste?
I think data should only be visible by a few developers, not public.
Feedback welcome!
```
Reported by `nicolas.raoul` on 2014-04-03 09:53:36
|
priority
|
implement log collector originally reported on google code with id since android android apps can not only see their own log apps like logcollector don t work anymore it becomes very difficult to debug user problems a solution could be to implement a mini logcollector inside ankidroid which would allow users to send their log should it post to a server or send an email or a copy paste i think data should only be visible by a few developers not public feedback welcome reported by nicolas raoul on
| 1
|
640,033
| 20,771,529,584
|
IssuesEvent
|
2022-03-16 05:36:28
|
AY2122S2-CS2103T-W13-4/tp
|
https://api.github.com/repos/AY2122S2-CS2103T-W13-4/tp
|
closed
|
As a first time user, I can track my clients' birthdays
|
priority.High type.Story
|
so that I can surprise them for their birthdays
|
1.0
|
As a first time user, I can track my clients' birthdays - so that I can surprise them for their birthdays
|
priority
|
as a first time user i can track my clients birthdays so that i can surprise them for their birthdays
| 1
|
222,553
| 7,433,724,633
|
IssuesEvent
|
2018-03-26 08:38:47
|
CS2103JAN2018-W10-B3/main
|
https://api.github.com/repos/CS2103JAN2018-W10-B3/main
|
opened
|
Implement Interactive Chat-like UI for Commands
|
priority.high type.epic
|
# 🌟Interactive Chat-like UI for Commands
Prompt user for details when using commands as opposed to fields `Enters interaction mode.`
## Order of priority of implementation
🥇`add` command
🥈`edit` command
🥉`order` command
Sample use case:
1. User: `add`
2. System: `Enter name:`
3. User: `Chicken Burger`
4. System: `Enter phone number to order:`
5. User: `98790000`
6. System: `Want to add optional fields? Choose from: email, allergy, price, rating, health. Else 'done' to finish`
6. User: `done`
## Legacy commands should still work
eg. `add n/Chicken Burger p/98790000` should still work
## If time permits
- Natural language detection
- UI: Chat flow
## Bonus: CLI and System Messages UI into Chat interface
- Strip CLI and System messages box into a messaging system
- More user friendly
|
1.0
|
Implement Interactive Chat-like UI for Commands - # 🌟Interactive Chat-like UI for Commands
Prompt user for details when using commands as opposed to fields `Enters interaction mode.`
## Order of priority of implementation
🥇`add` command
🥈`edit` command
🥉`order` command
Sample use case:
1. User: `add`
2. System: `Enter name:`
3. User: `Chicken Burger`
4. System: `Enter phone number to order:`
5. User: `98790000`
6. System: `Want to add optional fields? Choose from: email, allergy, price, rating, health. Else 'done' to finish`
6. User: `done`
## Legacy commands should still work
eg. `add n/Chicken Burger p/98790000` should still work
## If time permits
- Natural language detection
- UI: Chat flow
## Bonus: CLI and System Messages UI into Chat interface
- Strip CLI and System messages box into a messaging system
- More user friendly
|
priority
|
implement interactive chat like ui for commands 🌟interactive chat like ui for commands prompt user for details when using commands as opposed to fields enters interaction mode order of priority of implementation 🥇 add command 🥈 edit command 🥉 order command sample use case user add system enter name user chicken burger system enter phone number to order user system want to add optional fields choose from email allergy price rating health else done to finish user done legacy commands should still work eg add n chicken burger p should still work if time permits natural language detection ui chat flow bonus cli and system messages ui into chat interface strip cli and system messages box into a messaging system more user friendly
| 1
|
288,266
| 8,837,603,703
|
IssuesEvent
|
2019-01-05 07:10:21
|
Ohesachite/hyland-hackathon-project-1
|
https://api.github.com/repos/Ohesachite/hyland-hackathon-project-1
|
opened
|
search & filter -- listings
|
feature priority high
|
this page is dedicated to creating data queries (via searching and filtering) and displaying their results, specifically regarding the job listings. it should be similar in overall structure to the other search & filter pages, but with specific sections relating to the unique data set that listings involve.
the query component should consist of two major elements:
- a search bar (that's used to find listings by position title if possible)
- a more detailed list of filters (ideally hidden in a drop-down component until clicked on, similar to the [5eTools filter menu](https://5e.tools/bestiary), but that's a moderately advanced styling item, so don't feel terribly obliged to support it if you don't have the time or ability -- setting as low-to-medium priority due to heavy workload for the front-end developer)
filter options should include:
- listings by specific companies
- listings by the tags of the company that created each one (including a rating between 1 and 7, inclusive, for each tag)
- listings by the skills they require (including a configurable range of proficiency ratings they seek for each one; explicit minimum and maximum bounds) -- this would likely be best to have a similar layout to adding skills
- (low priority, non-essential and high workload for underlying logic) search for listings you qualify for (based on your choice of self-evaluation and peer evaluation)
- (medium priority, not terribly essential and might have a somewhat high workload all-around) listings created in a certain date range (explicit start and end dates; start should include option for incredibly early
- (medium-to-low priority, not entirely essential and may have a somewhat high workload for the front-end) toggle to make any individual filter _exclude_ matching results as opposed to _include_ them
below the query component should be the results list. this can be a simple `<table>` tag that's fed uniformly-styled `<tr>`s populated with `<td>`s containing listing data, including the following:
- listing title
- company posting the listing
- date posted
Depending on which you prefer, we could either do a "page view" displaying `x` (around 10-20) relevant listings per page, or (likely much simpler and less time-consuming) just fill it with all matching listings and setting the table to `overflow-y: scroll;` -- either way, it should have a static height.
when the user clicks on a listing, it should ideally load the listing overview page in an iframe to the right of the other two modules (medium priority); however, if this proves too time consuming, we can simply make each row (or even just the position titles) link to the relevant listing overview like any other webpage.
finally, as per usual, I'll personally handle all the interfacing with the data itself; however, note that this is a _very_ involved page in regards to not only the complexity of the design itself, but in how closely it's related to how the data is structured. if you undertake any of the filter pages, you'd probably be best devoting yourself to spending most of the day tomorrow on building them.
|
1.0
|
search & filter -- listings - this page is dedicated to creating data queries (via searching and filtering) and displaying their results, specifically regarding the job listings. it should be similar in overall structure to the other search & filter pages, but with specific sections relating to the unique data set that listings involve.
the query component should consist of two major elements:
- a search bar (that's used to find listings by position title if possible)
- a more detailed list of filters (ideally hidden in a drop-down component until clicked on, similar to the [5eTools filter menu](https://5e.tools/bestiary), but that's a moderately advanced styling item, so don't feel terribly obliged to support it if you don't have the time or ability -- setting as low-to-medium priority due to heavy workload for the front-end developer)
filter options should include:
- listings by specific companies
- listings by the tags of the company that created each one (including a rating between 1 and 7, inclusive, for each tag)
- listings by the skills they require (including a configurable range of proficiency ratings they seek for each one; explicit minimum and maximum bounds) -- this would likely be best to have a similar layout to adding skills
- (low priority, non-essential and high workload for underlying logic) search for listings you qualify for (based on your choice of self-evaluation and peer evaluation)
- (medium priority, not terribly essential and might have a somewhat high workload all-around) listings created in a certain date range (explicit start and end dates; start should include option for incredibly early
- (medium-to-low priority, not entirely essential and may have a somewhat high workload for the front-end) toggle to make any individual filter _exclude_ matching results as opposed to _include_ them
below the query component should be the results list. this can be a simple `<table>` tag that's fed uniformly-styled `<tr>`s populated with `<td>`s containing listing data, including the following:
- listing title
- company posting the listing
- date posted
Depending on which you prefer, we could either do a "page view" displaying `x` (around 10-20) relevant listings per page, or (likely much simpler and less time-consuming) just fill it with all matching listings and setting the table to `overflow-y: scroll;` -- either way, it should have a static height.
when the user clicks on a listing, it should ideally load the listing overview page in an iframe to the right of the other two modules (medium priority); however, if this proves too time consuming, we can simply make each row (or even just the position titles) link to the relevant listing overview like any other webpage.
finally, as per usual, I'll personally handle all the interfacing with the data itself; however, note that this is a _very_ involved page in regards to not only the complexity of the design itself, but in how closely it's related to how the data is structured. if you undertake any of the filter pages, you'd probably be best devoting yourself to spending most of the day tomorrow on building them.
|
priority
|
search filter listings this page is dedicated to creating data queries via searching and filtering and displaying their results specifically regarding the job listings it should be similar in overall structure to the other search filter pages but with specific sections relating to the unique data set that listings involve the query component should consist of two major elements a search bar that s used to find listings by position title if possible a more detailed list of filters ideally hidden in a drop down component until clicked on similar to the but that s a moderately advanced styling item so don t feel terribly obliged to support it if you don t have the time or ability setting as low to medium priority due to heavy workload for the front end developer filter options should include listings by specific companies listings by the tags of the company that created each one including a rating between and inclusive for each tag listings by the skills they require including a configurable range of proficiency ratings they seek for each one explicit minimum and maximum bounds this would likely be best to have a similar layout to adding skills low priority non essential and high workload for underlying logic search for listings you qualify for based on your choice of self evaluation and peer evaluation medium priority not terribly essential and might have a somewhat high workload all around listings created in a certain date range explicit start and end dates start should include option for incredibly early medium to low priority not entirely essential and may have a somewhat high workload for the front end toggle to make any individual filter exclude matching results as opposed to include them below the query component should be the results list this can be a simple tag that s fed uniformly styled s populated with s containing listing data including the following listing title company posting the listing date posted depending on which you prefer we could either do a page view displaying x around relevant listings per page or likely much simpler and less time consuming just fill it with all matching listings and setting the table to overflow y scroll either way it should have a static height when the user clicks on a listing it should ideally load the listing overview page in an iframe to the right of the other two modules medium priority however if this proves too time consuming we can simply make each row or even just the position titles link to the relevant listing overview like any other webpage finally as per usual i ll personally handle all the interfacing with the data itself however note that this is a very involved page in regards to not only the complexity of the design itself but in how closely it s related to how the data is structured if you undertake any of the filter pages you d probably be best devoting yourself to spending most of the day tomorrow on building them
| 1
|
213,594
| 7,254,909,678
|
IssuesEvent
|
2018-02-16 13:00:25
|
Sinapse-Energia/AP-Sinapse
|
https://api.github.com/repos/Sinapse-Energia/AP-Sinapse
|
opened
|
[RF][SPI] Firmware not working with hard SPI
|
Device: EN Priority: high Size: 2 Status: new Type: bug
|
After the inclusion of hard SPI the FW is not working. It works only after comment the Contexts.
Please fix it.
|
1.0
|
[RF][SPI] Firmware not working with hard SPI - After the inclusion of hard SPI the FW is not working. It works only after comment the Contexts.
Please fix it.
|
priority
|
firmware not working with hard spi after the inclusion of hard spi the fw is not working it works only after comment the contexts please fix it
| 1
|
126,981
| 5,008,719,995
|
IssuesEvent
|
2016-12-12 20:18:36
|
genome/civic-server
|
https://api.github.com/repos/genome/civic-server
|
closed
|
support clinvar ID as a property on variant
|
high priority
|
In some cases it is impossible to get to a clinvar record through myvariant.info (non simple variants). We would like to be able to add these to the variant record in such cases.
|
1.0
|
support clinvar ID as a property on variant - In some cases it is impossible to get to a clinvar record through myvariant.info (non simple variants). We would like to be able to add these to the variant record in such cases.
|
priority
|
support clinvar id as a property on variant in some cases it is impossible to get to a clinvar record through myvariant info non simple variants we would like to be able to add these to the variant record in such cases
| 1
|
344,282
| 10,342,432,574
|
IssuesEvent
|
2019-09-04 06:25:35
|
status-im/status-go
|
https://api.github.com/repos/status-im/status-go
|
closed
|
Service to store mailservers
|
blocker high priority v1 audit
|
# Problem
To remove realm from status-react, we need a service to save and get mailservers associated with an account
# Implementation
```
{:id :string
:name {:type :string}
:address {:type :string}
:password {:type :string :optional true}
:fleet {:type :string}}
```
We need the following rpc methods:
"mailservers_addMailserver"
"mailservers_getMailservers"
"mailservers_deleteMailserver"
# Acceptance Criteria
Service is integrated on status-react and replaces the current realm table
|
1.0
|
Service to store mailservers - # Problem
To remove realm from status-react, we need a service to save and get mailservers associated with an account
# Implementation
```
{:id :string
:name {:type :string}
:address {:type :string}
:password {:type :string :optional true}
:fleet {:type :string}}
```
We need the following rpc methods:
"mailservers_addMailserver"
"mailservers_getMailservers"
"mailservers_deleteMailserver"
# Acceptance Criteria
Service is integrated on status-react and replaces the current realm table
|
priority
|
service to store mailservers problem to remove realm from status react we need a service to save and get mailservers associated with an account implementation id string name type string address type string password type string optional true fleet type string we need the following rpc methods mailservers addmailserver mailservers getmailservers mailservers deletemailserver acceptance criteria service is integrated on status react and replaces the current realm table
| 1
|
461,917
| 13,238,294,129
|
IssuesEvent
|
2020-08-18 23:55:15
|
fossasia/open-event-frontend
|
https://api.github.com/repos/fossasia/open-event-frontend
|
opened
|
Scheduler: Public Sessions Page Enhance it and fix date bug
|
Priority: High bug enhancement scheduler
|
The public session page needs to be enhanced and fixed as follows:
* the top of the page shows "today" as an option for the date, instead it should show the days of the event as an option
* for the display of the sessions, please use the full width of the middle content area
* In the top right of the middle content area, please add an option to sort the sessions by a) Title (alphabetically), b) Speaker (alphabetically), c) Time/Date
|
1.0
|
Scheduler: Public Sessions Page Enhance it and fix date bug - The public session page needs to be enhanced and fixed as follows:
* the top of the page shows "today" as an option for the date, instead it should show the days of the event as an option
* for the display of the sessions, please use the full width of the middle content area
* In the top right of the middle content area, please add an option to sort the sessions by a) Title (alphabetically), b) Speaker (alphabetically), c) Time/Date
|
priority
|
scheduler public sessions page enhance it and fix date bug the public session page needs to be enhanced and fixed as follows the top of the page shows today as an option for the date instead it should show the days of the event as an option for the display of the sessions please use the full width of the middle content area in the top right of the middle content area please add an option to sort the sessions by a title alphabetically b speaker alphabetically c time date
| 1
|
617,438
| 19,350,787,607
|
IssuesEvent
|
2021-12-15 15:27:00
|
Grasslands-2/GrazeScape
|
https://api.github.com/repos/Grasslands-2/GrazeScape
|
closed
|
Move all geoserver requests from JavaScript to Python
|
Enhancement High Priority
|
WEI has expressed concern about having to another port open on their firewall for the client making requests to geoserver directly. So we are going to move all requests to geoserver into the Python code (since that is behind the firewall). This change will require significant changes to the app.
|
1.0
|
Move all geoserver requests from JavaScript to Python - WEI has expressed concern about having to another port open on their firewall for the client making requests to geoserver directly. So we are going to move all requests to geoserver into the Python code (since that is behind the firewall). This change will require significant changes to the app.
|
priority
|
move all geoserver requests from javascript to python wei has expressed concern about having to another port open on their firewall for the client making requests to geoserver directly so we are going to move all requests to geoserver into the python code since that is behind the firewall this change will require significant changes to the app
| 1
|
306,021
| 9,379,676,071
|
IssuesEvent
|
2019-04-04 15:23:51
|
VeraPrinsen/isomorphisms
|
https://api.github.com/repos/VeraPrinsen/isomorphisms
|
closed
|
Integration test gives wrong answer for cographs1
|
High Priority
|
```
---------------------------
Statistics of cographs1-0_1:
---------------------------
[FAIL] Graphs are not isomorph, is_isomorph determined they were
Processing time is_isomorph(G, H): 0.002 s
Processing time amount_of_isomorphisms(G, H): 0.003 s
---------------------------
Statistics of cographs1-0_2:
---------------------------
[FAIL] Graphs are not isomorph, is_isomorph determined they were
Processing time is_isomorph(G, H): 0.002 s
Processing time amount_of_isomorphisms(G, H): 0.01 s
```
|
1.0
|
Integration test gives wrong answer for cographs1 - ```
---------------------------
Statistics of cographs1-0_1:
---------------------------
[FAIL] Graphs are not isomorph, is_isomorph determined they were
Processing time is_isomorph(G, H): 0.002 s
Processing time amount_of_isomorphisms(G, H): 0.003 s
---------------------------
Statistics of cographs1-0_2:
---------------------------
[FAIL] Graphs are not isomorph, is_isomorph determined they were
Processing time is_isomorph(G, H): 0.002 s
Processing time amount_of_isomorphisms(G, H): 0.01 s
```
|
priority
|
integration test gives wrong answer for statistics of graphs are not isomorph is isomorph determined they were processing time is isomorph g h s processing time amount of isomorphisms g h s statistics of graphs are not isomorph is isomorph determined they were processing time is isomorph g h s processing time amount of isomorphisms g h s
| 1
|
415,979
| 12,137,922,987
|
IssuesEvent
|
2020-04-23 16:25:42
|
OpenSRP/opensrp-client-chw-hf
|
https://api.github.com/repos/OpenSRP/opensrp-client-chw-hf
|
opened
|
Cannot register a family on the HF app from the All Families Register
|
bug high priority
|
- [ ] You cannot register a family on HF app without it saving for a long time without creating the family (shown in screenshot
Replicate:
1. Navigate to All Families Register
2. Create a Family - Fill in Family Details, Family Head
3. Save the Family
4. A Saving window appears but never actually creates the family and it stays like this indefinitely until you close the window
|
1.0
|
Cannot register a family on the HF app from the All Families Register - - [ ] You cannot register a family on HF app without it saving for a long time without creating the family (shown in screenshot
Replicate:
1. Navigate to All Families Register
2. Create a Family - Fill in Family Details, Family Head
3. Save the Family
4. A Saving window appears but never actually creates the family and it stays like this indefinitely until you close the window
|
priority
|
cannot register a family on the hf app from the all families register you cannot register a family on hf app without it saving for a long time without creating the family shown in screenshot replicate navigate to all families register create a family fill in family details family head save the family a saving window appears but never actually creates the family and it stays like this indefinitely until you close the window
| 1
|
492,378
| 14,201,225,660
|
IssuesEvent
|
2020-11-16 07:18:08
|
woocommerce/woocommerce-admin
|
https://api.github.com/repos/woocommerce/woocommerce-admin
|
closed
|
[WC 4.6 RC1] Home Screen: "Continue Store Setup" button shown when the user exits OBW doesn't work
|
[Priority] High [Type] Bug
|
**Describe the bug**
If you exit onboarding without completing it, you are taken to the Home Screen and there is a prompt where you can select to `Continue Store Setup`. My first impression is that if I click on that button indicating that I want to continue Store Setup, I will be taken back to onboarding. But when I click on it, the page reloads and nothing happens. Does this button suppose to take us to Home Screen? If so, it feels a bit redundant that this notice is on the Home Screen:
The URL contains `enable_onboarding=1` which makes me think I should be going back to the Setup Wizard:
**To Reproduce**
Steps to reproduce the behavior:
1. Create a brand new test site and upload WC 4.6 RC1.
2. On the very first screen of onboarding select to `Skip Setup Wizard`.
3. You'd be taken to Home Screen where you'd see the notice in question.
4. Click on `Continue Store Setup` and observe that the page reloads without taking you anywhere.
**Expected behavior**
I expected to be taken back to the Setup Wizard upon clicking on that `Continue Store Setup` button in the notice on the Home Screen if I exited onboarding earlier.
**Screenshots**
See above.
**Desktop (please complete the following information):**
* OS: macOS Catalina 10.15.6
* Browser: Chrome
* Version: Version 85.0.4183.121 (Official Build) (64-bit)
**Additional context**
N/A.
|
1.0
|
[WC 4.6 RC1] Home Screen: "Continue Store Setup" button shown when the user exits OBW doesn't work - **Describe the bug**
If you exit onboarding without completing it, you are taken to the Home Screen and there is a prompt where you can select to `Continue Store Setup`. My first impression is that if I click on that button indicating that I want to continue Store Setup, I will be taken back to onboarding. But when I click on it, the page reloads and nothing happens. Does this button suppose to take us to Home Screen? If so, it feels a bit redundant that this notice is on the Home Screen:
The URL contains `enable_onboarding=1` which makes me think I should be going back to the Setup Wizard:
**To Reproduce**
Steps to reproduce the behavior:
1. Create a brand new test site and upload WC 4.6 RC1.
2. On the very first screen of onboarding select to `Skip Setup Wizard`.
3. You'd be taken to Home Screen where you'd see the notice in question.
4. Click on `Continue Store Setup` and observe that the page reloads without taking you anywhere.
**Expected behavior**
I expected to be taken back to the Setup Wizard upon clicking on that `Continue Store Setup` button in the notice on the Home Screen if I exited onboarding earlier.
**Screenshots**
See above.
**Desktop (please complete the following information):**
* OS: macOS Catalina 10.15.6
* Browser: Chrome
* Version: Version 85.0.4183.121 (Official Build) (64-bit)
**Additional context**
N/A.
|
priority
|
home screen continue store setup button shown when the user exits obw doesn t work describe the bug if you exit onboarding without completing it you are taken to the home screen and there is a prompt where you can select to continue store setup my first impression is that if i click on that button indicating that i want to continue store setup i will be taken back to onboarding but when i click on it the page reloads and nothing happens does this button suppose to take us to home screen if so it feels a bit redundant that this notice is on the home screen the url contains enable onboarding which makes me think i should be going back to the setup wizard to reproduce steps to reproduce the behavior create a brand new test site and upload wc on the very first screen of onboarding select to skip setup wizard you d be taken to home screen where you d see the notice in question click on continue store setup and observe that the page reloads without taking you anywhere expected behavior i expected to be taken back to the setup wizard upon clicking on that continue store setup button in the notice on the home screen if i exited onboarding earlier screenshots see above desktop please complete the following information os macos catalina browser chrome version version official build bit additional context n a
| 1
|
194,827
| 6,899,583,892
|
IssuesEvent
|
2017-11-24 14:24:49
|
metasfresh/metasfresh-webui-frontend
|
https://api.github.com/repos/metasfresh/metasfresh-webui-frontend
|
closed
|
Error with alt+space for expand
|
branch:master priority:high type:bug
|
### Is this a bug or feature request?
Bug
### What is the current behavior?
Currently, alt+space menu open collides with expand functionality. The Browser Menu opens.
#### Which are the steps to reproduce?
Open Sales Order Window. Add Businesspartner and mandatory fields. Press alt+space for expand.
### What is the expected or desired behavior?
Alt+space shall not open the browser menu. Shall expand/ compress (toggle) the lines View.
|
1.0
|
Error with alt+space for expand - ### Is this a bug or feature request?
Bug
### What is the current behavior?
Currently, alt+space menu open collides with expand functionality. The Browser Menu opens.
#### Which are the steps to reproduce?
Open Sales Order Window. Add Businesspartner and mandatory fields. Press alt+space for expand.
### What is the expected or desired behavior?
Alt+space shall not open the browser menu. Shall expand/ compress (toggle) the lines View.
|
priority
|
error with alt space for expand is this a bug or feature request bug what is the current behavior currently alt space menu open collides with expand functionality the browser menu opens which are the steps to reproduce open sales order window add businesspartner and mandatory fields press alt space for expand what is the expected or desired behavior alt space shall not open the browser menu shall expand compress toggle the lines view
| 1
|
166,977
| 6,329,612,922
|
IssuesEvent
|
2017-07-26 03:47:25
|
tunga-io/tunga-web
|
https://api.github.com/repos/tunga-io/tunga-web
|
closed
|
(EUR 50) Update current lander
|
enhancement feature High priority
|
<!--
PLEASE HELP US PROCESS GITHUB ISSUES FASTER BY PROVIDING THE FOLLOWING INFORMATION.
-->
## I'm submitting a ...
<!-- Check one of the following options with "x" and add the appropriate label to the issue as well -->
<pre><code>
[ ] Bug report <!-- Please search this repo for a similar issue or PR before submitting -->
[X] Feature request
[ ] Regression (behavior that used to work and stopped working in a new release)
</code></pre>
## Current behavior
<!-- Describe how the issue manifests. -->
Not applicable
## Expected behavior
<!-- Describe what the desired behavior would be. -->
https://tunga.io/ should display this design:
Details about font size are mention in the PSD file, which will be transferred with Slack
Also, a folder with assets will be provided
## Minimal instructions for reproducing the problem (optional for feature requests)
<!--
For bug reports please provide the *STEPS TO REPRODUCE* and if possible a *MINIMAL DEMO* of the problem via
https://plnkr.co or similar.
-->
## What is the motivation / use case for changing the behavior?
<!-- Describe the motivation or the concrete use case. -->
## Requested Delivery Date (feature requests only):
dd/MMM/YYYY
<!--
This gives us a better sense of the urgency of the issue compared to labels
If possible, We'll respond with the actual delivery date
-->
## Please tell us about your environment (optional for feature requests)
<pre><code>
Browser:
- [ ] Chrome (desktop) version XX
- [ ] Chrome (Android) version XX
- [ ] Chrome (iOS) version XX
- [ ] Firefox version XX
- [ ] Safari (desktop) version XX
- [ ] Safari (iOS) version XX
- [ ] IE version XX
- [ ] Edge version XX
- [ ] Other version XX <!-- Replace Other with name of browser -->
Operating System:
- [ ] macOS version XX
- [ ] Windows version XX
- [ ] Linux <!-- Add flavor name here --> XX
- [ ] Android version XX
- [ ] iOS version XX
- [ ] Windows Phone version XX
- [ ] Other version XX <!-- Replace Other with name of OS -->
Environment/ Server:
- [ ] Production
- [ ] Staging
- [ ] Test
- [ ] Development
<!-- If possible, check whether this is still an issue on the test server first -->
For Developer issues:
- Node version: XX <!-- use `node --version` -->
- Platform: <!-- Mac, Linux, Windows -->
Others:
<!-- Anything else relevant? Operating system version, IDE, package manager, HTTP server, ... -->
</code></pre>
|
1.0
|
(EUR 50) Update current lander - <!--
PLEASE HELP US PROCESS GITHUB ISSUES FASTER BY PROVIDING THE FOLLOWING INFORMATION.
-->
## I'm submitting a ...
<!-- Check one of the following options with "x" and add the appropriate label to the issue as well -->
<pre><code>
[ ] Bug report <!-- Please search this repo for a similar issue or PR before submitting -->
[X] Feature request
[ ] Regression (behavior that used to work and stopped working in a new release)
</code></pre>
## Current behavior
<!-- Describe how the issue manifests. -->
Not applicable
## Expected behavior
<!-- Describe what the desired behavior would be. -->
https://tunga.io/ should display this design:
Details about font size are mention in the PSD file, which will be transferred with Slack
Also, a folder with assets will be provided
## Minimal instructions for reproducing the problem (optional for feature requests)
<!--
For bug reports please provide the *STEPS TO REPRODUCE* and if possible a *MINIMAL DEMO* of the problem via
https://plnkr.co or similar.
-->
## What is the motivation / use case for changing the behavior?
<!-- Describe the motivation or the concrete use case. -->
## Requested Delivery Date (feature requests only):
dd/MMM/YYYY
<!--
This gives us a better sense of the urgency of the issue compared to labels
If possible, We'll respond with the actual delivery date
-->
## Please tell us about your environment (optional for feature requests)
<pre><code>
Browser:
- [ ] Chrome (desktop) version XX
- [ ] Chrome (Android) version XX
- [ ] Chrome (iOS) version XX
- [ ] Firefox version XX
- [ ] Safari (desktop) version XX
- [ ] Safari (iOS) version XX
- [ ] IE version XX
- [ ] Edge version XX
- [ ] Other version XX <!-- Replace Other with name of browser -->
Operating System:
- [ ] macOS version XX
- [ ] Windows version XX
- [ ] Linux <!-- Add flavor name here --> XX
- [ ] Android version XX
- [ ] iOS version XX
- [ ] Windows Phone version XX
- [ ] Other version XX <!-- Replace Other with name of OS -->
Environment/ Server:
- [ ] Production
- [ ] Staging
- [ ] Test
- [ ] Development
<!-- If possible, check whether this is still an issue on the test server first -->
For Developer issues:
- Node version: XX <!-- use `node --version` -->
- Platform: <!-- Mac, Linux, Windows -->
Others:
<!-- Anything else relevant? Operating system version, IDE, package manager, HTTP server, ... -->
</code></pre>
|
priority
|
eur update current lander please help us process github issues faster by providing the following information i m submitting a bug report feature request regression behavior that used to work and stopped working in a new release current behavior not applicable expected behavior should display this design details about font size are mention in the psd file which will be transferred with slack also a folder with assets will be provided minimal instructions for reproducing the problem optional for feature requests for bug reports please provide the steps to reproduce and if possible a minimal demo of the problem via or similar what is the motivation use case for changing the behavior requested delivery date feature requests only dd mmm yyyy this gives us a better sense of the urgency of the issue compared to labels if possible we ll respond with the actual delivery date please tell us about your environment optional for feature requests browser chrome desktop version xx chrome android version xx chrome ios version xx firefox version xx safari desktop version xx safari ios version xx ie version xx edge version xx other version xx operating system macos version xx windows version xx linux xx android version xx ios version xx windows phone version xx other version xx environment server production staging test development for developer issues node version xx platform others
| 1
|
303,285
| 9,304,859,186
|
IssuesEvent
|
2019-03-25 03:26:37
|
RITlug/teleirc
|
https://api.github.com/repos/RITlug/teleirc
|
closed
|
Create doc page on development environment
|
docs improvement priority:high
|
Need better developer docs for new contributors. Working with @icflournoy @zedjones and noticed the docs aren't clear in this way.
|
1.0
|
Create doc page on development environment - Need better developer docs for new contributors. Working with @icflournoy @zedjones and noticed the docs aren't clear in this way.
|
priority
|
create doc page on development environment need better developer docs for new contributors working with icflournoy zedjones and noticed the docs aren t clear in this way
| 1
|
301,762
| 9,223,730,349
|
IssuesEvent
|
2019-03-12 04:59:55
|
SacredDuckwhale/Rarity
|
https://api.github.com/repos/SacredDuckwhale/Rarity
|
closed
|
Add missing collectibles from Island Expeditions
|
complexity: trivial module:core module:database module:localization priority:high status:in-progress type:task
|
Many new items added in Tides of Vengeance are still missing from the addon.
Mounts:
* https://www.wowhead.com/item=166466/risen-mare
* https://www.wowhead.com/item=166467/island-thunderscale
* https://www.wowhead.com/item=166468/bloodgorged-hunter
* https://www.wowhead.com/item=166470/stonehide-elderhorn
Pets:
* https://www.wowhead.com/item=166486/baby-stonehide
* https://www.wowhead.com/item=166487/leatherwing-screecher
* https://www.wowhead.com/item=166488/rotting-ghoul
* https://www.wowhead.com/item=166499/thunderscale-whelpling
* https://www.wowhead.com/item=166498/scritches
* https://www.wowhead.com/item=166495/tonguelasher
* https://www.wowhead.com/item=166494/lord-woofington
* https://www.wowhead.com/item=166493/firesting-buzzer
* https://www.wowhead.com/item=166489/needleback-pup
* https://www.wowhead.com/item=166492/shadefeather-hatchling
---
Roadmap:
- [x] Research: Check the Dubloon Vendor to see what pets are purchased, not randomly dropped
- [x] Task: Add the new islands (maps) to the detection routine
- [x] Task: Add remaining collectibles to the DB
- [x] Testing: See if the new collectibles are being tracked
- [x] Testing: See if the OLD collectibles are being tracked on the NEW islands also (not ideal, but better than not tracking anything?)
- [ ] Wait for #61 to be completed, I guess :( Until then this entire Island Expedition thing will be highly inaccurate...
|
1.0
|
Add missing collectibles from Island Expeditions - Many new items added in Tides of Vengeance are still missing from the addon.
Mounts:
* https://www.wowhead.com/item=166466/risen-mare
* https://www.wowhead.com/item=166467/island-thunderscale
* https://www.wowhead.com/item=166468/bloodgorged-hunter
* https://www.wowhead.com/item=166470/stonehide-elderhorn
Pets:
* https://www.wowhead.com/item=166486/baby-stonehide
* https://www.wowhead.com/item=166487/leatherwing-screecher
* https://www.wowhead.com/item=166488/rotting-ghoul
* https://www.wowhead.com/item=166499/thunderscale-whelpling
* https://www.wowhead.com/item=166498/scritches
* https://www.wowhead.com/item=166495/tonguelasher
* https://www.wowhead.com/item=166494/lord-woofington
* https://www.wowhead.com/item=166493/firesting-buzzer
* https://www.wowhead.com/item=166489/needleback-pup
* https://www.wowhead.com/item=166492/shadefeather-hatchling
---
Roadmap:
- [x] Research: Check the Dubloon Vendor to see what pets are purchased, not randomly dropped
- [x] Task: Add the new islands (maps) to the detection routine
- [x] Task: Add remaining collectibles to the DB
- [x] Testing: See if the new collectibles are being tracked
- [x] Testing: See if the OLD collectibles are being tracked on the NEW islands also (not ideal, but better than not tracking anything?)
- [ ] Wait for #61 to be completed, I guess :( Until then this entire Island Expedition thing will be highly inaccurate...
|
priority
|
add missing collectibles from island expeditions many new items added in tides of vengeance are still missing from the addon mounts pets roadmap research check the dubloon vendor to see what pets are purchased not randomly dropped task add the new islands maps to the detection routine task add remaining collectibles to the db testing see if the new collectibles are being tracked testing see if the old collectibles are being tracked on the new islands also not ideal but better than not tracking anything wait for to be completed i guess until then this entire island expedition thing will be highly inaccurate
| 1
|
139,363
| 5,368,068,587
|
IssuesEvent
|
2017-02-22 07:24:36
|
cdnjs/cdnjs
|
https://api.github.com/repos/cdnjs/cdnjs
|
closed
|
[Request] Add rythm.js
|
High Priority Library - Request to Add/Update
|
**Library name:** rythm.js
**Git repository url:** https://github.com/Okazari/Rythm.js
**npm package url(optional):** https://www.npmjs.com/package/rythm.js
**License(s):** ISC on npm but GPL-3.0, need to be confirmed
**Official homepage:** https://okazari.github.io/Rythm.js/
|
1.0
|
[Request] Add rythm.js - **Library name:** rythm.js
**Git repository url:** https://github.com/Okazari/Rythm.js
**npm package url(optional):** https://www.npmjs.com/package/rythm.js
**License(s):** ISC on npm but GPL-3.0, need to be confirmed
**Official homepage:** https://okazari.github.io/Rythm.js/
|
priority
|
add rythm js library name rythm js git repository url npm package url optional license s isc on npm but gpl need to be confirmed official homepage
| 1
|
575,965
| 17,067,626,399
|
IssuesEvent
|
2021-07-07 09:18:08
|
wso2/integration-studio
|
https://api.github.com/repos/wso2/integration-studio
|
opened
|
Class Mediator does not work out of the box
|
Priority/High
|
**Description:**
Creating a class mediator and referring it in the sequence does not work in the built-in micro integrator
**Steps to reproduce:**
1) Create Hello World service from Help->Getting Started
2) Create a Mediator project inside the hello world project
3) Choose Run on micro integrator option in tooling
**Related Issues:**
<!-- Any related issues such as sub tasks, issues reported in other repositories (e.g component repositories), similar problems, etc. -->
|
1.0
|
Class Mediator does not work out of the box - **Description:**
Creating a class mediator and referring it in the sequence does not work in the built-in micro integrator
**Steps to reproduce:**
1) Create Hello World service from Help->Getting Started
2) Create a Mediator project inside the hello world project
3) Choose Run on micro integrator option in tooling
**Related Issues:**
<!-- Any related issues such as sub tasks, issues reported in other repositories (e.g component repositories), similar problems, etc. -->
|
priority
|
class mediator does not work out of the box description creating a class mediator and referring it in the sequence does not work in the built in micro integrator steps to reproduce create hello world service from help getting started create a mediator project inside the hello world project choose run on micro integrator option in tooling related issues
| 1
|
189,714
| 6,801,106,342
|
IssuesEvent
|
2017-11-02 15:51:38
|
ucdavis/ipa-client-angular
|
https://api.github.com/repos/ucdavis/ipa-client-angular
|
reopened
|
Teaching Call Form: Typeahead text searching needs improvement
|
bug high priority
|
Fixed on 'typeahead-improvement'
---------
For example, if the typeahead has EDU 101, EDU 102, EDU 103, etc., typing simply 'edu' results in no results filtered, but they re-appear when you finish typing 'edu 101'. This should really work how one expects dropdown typeaheads to work.
|
1.0
|
Teaching Call Form: Typeahead text searching needs improvement - Fixed on 'typeahead-improvement'
---------
For example, if the typeahead has EDU 101, EDU 102, EDU 103, etc., typing simply 'edu' results in no results filtered, but they re-appear when you finish typing 'edu 101'. This should really work how one expects dropdown typeaheads to work.
|
priority
|
teaching call form typeahead text searching needs improvement fixed on typeahead improvement for example if the typeahead has edu edu edu etc typing simply edu results in no results filtered but they re appear when you finish typing edu this should really work how one expects dropdown typeaheads to work
| 1
|
596,341
| 18,103,602,617
|
IssuesEvent
|
2021-09-22 16:37:47
|
MatthewHeun/MCBook2021
|
https://api.github.com/repos/MatthewHeun/MCBook2021
|
opened
|
Strong sustainability definition and consistent use
|
Ch5 (Energy intensity) high priority
|
In section 5.1.1, Daly's second law is that "Nonrenewable resources, such as minerals and fossil fuels, must be used no
faster than renewable substitutes for them can be put into place."
However, later in the section, it says "By the “strong sustainability” criterion, any extraction of construction minerals, ores and industrial minerals, and fossil energy carriers is unsustainable, because these materials do not regenerate on human timescales."
Still later, in Section 5.3 it says "By the strong sustainability criterion of consuming resources at a rate beneath their regeneration rate, none of the fossil fuels shown in Figure 5.5 are being consumed at a sustainable rate."
So, two questions:
1. What does "no faster than renewable substitutes can be put into place mean?"
2. Can some use of fossil fuels be sustainable if we are replacing them with (sustainable) biofuels?
In particular, let's consider an example with Daly's rule #2. Suppose we're using petroleum at a rate of 50k bbl/day. What would it mean for the rate at which a renewable substitute to be "put into place?" It seems to me that Daly means something like we have a weak-sustainability-timeframe to get to the point of having 50k bbl/day of biofuels.
|
1.0
|
Strong sustainability definition and consistent use - In section 5.1.1, Daly's second law is that "Nonrenewable resources, such as minerals and fossil fuels, must be used no
faster than renewable substitutes for them can be put into place."
However, later in the section, it says "By the “strong sustainability” criterion, any extraction of construction minerals, ores and industrial minerals, and fossil energy carriers is unsustainable, because these materials do not regenerate on human timescales."
Still later, in Section 5.3 it says "By the strong sustainability criterion of consuming resources at a rate beneath their regeneration rate, none of the fossil fuels shown in Figure 5.5 are being consumed at a sustainable rate."
So, two questions:
1. What does "no faster than renewable substitutes can be put into place mean?"
2. Can some use of fossil fuels be sustainable if we are replacing them with (sustainable) biofuels?
In particular, let's consider an example with Daly's rule #2. Suppose we're using petroleum at a rate of 50k bbl/day. What would it mean for the rate at which a renewable substitute to be "put into place?" It seems to me that Daly means something like we have a weak-sustainability-timeframe to get to the point of having 50k bbl/day of biofuels.
|
priority
|
strong sustainability definition and consistent use in section daly s second law is that nonrenewable resources such as minerals and fossil fuels must be used no faster than renewable substitutes for them can be put into place however later in the section it says by the “strong sustainability” criterion any extraction of construction minerals ores and industrial minerals and fossil energy carriers is unsustainable because these materials do not regenerate on human timescales still later in section it says by the strong sustainability criterion of consuming resources at a rate beneath their regeneration rate none of the fossil fuels shown in figure are being consumed at a sustainable rate so two questions what does no faster than renewable substitutes can be put into place mean can some use of fossil fuels be sustainable if we are replacing them with sustainable biofuels in particular let s consider an example with daly s rule suppose we re using petroleum at a rate of bbl day what would it mean for the rate at which a renewable substitute to be put into place it seems to me that daly means something like we have a weak sustainability timeframe to get to the point of having bbl day of biofuels
| 1
|
646,343
| 21,045,242,771
|
IssuesEvent
|
2022-03-31 15:28:13
|
Automattic/woocommerce-payments
|
https://api.github.com/repos/Automattic/woocommerce-payments
|
closed
|
[GlobalStep] Logo image fails to display for "UPE Payment Method" on "WooCommerce Payments" page.
|
type: bug priority: high component: settings component: grouped-settings component: upe category: core
|
### Bug Description:
Logo image fails to display for "UPE Payment Method" on "WooCommerce Payments" page..
### Environment:
Woocommerce Version : WooCommerce 6.3.1
WooCommerce Payments 4.0.0-test-1
WordPress version: v5.9.2
PC:
Windows 10
Chrome(Version 99.0.4844.84)
Firefox(Version 98.0.1)
Mac OS:
Safari: v15.4
### Steps To Reproduce:
1. Create any test site using JN site.
1. Install and activate all the required plugins.
1. Upload and activate theWooCommerce Payments - 4.0.0-test-1 plugin.
1. Go to WooCommerce > Settings > Payment page.
1. Observe that all Logo images fail to display for "UPE Payment Method" on "WooCommerce Payments" page.
### Actual Result:
Logo image fails to display for "UPE Payment Method" on "WooCommerce Payments" page.
### Expected Result:
Logo image should be properly diplayed for "UPE Payment Method" on "WooCommerce Payments" page.
### Screenshot:
*Isolating the problem (mark completed items with an [x]):*
- [ ] I have deactivated other plugins and confirmed this bug occurs when only WooCommerce plugin is active.
- [ ] This bug happens with a default WordPress theme active, or [Storefront.
- [x] I can reproduce this bug consistently using the steps above.
<details>
`
### WordPress Environment ###
WC Version: 6.3.1
REST API Version: ✔ 6.3.1
WC Blocks Version: ✔ 6.9.0
Action Scheduler Version: ✔ 3.4.0
WC Admin Version: ✔ 3.2.1
Log Directory Writable: ✔
WP Version: 5.9.2
WP Multisite: –
WP Memory Limit: 256 MB
WP Debug Mode: ✔
WP Cron: ✔
Language: en_US
External object cache: –
### Server Environment ###
Server Info: Apache/2.4.53 (Unix) OpenSSL/1.0.2g
PHP Version: 7.4.28
PHP Post Max Size: 1 GB
PHP Time Limit: 30
PHP Max Input Vars: 5000
cURL Version: 7.47.0
OpenSSL/1.0.2g
SUHOSIN Installed: –
MySQL Version: 5.7.33-0ubuntu0.16.04.1-log
Max Upload Size: 512 MB
Default Timezone is UTC: ✔
fsockopen/cURL: ✔
SoapClient: ✔
DOMDocument: ✔
GZip: ✔
Multibyte String: ✔
Remote Post: ✔
Remote Get: ✔
### Database ###
WC Database Version: 6.3.1
WC Database Prefix: wp_
Total Database Size: 8.23MB
Database Data Size: 6.24MB
Database Index Size: 1.99MB
wp_woocommerce_sessions: Data: 0.03MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_api_keys: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_attribute_taxonomies: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_downloadable_product_permissions: Data: 0.02MB + Index: 0.06MB + Engine InnoDB
wp_woocommerce_order_items: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_order_itemmeta: Data: 0.08MB + Index: 0.09MB + Engine InnoDB
wp_woocommerce_tax_rates: Data: 0.02MB + Index: 0.06MB + Engine InnoDB
wp_woocommerce_tax_rate_locations: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_shipping_zones: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_woocommerce_shipping_zone_locations: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_shipping_zone_methods: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_woocommerce_payment_tokens: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_payment_tokenmeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_log: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_actionscheduler_actions: Data: 0.14MB + Index: 0.14MB + Engine InnoDB
wp_actionscheduler_claims: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_actionscheduler_groups: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_actionscheduler_logs: Data: 0.11MB + Index: 0.09MB + Engine InnoDB
wp_commentmeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_comments: Data: 0.13MB + Index: 0.09MB + Engine InnoDB
wp_links: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_options: Data: 4.45MB + Index: 0.09MB + Engine InnoDB
wp_postmeta: Data: 0.38MB + Index: 0.38MB + Engine InnoDB
wp_posts: Data: 0.13MB + Index: 0.06MB + Engine InnoDB
wp_snippets: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_termmeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_terms: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_term_relationships: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_term_taxonomy: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_usermeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_users: Data: 0.02MB + Index: 0.05MB + Engine InnoDB
wp_wc_admin_notes: Data: 0.05MB + Index: 0.00MB + Engine InnoDB
wp_wc_admin_note_actions: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_wc_category_lookup: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_wc_customer_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_download_log: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_order_coupon_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_order_product_lookup: Data: 0.02MB + Index: 0.06MB + Engine InnoDB
wp_wc_order_stats: Data: 0.02MB + Index: 0.05MB + Engine InnoDB
wp_wc_order_tax_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_product_attributes_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_product_meta_lookup: Data: 0.02MB + Index: 0.09MB + Engine InnoDB
wp_wc_rate_limits: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_wc_reserved_stock: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_wc_tax_rate_classes: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_wc_webhooks: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
### Post Type Counts ###
attachment: 24
page: 10
post: 2
product: 24
product_variation: 7
revision: 3
shop_coupon: 1
shop_order: 52
shop_order_refund: 6
shop_subscription: 20
wp_global_styles: 1
### Security ###
Secure connection (HTTPS): ✔
Hide errors from visitors: ✔
### Active Plugins (5) ###
Query Monitor: by John Blackbourn – 3.8.2
Code Snippets: by Code Snippets Pro – 2.14.3
Companion Plugin: by Osk – 1.24
WooCommerce Payments: by Automattic – 4.0.0-test-1
WooCommerce: by Automattic – 6.3.1
### Inactive Plugins (6) ###
Akismet Anti-Spam: by Automattic – 4.2.2
Hello Dolly: by Matt Mullenweg – 1.7.2
Jetpack: by Automattic – 10.7
WooCommerce Blocks: by Automattic – 7.3.0
WooCommerce Payments Dev Tools: by Automattic –
WooCommerce Subscriptions: by WooCommerce – 4.1.0
### Dropin Plugins (1) ###
db.php: Query Monitor Database Class
### Settings ###
API Enabled: –
Force SSL: –
Currency: USD ($)
Currency Position: left
Thousand Separator: ,
Decimal Separator: .
Number of Decimals: 2
Taxonomies: Product Types: external (external)
grouped (grouped)
simple (simple)
subscription (subscription)
variable (variable)
variable subscription (variable-subscription)
Taxonomies: Product Visibility: exclude-from-catalog (exclude-from-catalog)
exclude-from-search (exclude-from-search)
featured (featured)
outofstock (outofstock)
rated-1 (rated-1)
rated-2 (rated-2)
rated-3 (rated-3)
rated-4 (rated-4)
rated-5 (rated-5)
Connected to WooCommerce.com: –
### WC Pages ###
Shop base: #6 - /shop/
Cart: #7 - /cart/
Checkout: #8 - /checkout/
My account: #9 - /my-account/
Terms and conditions: ❌ Page not set
### Theme ###
Name: Storefront
Version: 4.0.0
Author URL: https://woocommerce.com/
Child Theme: ❌ – If you are modifying WooCommerce on a parent theme that you did not build personally we recommend using a child theme. See: How to create a child theme
WooCommerce Support: ✔
### Templates ###
Overrides: –
### Subscriptions ###
WCS_DEBUG: ✔ No
Subscriptions Mode: ✔ Live
Subscriptions Live URL: https://energetic-shrimp.jurassic.ninja
Subscription Statuses: wc-cancelled: 1
wc-active: 19
WooCommerce Account Connected: ❌ No
### Store Setup ###
Country / State: United States (US) — California
### Subscriptions by Payment Gateway ###
WooCommerce Payments: wc-active: 19
wc-cancelled: 1
### Payment Gateway Support ###
WooCommerce Payments: products
refunds
multiple_subscriptions
subscription_cancellation
subscription_payment_method_change_admin
subscription_payment_method_change_customer
subscription_payment_method_change
subscription_reactivation
subscription_suspension
subscriptions
gateway_scheduled_payments
tokenization
add_payment_method
### WooCommerce Payments ###
Version: 4.0.0-test-1
Connected to WPCOM: Yes
Blog ID: 204620016
Account ID: acct_1KiZPn2HuOXtymeZ
### Action Scheduler ###
Canceled: 1
Oldest: 2022-03-29 12:02:30 +0000
Newest: 2022-03-29 12:02:30 +0000
Complete: 370
Oldest: 2022-03-29 07:28:49 +0000
Newest: 2022-03-29 11:52:11 +0000
Pending: 22
Oldest: 2022-03-29 15:02:41 +0000
Newest: 2022-05-29 11:47:02 +0000
### Status report information ###
Generated at: 2022-03-29 13:51:16 +00:00
`
</details>
|
1.0
|
[GlobalStep] Logo image fails to display for "UPE Payment Method" on "WooCommerce Payments" page. - ### Bug Description:
Logo image fails to display for "UPE Payment Method" on "WooCommerce Payments" page..
### Environment:
Woocommerce Version : WooCommerce 6.3.1
WooCommerce Payments 4.0.0-test-1
WordPress version: v5.9.2
PC:
Windows 10
Chrome(Version 99.0.4844.84)
Firefox(Version 98.0.1)
Mac OS:
Safari: v15.4
### Steps To Reproduce:
1. Create any test site using JN site.
1. Install and activate all the required plugins.
1. Upload and activate theWooCommerce Payments - 4.0.0-test-1 plugin.
1. Go to WooCommerce > Settings > Payment page.
1. Observe that all Logo images fail to display for "UPE Payment Method" on "WooCommerce Payments" page.
### Actual Result:
Logo image fails to display for "UPE Payment Method" on "WooCommerce Payments" page.
### Expected Result:
Logo image should be properly diplayed for "UPE Payment Method" on "WooCommerce Payments" page.
### Screenshot:
*Isolating the problem (mark completed items with an [x]):*
- [ ] I have deactivated other plugins and confirmed this bug occurs when only WooCommerce plugin is active.
- [ ] This bug happens with a default WordPress theme active, or [Storefront.
- [x] I can reproduce this bug consistently using the steps above.
<details>
`
### WordPress Environment ###
WC Version: 6.3.1
REST API Version: ✔ 6.3.1
WC Blocks Version: ✔ 6.9.0
Action Scheduler Version: ✔ 3.4.0
WC Admin Version: ✔ 3.2.1
Log Directory Writable: ✔
WP Version: 5.9.2
WP Multisite: –
WP Memory Limit: 256 MB
WP Debug Mode: ✔
WP Cron: ✔
Language: en_US
External object cache: –
### Server Environment ###
Server Info: Apache/2.4.53 (Unix) OpenSSL/1.0.2g
PHP Version: 7.4.28
PHP Post Max Size: 1 GB
PHP Time Limit: 30
PHP Max Input Vars: 5000
cURL Version: 7.47.0
OpenSSL/1.0.2g
SUHOSIN Installed: –
MySQL Version: 5.7.33-0ubuntu0.16.04.1-log
Max Upload Size: 512 MB
Default Timezone is UTC: ✔
fsockopen/cURL: ✔
SoapClient: ✔
DOMDocument: ✔
GZip: ✔
Multibyte String: ✔
Remote Post: ✔
Remote Get: ✔
### Database ###
WC Database Version: 6.3.1
WC Database Prefix: wp_
Total Database Size: 8.23MB
Database Data Size: 6.24MB
Database Index Size: 1.99MB
wp_woocommerce_sessions: Data: 0.03MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_api_keys: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_attribute_taxonomies: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_downloadable_product_permissions: Data: 0.02MB + Index: 0.06MB + Engine InnoDB
wp_woocommerce_order_items: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_order_itemmeta: Data: 0.08MB + Index: 0.09MB + Engine InnoDB
wp_woocommerce_tax_rates: Data: 0.02MB + Index: 0.06MB + Engine InnoDB
wp_woocommerce_tax_rate_locations: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_shipping_zones: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_woocommerce_shipping_zone_locations: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_shipping_zone_methods: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_woocommerce_payment_tokens: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_woocommerce_payment_tokenmeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_woocommerce_log: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_actionscheduler_actions: Data: 0.14MB + Index: 0.14MB + Engine InnoDB
wp_actionscheduler_claims: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_actionscheduler_groups: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_actionscheduler_logs: Data: 0.11MB + Index: 0.09MB + Engine InnoDB
wp_commentmeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_comments: Data: 0.13MB + Index: 0.09MB + Engine InnoDB
wp_links: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_options: Data: 4.45MB + Index: 0.09MB + Engine InnoDB
wp_postmeta: Data: 0.38MB + Index: 0.38MB + Engine InnoDB
wp_posts: Data: 0.13MB + Index: 0.06MB + Engine InnoDB
wp_snippets: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_termmeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_terms: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_term_relationships: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_term_taxonomy: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_usermeta: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_users: Data: 0.02MB + Index: 0.05MB + Engine InnoDB
wp_wc_admin_notes: Data: 0.05MB + Index: 0.00MB + Engine InnoDB
wp_wc_admin_note_actions: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_wc_category_lookup: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_wc_customer_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_download_log: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_order_coupon_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_order_product_lookup: Data: 0.02MB + Index: 0.06MB + Engine InnoDB
wp_wc_order_stats: Data: 0.02MB + Index: 0.05MB + Engine InnoDB
wp_wc_order_tax_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_product_attributes_lookup: Data: 0.02MB + Index: 0.03MB + Engine InnoDB
wp_wc_product_meta_lookup: Data: 0.02MB + Index: 0.09MB + Engine InnoDB
wp_wc_rate_limits: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_wc_reserved_stock: Data: 0.02MB + Index: 0.00MB + Engine InnoDB
wp_wc_tax_rate_classes: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
wp_wc_webhooks: Data: 0.02MB + Index: 0.02MB + Engine InnoDB
### Post Type Counts ###
attachment: 24
page: 10
post: 2
product: 24
product_variation: 7
revision: 3
shop_coupon: 1
shop_order: 52
shop_order_refund: 6
shop_subscription: 20
wp_global_styles: 1
### Security ###
Secure connection (HTTPS): ✔
Hide errors from visitors: ✔
### Active Plugins (5) ###
Query Monitor: by John Blackbourn – 3.8.2
Code Snippets: by Code Snippets Pro – 2.14.3
Companion Plugin: by Osk – 1.24
WooCommerce Payments: by Automattic – 4.0.0-test-1
WooCommerce: by Automattic – 6.3.1
### Inactive Plugins (6) ###
Akismet Anti-Spam: by Automattic – 4.2.2
Hello Dolly: by Matt Mullenweg – 1.7.2
Jetpack: by Automattic – 10.7
WooCommerce Blocks: by Automattic – 7.3.0
WooCommerce Payments Dev Tools: by Automattic –
WooCommerce Subscriptions: by WooCommerce – 4.1.0
### Dropin Plugins (1) ###
db.php: Query Monitor Database Class
### Settings ###
API Enabled: –
Force SSL: –
Currency: USD ($)
Currency Position: left
Thousand Separator: ,
Decimal Separator: .
Number of Decimals: 2
Taxonomies: Product Types: external (external)
grouped (grouped)
simple (simple)
subscription (subscription)
variable (variable)
variable subscription (variable-subscription)
Taxonomies: Product Visibility: exclude-from-catalog (exclude-from-catalog)
exclude-from-search (exclude-from-search)
featured (featured)
outofstock (outofstock)
rated-1 (rated-1)
rated-2 (rated-2)
rated-3 (rated-3)
rated-4 (rated-4)
rated-5 (rated-5)
Connected to WooCommerce.com: –
### WC Pages ###
Shop base: #6 - /shop/
Cart: #7 - /cart/
Checkout: #8 - /checkout/
My account: #9 - /my-account/
Terms and conditions: ❌ Page not set
### Theme ###
Name: Storefront
Version: 4.0.0
Author URL: https://woocommerce.com/
Child Theme: ❌ – If you are modifying WooCommerce on a parent theme that you did not build personally we recommend using a child theme. See: How to create a child theme
WooCommerce Support: ✔
### Templates ###
Overrides: –
### Subscriptions ###
WCS_DEBUG: ✔ No
Subscriptions Mode: ✔ Live
Subscriptions Live URL: https://energetic-shrimp.jurassic.ninja
Subscription Statuses: wc-cancelled: 1
wc-active: 19
WooCommerce Account Connected: ❌ No
### Store Setup ###
Country / State: United States (US) — California
### Subscriptions by Payment Gateway ###
WooCommerce Payments: wc-active: 19
wc-cancelled: 1
### Payment Gateway Support ###
WooCommerce Payments: products
refunds
multiple_subscriptions
subscription_cancellation
subscription_payment_method_change_admin
subscription_payment_method_change_customer
subscription_payment_method_change
subscription_reactivation
subscription_suspension
subscriptions
gateway_scheduled_payments
tokenization
add_payment_method
### WooCommerce Payments ###
Version: 4.0.0-test-1
Connected to WPCOM: Yes
Blog ID: 204620016
Account ID: acct_1KiZPn2HuOXtymeZ
### Action Scheduler ###
Canceled: 1
Oldest: 2022-03-29 12:02:30 +0000
Newest: 2022-03-29 12:02:30 +0000
Complete: 370
Oldest: 2022-03-29 07:28:49 +0000
Newest: 2022-03-29 11:52:11 +0000
Pending: 22
Oldest: 2022-03-29 15:02:41 +0000
Newest: 2022-05-29 11:47:02 +0000
### Status report information ###
Generated at: 2022-03-29 13:51:16 +00:00
`
</details>
|
priority
|
logo image fails to display for upe payment method on woocommerce payments page bug description logo image fails to display for upe payment method on woocommerce payments page environment woocommerce version woocommerce woocommerce payments test wordpress version pc windows chrome version firefox version mac os safari steps to reproduce create any test site using jn site install and activate all the required plugins upload and activate thewoocommerce payments test plugin go to woocommerce settings payment page observe that all logo images fail to display for upe payment method on woocommerce payments page actual result logo image fails to display for upe payment method on woocommerce payments page expected result logo image should be properly diplayed for upe payment method on woocommerce payments page screenshot isolating the problem mark completed items with an i have deactivated other plugins and confirmed this bug occurs when only woocommerce plugin is active this bug happens with a default wordpress theme active or storefront i can reproduce this bug consistently using the steps above wordpress environment wc version rest api version ✔ wc blocks version ✔ action scheduler version ✔ wc admin version ✔ log directory writable ✔ wp version wp multisite – wp memory limit mb wp debug mode ✔ wp cron ✔ language en us external object cache – server environment server info apache unix openssl php version php post max size gb php time limit php max input vars curl version openssl suhosin installed – mysql version log max upload size mb default timezone is utc ✔ fsockopen curl ✔ soapclient ✔ domdocument ✔ gzip ✔ multibyte string ✔ remote post ✔ remote get ✔ database wc database version wc database prefix wp total database size database data size database index size wp woocommerce sessions data index engine innodb wp woocommerce api keys data index engine innodb wp woocommerce attribute taxonomies data index engine innodb wp woocommerce downloadable product permissions data index engine innodb wp woocommerce order items data index engine innodb wp woocommerce order itemmeta data index engine innodb wp woocommerce tax rates data index engine innodb wp woocommerce tax rate locations data index engine innodb wp woocommerce shipping zones data index engine innodb wp woocommerce shipping zone locations data index engine innodb wp woocommerce shipping zone methods data index engine innodb wp woocommerce payment tokens data index engine innodb wp woocommerce payment tokenmeta data index engine innodb wp woocommerce log data index engine innodb wp actionscheduler actions data index engine innodb wp actionscheduler claims data index engine innodb wp actionscheduler groups data index engine innodb wp actionscheduler logs data index engine innodb wp commentmeta data index engine innodb wp comments data index engine innodb wp links data index engine innodb wp options data index engine innodb wp postmeta data index engine innodb wp posts data index engine innodb wp snippets data index engine innodb wp termmeta data index engine innodb wp terms data index engine innodb wp term relationships data index engine innodb wp term taxonomy data index engine innodb wp usermeta data index engine innodb wp users data index engine innodb wp wc admin notes data index engine innodb wp wc admin note actions data index engine innodb wp wc category lookup data index engine innodb wp wc customer lookup data index engine innodb wp wc download log data index engine innodb wp wc order coupon lookup data index engine innodb wp wc order product lookup data index engine innodb wp wc order stats data index engine innodb wp wc order tax lookup data index engine innodb wp wc product attributes lookup data index engine innodb wp wc product meta lookup data index engine innodb wp wc rate limits data index engine innodb wp wc reserved stock data index engine innodb wp wc tax rate classes data index engine innodb wp wc webhooks data index engine innodb post type counts attachment page post product product variation revision shop coupon shop order shop order refund shop subscription wp global styles security secure connection https ✔ hide errors from visitors ✔ active plugins query monitor by john blackbourn – code snippets by code snippets pro – companion plugin by osk – woocommerce payments by automattic – test woocommerce by automattic – inactive plugins akismet anti spam by automattic – hello dolly by matt mullenweg – jetpack by automattic – woocommerce blocks by automattic – woocommerce payments dev tools by automattic – woocommerce subscriptions by woocommerce – dropin plugins db php query monitor database class settings api enabled – force ssl – currency usd currency position left thousand separator decimal separator number of decimals taxonomies product types external external grouped grouped simple simple subscription subscription variable variable variable subscription variable subscription taxonomies product visibility exclude from catalog exclude from catalog exclude from search exclude from search featured featured outofstock outofstock rated rated rated rated rated rated rated rated rated rated connected to woocommerce com – wc pages shop base shop cart cart checkout checkout my account my account terms and conditions ❌ page not set theme name storefront version author url child theme ❌ – if you are modifying woocommerce on a parent theme that you did not build personally we recommend using a child theme see how to create a child theme woocommerce support ✔ templates overrides – subscriptions wcs debug ✔ no subscriptions mode ✔ live subscriptions live url subscription statuses wc cancelled wc active woocommerce account connected ❌ no store setup country state united states us — california subscriptions by payment gateway woocommerce payments wc active wc cancelled payment gateway support woocommerce payments products refunds multiple subscriptions subscription cancellation subscription payment method change admin subscription payment method change customer subscription payment method change subscription reactivation subscription suspension subscriptions gateway scheduled payments tokenization add payment method woocommerce payments version test connected to wpcom yes blog id account id acct action scheduler canceled oldest newest complete oldest newest pending oldest newest status report information generated at
| 1
|
392,250
| 11,585,632,431
|
IssuesEvent
|
2020-02-23 01:26:41
|
OceanDataTools/openrvdas
|
https://api.github.com/repos/OceanDataTools/openrvdas
|
closed
|
Properly compute network mask/broadcast address for UDPWriter
|
bug high priority
|
Right now, if an interface is specified for UDPWriter, e.g.
```
UDPWriter(interface='10.1.1.15', port=6224)
```
it will assume the broadcast address is 10.1.1.15 by simply replacing the last tuple with 255. This will fail if the network mask is anything except /24.
|
1.0
|
Properly compute network mask/broadcast address for UDPWriter - Right now, if an interface is specified for UDPWriter, e.g.
```
UDPWriter(interface='10.1.1.15', port=6224)
```
it will assume the broadcast address is 10.1.1.15 by simply replacing the last tuple with 255. This will fail if the network mask is anything except /24.
|
priority
|
properly compute network mask broadcast address for udpwriter right now if an interface is specified for udpwriter e g udpwriter interface port it will assume the broadcast address is by simply replacing the last tuple with this will fail if the network mask is anything except
| 1
|
237,077
| 7,755,543,701
|
IssuesEvent
|
2018-05-31 10:31:21
|
nlbdev/pipeline
|
https://api.github.com/repos/nlbdev/pipeline
|
closed
|
EPUB/HTML as input - TOC missing
|
Priority:3 - High enhancement
|
For 562416 TOC is present with DTBook input but absent with NLBPUB as input. I can't figure why.
Job 2253
|
1.0
|
EPUB/HTML as input - TOC missing - For 562416 TOC is present with DTBook input but absent with NLBPUB as input. I can't figure why.
Job 2253
|
priority
|
epub html as input toc missing for toc is present with dtbook input but absent with nlbpub as input i can t figure why job
| 1
|
416,320
| 12,142,581,929
|
IssuesEvent
|
2020-04-24 02:08:39
|
incognitochain/incognito-chain
|
https://api.github.com/repos/incognitochain/incognito-chain
|
closed
|
[testnet] Unable to mint pToken when call createandsendtxwithissuingethreq
|
Priority: High Type: Bug
|
1. create proof success -> call createandsendtxwithissuingethreq -> response success (block)
-> can't mint pToken
2. Get getbridgereqwithstatus with this txhash -> status =3 (reject)
{
"id": 1,
"jsonrpc": "1.0",
"method": "getbridgereqwithstatus",
"params": [
{
"TxReqID": "873639d7374d116b3cdb58ae80df1766ea1fcaf560f6792aab9cd8fc7c5dd712"
}
]
}
|
1.0
|
[testnet] Unable to mint pToken when call createandsendtxwithissuingethreq - 1. create proof success -> call createandsendtxwithissuingethreq -> response success (block)
-> can't mint pToken
2. Get getbridgereqwithstatus with this txhash -> status =3 (reject)
{
"id": 1,
"jsonrpc": "1.0",
"method": "getbridgereqwithstatus",
"params": [
{
"TxReqID": "873639d7374d116b3cdb58ae80df1766ea1fcaf560f6792aab9cd8fc7c5dd712"
}
]
}
|
priority
|
unable to mint ptoken when call createandsendtxwithissuingethreq create proof success call createandsendtxwithissuingethreq response success block can t mint ptoken get getbridgereqwithstatus with this txhash status reject id jsonrpc method getbridgereqwithstatus params txreqid
| 1
|
709,288
| 24,373,072,776
|
IssuesEvent
|
2022-10-03 21:09:49
|
radical-cybertools/radical.pilot
|
https://api.github.com/repos/radical-cybertools/radical.pilot
|
closed
|
ddmd.py terminates after sim_md tasks on non-localhost
|
type:question topic:resource topic:execution priority:high
|
[`ddmd.py`](https://github.com/radical-cybertools/radical.pilot/blob/da1d6c46eb3260913771fa71654731016214ffe5/examples/misc/ddmd.py) is expected to execute a number of (as of now, mock) (1) MD simulation, (2) aggregation, (3) ML training and (4) 'agent' tasks such that each successive set of a given type of tasks is triggered by a callback which depends on the number of required tasks of another type.
The script works fine when run on `localhost` but when launching a job on compute nodes, the job terminates after the first set of tasks execute; other tasks are not scheduled.
Sandbox:
[rp.session.login3.pascuzzi.019165.0012.tar.gz](https://github.com/radical-cybertools/radical.pilot/files/8968999/rp.session.login3.pascuzzi.019165.0012.tar.gz)
@mturilli, @andre-merzky
|
1.0
|
ddmd.py terminates after sim_md tasks on non-localhost - [`ddmd.py`](https://github.com/radical-cybertools/radical.pilot/blob/da1d6c46eb3260913771fa71654731016214ffe5/examples/misc/ddmd.py) is expected to execute a number of (as of now, mock) (1) MD simulation, (2) aggregation, (3) ML training and (4) 'agent' tasks such that each successive set of a given type of tasks is triggered by a callback which depends on the number of required tasks of another type.
The script works fine when run on `localhost` but when launching a job on compute nodes, the job terminates after the first set of tasks execute; other tasks are not scheduled.
Sandbox:
[rp.session.login3.pascuzzi.019165.0012.tar.gz](https://github.com/radical-cybertools/radical.pilot/files/8968999/rp.session.login3.pascuzzi.019165.0012.tar.gz)
@mturilli, @andre-merzky
|
priority
|
ddmd py terminates after sim md tasks on non localhost is expected to execute a number of as of now mock md simulation aggregation ml training and agent tasks such that each successive set of a given type of tasks is triggered by a callback which depends on the number of required tasks of another type the script works fine when run on localhost but when launching a job on compute nodes the job terminates after the first set of tasks execute other tasks are not scheduled sandbox mturilli andre merzky
| 1
|
448,899
| 12,960,076,684
|
IssuesEvent
|
2020-07-20 13:53:34
|
inverse-inc/packetfence
|
https://api.github.com/repos/inverse-inc/packetfence
|
closed
|
pf::mini_template ignores some of the template content
|
Priority: High Type: Bug
|
**Describe the bug**
pf::mini_template ignores some of the template content
**To Reproduce**
Steps to reproduce the behavior:
1. Run the following code:
```
print pf::mini_template->new('${uc("hello")} good-bye')->process({});
```
**Expected behavior**
Expected to have `HELLO good-bye`, only got HELLO
|
1.0
|
pf::mini_template ignores some of the template content - **Describe the bug**
pf::mini_template ignores some of the template content
**To Reproduce**
Steps to reproduce the behavior:
1. Run the following code:
```
print pf::mini_template->new('${uc("hello")} good-bye')->process({});
```
**Expected behavior**
Expected to have `HELLO good-bye`, only got HELLO
|
priority
|
pf mini template ignores some of the template content describe the bug pf mini template ignores some of the template content to reproduce steps to reproduce the behavior run the following code print pf mini template new uc hello good bye process expected behavior expected to have hello good bye only got hello
| 1
|
339,201
| 10,244,198,625
|
IssuesEvent
|
2019-08-20 09:51:30
|
wso2/product-is
|
https://api.github.com/repos/wso2/product-is
|
closed
|
MSSQL IDN_ARTIFACT_STORE table does not get created
|
Priority/High Severity/Critical Type/Bug
|
**Environment**
Windows 2016 server
MSSQL
IS 5.9.0-m8- snapshot
**Suggested Lables**
Type/Bug
Priority/High
**Steps to Reproduce**
Execute the script in below location against MSSQL
wso2is-5.9.0-m8-SNAPSHOT/dbscripts/identity/mssql.sql
The table with the name IDN_ARTIFACT_STORE is not getting created.
|
1.0
|
MSSQL IDN_ARTIFACT_STORE table does not get created - **Environment**
Windows 2016 server
MSSQL
IS 5.9.0-m8- snapshot
**Suggested Lables**
Type/Bug
Priority/High
**Steps to Reproduce**
Execute the script in below location against MSSQL
wso2is-5.9.0-m8-SNAPSHOT/dbscripts/identity/mssql.sql
The table with the name IDN_ARTIFACT_STORE is not getting created.
|
priority
|
mssql idn artifact store table does not get created environment windows server mssql is snapshot suggested lables type bug priority high steps to reproduce execute the script in below location against mssql snapshot dbscripts identity mssql sql the table with the name idn artifact store is not getting created
| 1
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.