UniProt ID
stringlengths
6
10
Protein Sequence
stringlengths
2
35.2k
Functional Description
stringlengths
5
30.7k
Q0DTZ4
MASPSSLLSWPHRAISLSFQPKNPSPSPATARVSVQDPPPPPSDANPSPGRSSNTSRYVWVNPNSPRAAGLARARAGSGRRARLAAAAAALAACEAGEAPVAAALEAAFPEPPSEQDAVIVLNTTSARPAAVVLALWWFLRNAEVRKEVILYNVALKALRKRRRWSDAEALWEEMLREGVQPDNATFSTVISCARACGMPGKAVEWFEKMPDFGCSPDMLTYSAVIDAYGRAGDAETALRLYDRARAEKWQLDPVICATVIRVHSSSGNFDGALNVFEEMKAAGVKPNLVVYNTVLDAMGRAMRPWVVKTIHRELVSQEAVPNKATYCCLLHAYTRARYGEDAMAVYRVMKDEVMDIDVVLYNMLLSMCADIGYVEEAEEIFRDMKASMDSRSKPDSWSYSSMVTLYSCTGNVAGAEGILNEMVEAGFKPNIFILTSLIRCYGKAGRTDDVVRSFAMLEDLGITPDDRFCGCLLTVAAGTPADELGKVIGCIDRSSAQLGAVVRLLVDAAAPSEPLREAAGELLGGARGVVRMPYCNCLMDLAVNLSQMEKACALLDVALRLGIYSNVQTRTQTQWSLHLRGLSVGAALTTLHVWMSDLYAALQAGDELPPLLGIHTGQGKNTYSYKGLATVFESHLKELDAPFHEAPDKAGWFLTTSVAARHWLETKKSAELVAV
Involved in translation and accumulation of chloroplast ATP synthase subunits. Belongs to the PPR family. P subfamily.
Q41000
MFRRATSTFLSRASATRRFSTDVATPATNSSFVEAWRKVSPNIDPPKTPLEFLKTRPPVPSTIPTKLTVNFVLPYSSQLAAKEVDSVIIPATTGEMGVLPGHVATIAELKPGVLTVQEGTDTTKYFVSSGFRFIHANSVADIIAVEAVPVNQLDRDLVQKGLQEFTQKLNSATTDLEKREAQIGIDVDSALNSALTG
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase epsilon chain family.
P80085
TSAEVPATAQGVTHALEGTQ
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase epsilon chain family.
Q96253
MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQKPVLRSDTPEV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the eukaryotic ATPase epsilon family.
Q32PE5
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAMKTSGSTIKIVKVKKE
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L). Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ. Belongs to the eukaryotic ATPase epsilon family. Extended N-terminus.
P34539
MVAWRAAGLNYVRYSQIAAQVVRQCTKGGANVKKPQATLKTTAWENGKMVSKSQ
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L) (By similarity). Belongs to the eukaryotic ATPase epsilon family.
Q1ZXK8
MAGQYWRAAGITYLQYANICGTHVRNCLKEPFRAAAKNREGFISNTVMYQNGKESSTIILNSELLQKELLVKKN
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L) (By similarity). Belongs to the eukaryotic ATPase epsilon family.
Q53XU6
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L). Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Ubiquitous. The disease is caused by variants affecting the gene represented in this entry. Belongs to the eukaryotic ATPase epsilon family.
B2G685
MGGDALTFKLFGLTFNTTNIVSGLIIYAIVFFTLYGMSRKIQMKPTGAQNVFEWLVDFTNGIVRSQMPASEQGHYSFFAFVLFVFIFFANQFGLIFQFHWNGAEVLRSPTADPVVTLTLSLMVMVLAFAAGVAHNGLGGYLKGYTKPFTLMLPVNIIEDFANFLTLGLRIFGNIFAGELLMSLIANMAFSHGILTIIPGLFLELAWQGFSVFIGSIQAYVFVTLTTVYISRKISE
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q927V8
MEEEFPTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDWKTGGRFHVLGITLLMFIFVANMLGLPFQIAINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFKHYFVGTYFSPMKFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATQLAHMNIFVGVLAIIPALLWQGFSIFIGAIQAYIFTMLTMVYMSHKVSDEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
C1KYV2
MEEEFPTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDWKTGGRFHVLGITLLMFIFVANMLGLPFQIAINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFKHYFVGTYFSPMKFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATQLAHMNIFVGVLAIIPALLWQGFSIFIGAIQAYIFTMLTMVYMSHKVSDEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q71WP3
MEEEFPTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDWKTGGRFHVLGITLLMFIFVANMLGLPFQIAINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFKHYFVGTYFSPMKFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATQLAHMNIFVGVLAIIPALLWQGFSIFIGAIQAYIFTMLTMVYMSHKVSDEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q8Y4B6
MEEEFPTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDWKTGGRFHVLGITILMFVFVANMLGLPLQIAVNDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFKHYFVGTYLSPMKFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATQLAHINIFVGVLAIIPAIIWQAFSLFIGAIQAYIFTMLTMVYMSHKVSDEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A0ALL9
MGEEFPTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWIMDFVRGIINSNMDWKTGGRFHVLGITLLMFIFVANMLGLPFQIAINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFKHYFVGTYFSPMKFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATQLAHMNIFVGVLAIIPALLWQGFSIFIGAIQAYIFTMLTMVYMSHKVSDEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
P14569
MMTNLFSTFDPSTNLFNLSLNWTSTFLGLLLIPSMFWLMPSRINILWNKMNLNLHNEFKTLLGKNSFQGSTLILISIFIMMLFNNFMGLFPYIFTSTSHMTLTFSIALPMWMSFMLFGWINNTNHMFTHLVPQGTPNALMSFMVLIETISNVIRPGTLAVRLAANMIAGHLLLTLLGNTGPSLTTSIMLFLIIGQMLLLILESAVAMIQAYVFSILSTLYSSEVY
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase A chain family.
Q2I3F6
MNEELSTFFYVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNTKGLSWSLMLITLTLFIGLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVPGFRYKTKISLAHLLPQGTPMFLIPMIIIIETISLLIRPVTLAVRLTANITAGHSLIHLTGTATLTLSSIHSMTITVTFVTVILLTILELAVALIQAYVFALLISLYLHENA
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Interacts with DNAJC30; interaction is direct (By similarity). Belongs to the ATPase A chain family.
Q34946
MMPDIFSSFDPYMFNTLFPLNSLFLVTNTAIILMIQSSFWVLNARTSAFKSPVNDTIFTQLSRTSTTHLKGLSTPLSTIFFMLVMINLMGLIPYMFSTSSHLVFTLSLGFPIWLSLMISTFAHSPKKSTAHFLPDGAPDWLNPFLVLIETTSVFVRPLTLSFRLAANMSAGHIVLSLMGIYCAAAWFSSVSSTALLILTAIGYILFEVAICLIQAYIFCLLLSLYSDDHAH
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase A chain family.
O79551
MTMNMFEQFMSPELLMIPTALLSMLVPVLLIHHNPKLLGNRMTTAIAWLLMTIMSNMTNQLTPSGQKWCQVLTSLLLMILLSNLLGLLPYTFTSTSQLSMNMAMAIPLWMATIITGMTKKPSITLAHMLPEGSPTPLIPFMIIIETISLLMRPLALGVRLTANITAGHLLMTMVSTTTLNFITSHITLSIMTYLLLFLLCILELAVACIQAYVFVLLIILYLQENT
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase A chain family.
B1HM50
MNHEAPLLEVGFLTFNKSTVMMLLVAAIIVFLIAFISTRSLKLKPTGMQNFMEWIMDFVKNIIKSNMDWKTGGRFHILGITLIMFIAVSNLLGLPFSIVYGHELWWKSPTADPTVTMTLATMILVLSHFYGVKMKGTGHYAGTFFKPMSFMFPLKLVEEFANTLTLGLRLYGNIYAGEILLGLLAGLASSGAVGFIGAIVPMMAWQGFSIFIGFIQAFIFTMLTMVYMAHKVSDDH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B9E8F1
MGHESPLYSLDLFGHEMIFDLSSMLMLTVTAAIVFLIAMLFTRNLSVRPHGKQNFIEWIFDFTRGIINSNMAWNKGGRFHFLAVTLLLFIFVANMLGLPFAIINGHTLWWKSPTADPTVTLTLSTLMVLLTHFYGVKMRGTGNYLKSFAQPVWFMVPFKIIEEFSSTLTLGLRLYGNIFAGEVLLGLLATLGTAGAAGMLGAAIPTLIWQGFSIFVGSIQAYIFVMLSMVYMSHKVSDDH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A0LDW6
MSAEAMHAAASAAPKMDPLHHFMVQKVVPIEIAGIDLSITNSTIWMWLAVAVAFLFMKWSFRGRAEDKLIPTKMQSLAEMTFTFVRQIVDQNIGGAEGRKYFPAIFTLFLLVLFCNLLGLIPGSFTPTSQLVVTATLALSVFFFATGLAIVKHGTGFIGFFVPSGVPPMLLILMVPIEIVSYLSRPVSLSVRLFANMTAGHTVLAIMFFFAATLPLGGLLMPAAFATVFTGFELFIGFIQAYIFTILTCVYINDALHLH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q2W028
MANPIEQFKIQPLVPLKVGSVDISFTNSSAMMVLSICLITLFLTLSVRSRALVPGRWQSMAEVFYEFIAGMLRDNVGQEGRKYFPFIFSLFMFVLFGNLLGMMPIPVIGFTYTSHVIVTFAMALVVFVGVTVIGFARHGTHYLRMFFPHGAPIATAVILIPIELISYFSRPFSLAVRLFANMTVGHIILKVMGGFVVSLGAFYLIPGAVPFAFLSAITVLEFGIALLQAYVFTILSCIYLHDAIHMH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
P07925
MERNGEIVNNGSIIIPGGGGPVTESPLDQFGIHPILDLNIGKYYVSFTNLSLSMLLTLGLVLLLVFVVTKKGGGKSVPNAFQSLVELIYDFVPNLVNEQIGGLSGNVKHKFFPCISVTFTFSLFRNPQGMIPFSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISHCFRALSSGIRLFANMMAGHSSVKILSGFAWTMLFLNNIFYFLGDLGPLFIVLALTGLELGVAISQAHVSTISICIYLNDATNLHQNESFHNCIKTRSQS
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase A chain family.
Q38PR7
MNEELSAFFDVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLVKLIMKQLLSIHNTKGLSWSLMLITLTLFIGLTNLLGLLPYSFAPTAQLTVNLSMAIPLWTGTVILGFRYKTKISLAHLLPQGTPTFLIPMIIIIETISLLIRPVTLAVRLTANITAGHLLIHLTGTAALTLLSIHSMTITVTFITVVVLTILELAVALIQAYVFALLISLYLHESA
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Interacts with DNAJC30; interaction is direct (By similarity). Belongs to the ATPase A chain family.
Q65Q01
MSGQTTSEYIGHHLQFLKTGDSFWNVHIDTLFFSVLAAIIFLAVFRSVAKKATSGVPGKLQCMVEILVEWINGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQLAGLFGIHYLRAVPTADISATLGMSLCVFALILFYTVKSKGFGGLVKEYTLHPFNHWSLIPVNFVLESVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFHILIVTLQAFIFMMLTVVYLSIAYNKAEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q0AMJ4
MADTNPIKQFEVHEVFPFEAFGLNLAFTNSSYFMVLTTVLTIVLFMVAMSSRALVPNRAQSVAEIIYGFVADMVRSTAGQEGLRFFPFVFTLFIFILVANMLGMFPYFPAPGAHSFTITSHLIVTVALAMLVWLTVIIYGVFKNGFGFLKLFVPSGVPIFVLPLVVVIEIISFVSRPLSHSVRLFANMLAGHILLKVFAGFVVTLAAAWGGFGYLAGIAPLAMAVSLTALEFLVAFLQAYVFAMLTCIYLNDALHPGH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A6W3T4
MGIESPTASSYIKHHLQNLTYGQHPDGTWGLAHDAKEAADMGFWAIHVDTMAISIALGFLFLWLFRKAAKKISADTPSGLQNFVELMVEFVDGSVKETFHGKSKVIAPLALTIFVWVFLMNFMDLIPVDFLPATAQWIGVTLFGADPHHVYFKFVPTTDINATLGMSLSVFVLIVFYSIKVKGISGFVGELTLQPFGKWMIPFNLLLEGVGLLAKPVSLALRLFGNLYAGELIFILIAILPWGVQWALSVPWAIFHILIIVLQAFIFMMLTIVYLSMAHENH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A1U7I0
MAADTPVEYIKHHLTNLTYGKLPEGYERADGSVVQEATWTFARTGQEATDMGFMAIHVDTLGWSIAMGILFLGLFRFVANRVTEGTPSGLQNLIEMTFEFVQGIVRDVFHGKNPLIAPLALTIFVWILLMNILKLIPIDYIPSIAHALGLEYFKIVPTTDPNATFGMSIGVFLLILFYSFKVKGVSGFSKELAFNPFNHWIMIPFNLLLEILALIIKPISLALRLFGNMYAGEVVFILIALLPLWIQWTLNVPWAIFHILVIPLQAFIFTVLTVVYLSAAHEDH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B0BVU2
MTHSPLAQFDIKKLIDIKMFGFDVSFTNSSIYMLLASILALTYFYLAFYKRKLVPSRLQVSAEIVYNLVADMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLRFLTLFLPHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPIMVILIGFEIFVAILQAYIFTILSCMYLNDAINLH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A8GQF6
MTHSPLAQFDIKKLIDIKMFGFDVSFTNSSIYMLLASILALTYFYLAFYKRKLVPSRLQVSAEIVYNLVADMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLRFLTLFLPHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPIMVILIGFEIFVAILQAYIFTILSCMYLNDAINLH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q68XQ1
MTNSPLIQFNIKKLIDIKMFGLDVSFTNSSIYMLLASTLALTYFYLAFYNRKLIPSRLQVSAEIVYNFVVDMLNQNIGIKGRKFIPLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLALLIFLTVTIVGFIKHGMSFLTLFLPQGTPVWLAPLMIVIELFTYLAKPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPLIVILIGFEIFVAILQAYIFTILSCMYLNDAINLH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q16AM8
MADKAEGGGLVFKPMEQFEITALFGGDVTWYTPTNTALWMGFSIIAVVLLLVVGSSKRAVVPSRAQSVAELAYGFIYKMVEDICGKEGLKFFPYIMTLFMFIVCANFLGLIPSSFTPTSHFAVTVVLALAVFVTVTILGFVKNGTAFLSLFWVSSAPLALRPVLAIIEIISYFVRPVSHSIRLAGNVMAGHAVIKVFAGFAALTLVSPVAILGITAMYGLEVLVSFIQAYVFTILTCVYLKDALHPHH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a, b, b' and c. Belongs to the ATPase A chain family.
Q1AVH3
MEVTQEELRHEILHTWEAAREAWVIHLEIAGINLSINKPVWFLWLGAAITFLFMYVGARTLRDRPGAYQVLVEELFRFGRDMFGGQINEEGRKWFPYSLTLFIFLLVLNIIGLFPNSYPVTSNISFTATLALFTFVLTQYEGVRRNGLVTYLKSWAPADLPAKPLMYPIMWFLHLIQEFTKPLTLALRLYANILAGHLIIFVFLSLILYFGLPTAFVSVPFAVVFYAFEIFVAVIQAYIFAILTQVYIELAMFAEEAH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A1AXU8
MSATNEVITSGSYIKHHLQNLTYGQFPDGHWRFAHTTSEAKEMGFWAFHLDTLSISFILGALFLIFFYKVGKKMTSDTPSGAQNFIESVIDFINDNVRGSFNSQNPMVAPLALTTFIWIVLMNTMDLVPVDWLPYVAQQIGVWLGADPHHVFFKMVPTADPNATLGMSIGIFILIIYYSIKEKGAGGFAAELTFHPFGKMMLPFNLFLEGVNLIAKPVSLALRLFGNMYAGEMIFILIALLPFWVQWSLSLPWAIFHILIVLLQAFIFMTLVIVYMDMAHQKKH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q21DK2
MASSEELTATGYIQHHLQNLTYGKLPAGYVRHNADGTHTELAANTWTFAHTAQEAKDMGFMAVHVDTLGWGIFLALLLGFIFRSAVKKAHTGKPSGLLSFVEFLVEGINSVVKDIFHHKNRLIAPMGLTIFSWVFMMNLMDLIPVDWLPMLAQVVTGDSHTFFKVVPTTDPNATLGMAFTVFALMIMFSIKEKGALGFVKELTCHPFFAPKKLWYLNILLIPVNTILETVALIAKPISLGLRLFGNMYAGEMIFILIALLFSVGLVMGFVGGVLQWAWAVFHILVITLQAFIFMVLTTVYMAMAHDNHDEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B5EZ02
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A9MJR3
MASENMTPQDYIGHHLNNLQMDLRTFSLVDPHNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q57HX3
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B5FN39
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B5QVD8
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B5RFV7
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B4TAX8
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B4SYD7
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q5PKW6
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
A9MXB2
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
C0Q2N8
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
B5BIP2
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase A chain family.
Q35920
MTLSFFDQFMSPTYLGIPLIAVALTLPWILFPTPSTRWLNNRLITLQGWFINRFTQQLLLPLNLGGHKWAVLLTSLMLFLITLNMLGLLPYTFTPTTQLSLNMGLAVPLWLATVIIGMRNQPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFVLMPIMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c (By similarity). Belongs to the ATPase A chain family.
P80088
TKXXEAPAPKGLKGNEMLKGIFLEVKKKFETA
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain.
Q6CFH9
MSVAAARSSAVKVDWGKIVSSLGLTGATVSSLQAFRKRHEEAKKNAYELQNQPTTVDFAHYRKVLKNQKVVDEIEQHFKSFKPVTYDVSKQLKTIDAFEAKAIEDAKATEGKVNQEIGDLQKTLENIESARPFDQLSVDDVFKARPDLEKKIEEMVKKGRWSVPGYNEKFGSVVLM
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed:25759169). F-type ATP synthases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk (PubMed:27373333). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (PubMed:27373333). Part of the complex F(0) domain and the peripheral stalk, which acts as a stator to hold the catalytic alpha/ATP1(3)beta/ATP2(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (PubMed:27373333). F-type ATP synthases have 2 components, the catalytic core F(1) and the membrane-embedded component F(0), linked together by a central stalk and a peripheral stalk (PubMed:27373333). The central stalk, also called rotor shaft, is often seen as part of F(1) (PubMed:27373333). The peripheral stalk is seen as part of F(0) (PubMed:27373333). F(0) contains the membrane channel next to the rotor (PubMed:27373333). F-type ATP synthases form dimers but each monomer functions independently in ATP generation (PubMed:27373333). The dimer consists of 17 different polypeptides: ATP1 (subunit alpha, 3 molecules per monomer, part of F(1)), ATP2 (subunit beta, 3 copies per monomer, part of F(1)), ATP3 (subunit gamma, part of the central stalk), ATP4 (subunit b, part of the peripheral stalk), ATP5/OSCP (subunit 5/OSCP, part of the peripheral stalk), ATP6 (subunit a, part of the peripheral stalk), ATP7 (subunit d, part of the peripheral stalk), ATP8 (subunit 8, part of the peripheral stalk), OLI1 (subunit c, part of the rotor, 10 molecules per monomer), ATP14 (subunit h, part of the peripheral stalk), ATP15 (subunit epsilon, part of the central stalk), ATP16 (subunit delta, part of the central stalk), ATP17 (subunit f, part of the peripheral stalk), ATP18 (subunit i/j, part of the peripheral stalk), ATP19 (subunit k, dimer-specific, at interface between monomers), ATP20 (subunit g, at interface between monomers), TIM11 (subunit e, at interface between monomers) (PubMed:27373333, PubMed:25759169). The F-type ATP synthase complex is anchored in the mitochondrial inner membrane via the F(0) domain with the F(1) domain and the peripheral stalk extending into the mitochondrial matrix. Belongs to the ATPase d subunit family.
D6VXS0
MSLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. In yeast, the dimeric form of ATP synthase consists of 17 polypeptides: alpha, beta, gamma, delta, epsilon, 4 (B), 5 (OSCP), 6 (A), 8, 9 (C), d, E (Tim11), f, g, h, i/j and k. Present with 6820 molecules/cell in log phase SD medium. Belongs to the ATPase d subunit family.
Q47527
MEQNLPSRITKLIKKSESGDFASSYQLYKVFGSKEYGVEPDEKMSDYFKELSAKQLEGGQLRVADIHLENYKGFESLIMDFSMKKNSTILVGNNGCGKSTILDAIQKGLTHLSSRLSTRSHNGDGIEKHELRKGQNYASIAINYDYMGIRFPMIIATTEPGYEDRAKSNYSGINELGSIFKTAHSINPNVSFPLIAMYTVERANDVSTRDIENSEEIKEAQIWDKFKAYNKSLTGKADFKLFFRWFKELIEIENSDNADITALRAEIRAKEKDLDNPLLKALLAENKNSETTKKLLEDHQNSLKVLKEKLNSYYSVNSKTLHTVEDAMYSFLPGFSNLKLQRAPLDLIVDKNNVSLSVLQLSQGEKTILALIADIARRLTLLNPNSVNPLDGTGIVLIDEIDLHLHPSWQQNIIPRLEKTFKNIQFIVTTHSPQVCHTIDSQNIWLLKNGQKFKAPKGVRGAISSWVLENLFEVAQRPPEDKYTKLLQEYKNLVFSEKYASEDARKLGATLSQHFGPDDETLVELKLEIEKRIWEDDFEKDQ
Probable ATPase component of antiviral defense system retron Ec83, composed of a non-coding RNA (ncRNA), a reverse transcriptase (RT), this protein and a putative HNH endonuclease. Expression of retron Ec83 confers protection against bacteriophage T2, T4 and T6. At multiplicity of infection (MOI) of 0.02 cultures slow growth when infected with T4 but do not collapse, at MOI 2 cultures enter growth stasis.
Q751Q6
MTPQIIPFFFMHQFTYGFLVILLTLLLLSYAFLSMILRLYLSRIYLSK
Belongs to the ATPase protein 8 family.
B0FWC9
MPQMAPISWLTLFFVFSITLVIFNIKNYFCFSYNSTETSQNLNIKQHKLNWKW
Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q5JCK6
MPQMAPISWLTLFFIFSITLVIFNMKNYFCFFYNSNESCQNLNIKQYKLNWKW
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q3L6W9
MPQLDTSTWSITITSVVLTLFIMFQLKILKSSFPNNPEPKSTPMLKTSMPWEKKWTKIYLPLSLPQH
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Interacts with PRICKLE3 (By similarity). Belongs to the ATPase protein 8 family.
P48895
MPQLSPMNGLLIMFSVTLMLLIVLVINHFMLTPMASPLLASHLKTKKSGGEKLYY
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q08076
MPQLSPINGFVILCSISLMLLTLLINGHFMLKPISSLTTPKLKMAYIKKLYF
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
O47871
MPQLNPEPWLTTFLIVWISLIVILQPKIASLMLTSSPTPYKAMTIKTWPWPWT
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q8HFZ6
MPQLDMSPWPMVIMSMILTLFYITQLKMLNFTFHTTPSSKLTMSHKHKTTWELKWTKIYLPPSTYQ
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Interacts with PRICKLE3 (By similarity). Belongs to the ATPase protein 8 family.
Q8HG02
MPQLDMSPWPMVIMSMILTLFYITQLKMLNFTFYNTPSSKLSMPHKHKTTWELKWTKIYLPPSMYQ
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Interacts with PRICKLE3 (By similarity). Belongs to the ATPase protein 8 family.
P50655
MPQLNPAPWFSIMVMTWLTLALLIQPKLLTFTTTNPPSKKPSLITKPTPWAWPWT
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
P34836
MPQMAPINWLILFIVFSITLVVFNILNYFCFFYTPLKTSQSLNIKFNKLNWKW
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
P33506
MPQMAPINWLILFFIFSITLVIFNILNYFCFSYTPMKTSQSLNIKFNKLNWKW
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q00276
MPQMMPMKWFLIYFIYLLIFYLFIMLINSMLIKTKINKETLKIKLKKWNWFW
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q9MJC0
MPQLEFTWWIINFFIVWTADFTLLIVLSIPNLSTPTTLSKQLDINKSHVTWQWS
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
O99598
MPQLDTSTWFITILATILTLFIIMQLKISTYYYHSNPEPKTTKMTKSLIPWEIKWTKIYSPLSLPLR
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MK and ATP5MJ (By similarity). Interacts with PRICKLE3 (By similarity). Belongs to the ATPase protein 8 family.
Q37707
MPQMMPLPWIMVFLVSMALLWAIMTMVFFLYQPRSVSSAKGFSDRTVYLNWKW
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase protein 8 family.
Q75G38
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMKDTLFQFAILGFAISEATGLFCLMISFLLLYGV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. In yeast, the dimeric form of ATP synthase consists of 18 polypeptides: alpha, beta, gamma, delta, epsilon, 4 (B), 5 (OSCP), 6 (A), 8, 9 (C), d, E (Tim11), f, g, h, i, j and k. Belongs to the ATPase C chain family.
P14571
MLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALSELIALFALMMAFLILFAFRFFSKKGKLAGAPV
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q08366
MLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMAFLILFVF
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c (By similarity). Belongs to the ATPase C chain family.
Q9B8D5
MQLALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGLFCLMISFLLLYAV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q85Q98
MQLALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEATGLFCLMISFMLLFAV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
P48880
MNVTLQSAKMIGAGLATIGLTGVGAGVGIVFGSLVMAYARNPSLKQQLFGYTILGFALTEAVALFALMMAFLILFT
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q36852
MQLVLAAKYIGAAISTIGTLGAGIGIAIVFAALINGTSRNPSLRNTLFPFAITGFALSEATGLFCLMVSFTLLYGV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
A9RAH4
MQLALAAKYIGASMATLGLGGAAIGIALVFVALINGTSRNPSLRATLFPQAILGFALAEACGLFCLMMSFLLLYAV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q2LCR3
MKNIVKIEQLELASAVVELGKKVGAGLAAIGLTGAGAGVGIVFAAFILAVGMNPNLRGELFKLAMLGFALSEAVGLLALMMSFLILYS
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c (By similarity). Belongs to the ATPase C chain family.
Q37315
MKNIVKIEQLELASAVVELGKKVGAGLAAIGLTGAGAGVGIVFAAFILAVGMNPNLRGELFKLAMLGFALSEAVGLLALMMSFLILYS
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c (By similarity). Belongs to the ATPase C chain family.
Q5BCV6
MAASRVFAQRLASTMKVARPAARIQARTLTTQRMATPFQTIKRQQPSMIQASARQAFAARRQYSSEIADAMVQVSQNIGMGSAAIGLGGAGIGIGVVFGSLLLAVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
P17254
MLEGAKSIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLISSVIPIKESKKEG
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q6DN63
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLKDTLFPFAILGFALSEATGLFCLMISFLLLYAV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
P00840
MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q37550
MLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLISSVFRSVSRVTI
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c (By similarity). Belongs to the ATPase C chain family.
P26855
MLEGAKLIGAGAATIALAGAAVGIGNVFSSLINSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
Q7S5B4
MASTRVLASRLASQMAASAKVARPAVRVAQVSKRTIQTGSPLQTLKRTQMTSIVNATTRQAFQKRAYSSEIAQAMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDLMVALMAKFT
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase C chain family.
P14572
MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. The stop codon at position 75 is created by RNA editing. Belongs to the ATPase C chain family.
Q7JAI7
MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. The stop codon at position 75 is created by RNA editing. Belongs to the ATPase C chain family.
P23413
MELSPRAAELTNLFESRIRNFYANFQVDEIGRVVSVGDGIAQVYGLNEIQAGEMVLFANGVKGMALNLENENVGIVVFGGDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDAMGVPIDGRGALSDHEQRRVEVKAPGILERKSVHEPMQTGLKAVDSLVPIGRGQRELLIGDRQTGKTTIAIDTILNQKQINSRATSESETMYCVYVAIGQKRSTVGQLIQTLEEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDRISQYEKAIPNSVKPELLQALKGGLTNERKMEPDAFLKERALALI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P22201
MELSPRAAELTNLFESRIRNFYANFQVDEIGRVVSVGDGIAQVYGLNEIQAGEMVLFANGVKGMALNLENENVGIVVFGGDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDAMGVPIDGRGALSDHEQRRVEVKAPGILERKSVHEPMQTGLKAVDSLVPIGRGQRELLIGDRQTGKTTIAIDTILNQKQINSRATSESETMYCVYVAIGQKRSTVGQLIQTLEEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDRISQYEKAIPNSVKPELLQALKGGLTNERKMEPDAFLKERALRLI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P18260
MEFSPRAAELTTLLESRISNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRSTSESETLYCVYVAIGQKRSTVAQLVQILSEANAMEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVIPITDGQICSETELFYRGIRPAINVGLSVSRVGSAAQLKTMKQVCGSSKLELAQYREVAALAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDRISQYERAILKSIKTELLQSLLEKGGLTNERKMEPDTFLKECALPYTI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P05494
MEFSPRAAELTTLLESRMINFYTNLKVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGKGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTNESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSMLVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYEPLPIEKQIVVIYAAVNGFCDRMPLDRISQYEKNILSTINPELLKSFLEKGGLTNERKMEPDASLKESALNL
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P26854
MNKLAGAELSTLLEQRITNYYTKLQVDEIGRVVSVGDGIARVYGLNKIQAGEMVEFASGVKGMALNLENENVGIVIFGSDTAIKEGDIVKRTGSIVDVPVGKGMLGRVVDALGVPIDGKGALSAVERRRVEVKAPGIIARKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQINAQGTSDSEKLYCVYVAIGQKRSTVAQLVKILSEAGALEYSIIVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKMSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYRGSRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEILKQAQYSPIPIEKQIVVIYAAVKGYLDQIPVALITHYEQELLKSIDPGLLSAIVQQKNITEQISSQLATFCQKFTQSFLATHQS
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P05495
MELSPRAAELTSLLESRISNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDGLGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQLNSRATSESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVIPITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKTMKQVCGSSKLELAQYREVAALAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDRISQYERAIPNSVKPELLQSFLEKGGLTNERKMEPDTFLKESALAFI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P05492
MEFSPRAAELTTLLESRITNFYTNFQVDEIGRVISVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKSLLGRVVDALGVPIDGRGALGDHERRRVEVKVPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAIGQKRSTVAQLVQILSEGNALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEILKQPQYAPLPIEKQIIVIYAAVNGFCDRMPLDRISQYERAIPQSVKQELLQSLVEKGGLNNERKIEPDAFLKENAKPYIKG
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
Q7JAI5
MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGKGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTNESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVSKQPQYEPLPIEKQIVVIYAAVNGFCDRMPLDRISQYEKAILSTINPELLKSFNEKGGLTNERKIELDAFLKQTAKEIN
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P05493
MEFSVRAAELTTLLESRITNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGELVEFASGVKGIALNLENENVGIVVFGSDTSIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDKIAQYERDILSTIKQELLQSLKGGLTGERKIEPDAFLKEKALSLI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P24459
MEFSSRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQACGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDKIPQYERDILTTIKPELLQSLKGGLTSERKIELEKFLKEKAKNYTL
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
M1FPH1
MEFSVRAAELTTLLESRITNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIYAAVNGFCDRMPLDKIPQYERDILTTIKPELLQSLKGGLTSERKIELEKFLKEKGGTYYI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P80082
MEFSPRAAELTTLLESRISNFYTNI
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
P12862
MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGKGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTNESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSSTALPVIETQAGDVSAYIPTNVISITDGQICLETDVFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSSKLELAQYREVAAFAQFGSDLDAASQALLNRGARLTEVPKQPQYEPLPIEKQIVVIYAAVNGFCDRMPLDRISQYEKAILSTINPELQKSFLEKGGLTNERKMEPDASLKESTLPYL
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.