UniProt ID
stringlengths
6
10
Protein Sequence
stringlengths
2
35.2k
Functional Description
stringlengths
5
30.7k
Q8Y4C1
MSKGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDVLEKAKDMGVEV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A0ALL3
MSKGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEEVLEKAKDMGVEV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A6W3S8
MSSGHIVQVIGAVMDVEFPRDSVPKVYDALTIEGKQLVLEVQQQLGDGIVRTIAMGSTDGIKRGLVVENTNKPVSVPVGTKTLGRIMDVLGNPIDEKGPIGEEERWSIHRSAPSYAEQSSSNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATVVLSRDIASLGIYPAIDPLDSTSRQLDPLVIGQEHYDVARGVQMVLQRYKELKDIIAILGMDELSEEDKQTVNRSRKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILDGEFDDLPEQAFYMIGSIDEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q7P095
MSQGKIVQIIGAVIDVEFPRDAMPKVYDALKLVDADLTLEVQQQLGDGVVRTIAMGSSDGLKRGMAVANTGAPISVPVGAATLGRIMDVLGNPVDEAGPVATDARRAIHQAAPKFDELSAAADILETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEHFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGRLQERITSTKDGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVVGDEHYTVARGVQSTLQRYKELRDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEVFTGSPGKYVPLRETIKGFKAILAGEYDHLPEQAFYMVGAIEEAAEKAKTLN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q9MRR1
MRINPTTSGPGVSTLEKKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVHGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTSQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLTETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEVESNLKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
B5EFI7
MSQNFGKISQVIGAVIDVEFEPGKLPPIYQALRVTNPAIDDQEFNLVLEVAQHLGENAVRTIAMDSTDGLVRGQQVKDMGKQISVPVGKKTLGRILNVIGEPVDEMGPIGNEKEYGIHREAPLFVNQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGDEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQKFLSQPFHVAEAFTGSPGKYVELKDTIKGFSEIIAGKHDDLPEQAFYMVGTIEEAIEKAQKLAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A8ACN6
MATGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNEHLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q09MH1
MRINPTTSGPGVSAFANKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVDQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGVTLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINDQNLSESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEVTAKATNLEMESNLKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A5CQ60
MTDTATAPVASDSVAGVGRIVRVTGPVVDIEFPHDSIPPVYNALKTTITIGEESTEITLEIALHLGDDVVRAIALKPTDGLVRGQEVRDTGAAISVPVGDITKGKVFNVTGDILNNEGGEPIEITERWPIHRKPPMFDQLESKTQLFETGIKVIDLLTPYVQGGKIGLFGGAGVGKTVLIQEMIQRVAQDHGGVSVFAGVGERTREGNDLIMEMEEAGVFDKTALVFGQMDEPPGTRLRVALSALTMAEYFRDVKNQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPNLADEMGVLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSREIASRGLYPAVDPLTSTSRILDPRYLGQAHYDTATRVKAILQKNKELQEIIAILGVDELSEEDKVTVSRARRIQQFLSQNTYMAKKFTGVEGSTVPLKNTIESFSKIADGDYDHVAEQAFFNVGDLDDVERRWSEIQKENG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B0RED4
MTDTATRPVASDSVAGVGRIVRVTGPVVDIEFPHDSIPPVYNALKTTITIGEDSTEITLEIALHLGDDVVRAIALKPTDGLVRGQEVRDTGAAISVPVGDITKGKVFNVTGDILNNEGGEPIEITERWPIHRKPPMFDQLESKTQLFETGIKVIDLLTPYVQGGKIGLFGGAGVGKTVLIQEMIQRVAQDHGGVSVFAGVGERTREGNDLIMEMEEAGVFDKTALVFGQMDEPPGTRLRVALSALTMAEYFRDVKNQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPNLADEMGVLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSREIASRGLYPAVDPLTSTSRILDPRYLGQAHYDTATRVKAILQKNKELQEIIAILGVDELSEEDKVTVSRARRIQQFLSQNTYMAKKFTGVEGSTVPLKNTIESFSKIADGDYDHVAEQAFFNVGDLDDVERRWSEIQKENG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q9Z687
MPEHVGKIVQVIGPVVDIKFDAENLPDIYNSIEIDMGDNKKLIAEVEQHVGDDIVRTIAMEGTDGLKRGMEAVNTGKPISVPVGENVLGRLFNVLGQTIDEAGDMNADKYYPIHRPAPTFEEQSVQPEMFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKDSGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLANEMGALQERITSTKQGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSREISNLGIYPAVSPLESTSRILDPRIVGEEHYEVANKVKHILERYQELQDIIAILGVDELSDEDRLLVGRARRVQRFLSQAFSVAEQFTGMKGQFVPVKDTIRSFKEILDGKCDDLPEAAFLFAGTIEDVKEKAKKMMES
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A7FQH9
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
C3KYJ3
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A6LQH6
MPGKMGKVVQVIGPVIDIKFDSDSLPDLYNAIVIKAGDYELVAEVEQHVGDDIVRTIAMSATEGLKRGMDAVDTGAPISVPVGEEVLGRLFNVLGKPIDKCGDIEVKQEYPIHRPAPSFKDQSVEPEMFETGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKQHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKGQDVLLFIDNIFRYTQAGSEVSALLGRTPSAVGYQPTLATEMGALQERITSTVNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLESTSRILDPRIVGEEHYKVAADVKHVLEKYKQLQDIIAILGVDELGDEDKAVVARARRIQRFLSQPFTVGEQFTGLKGKYVPVKETVRGFKEILEGKYDELPESAFLFAGTIDDVIEKAKKLG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B2UZK0
MPGKIGKVVQVIGPVVDIKFDSDSLPNLYNAISIDMGERTLIAEVEQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDKVLGRLFNVLGKPIDNAGEVEAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPLESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKVQRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEEAVQKAKSLA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B2TK00
MPGKIGKVVQVIGPVVDIKFDSDSLPNLYNAISIDMGERTLIAEVEQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDQVLGRLFNVLGKPIDNAGEVEAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPLESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKVQRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEEAVQKAKSLA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A7G072
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
C1FQP5
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYEKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B1IE34
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFTSEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A7G9Q9
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFTSEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B1KSS8
MSNLGKVIQIIGPIIDIKFDSENLPDLFNALEINAGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRSAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLKKAQQMEI
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q180W5
MANVGKVVQIVGAVLDVKFDSEQSLPNLLNALVIKLGDKEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVVDTGGPISVPVGDETLGRIFNVLGKPVDGKPAPKSAPKLPIHRPAPAYDELETTAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKQHGGISVFSGVGERTREGNDLYGEMSESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLSRQISSLGIYPAVDPLESTSRILDPSIVGKEHYEVARGVQSILQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQSFTVAEQFTGNPGQYVPVKETVRGFKEILEGKHDDLPESAFLFVGTIEDAVRKAKGSM
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A5N3H7
MSNIGKVVQVIGPVVDIKFDEENLPDIYNAISIESGNAKIITEVAQHLGDDIVRTISMESTDGLMRGMDALDIGAPISVPVGKPVLGRLFNMLGQPIDENGEVEADEYSPIHRPAPSFEDQSVKPEMFETGIKVIDLIAPYQKGGKIGLFGGAGVGKTVIIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMQESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGSLQERITSTKHGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSISEIGIYPAVDPLASTSRILDPRVVGEEHYKVASDVKHILERYSELQDIIAILGVDELSEEDRLVVIRARRIQRFLSQPFSVAEQFTGYEGKYVPIKETIRGFKEILEGKYDDLPETAFLFKGSIDEVIESAKNMVKS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q06RC2
MRMNPTTSGSGVSTLEKKNLGRIVQIIGPVLDVSFPSGKMPNIYNALVVQGRDTVGQAINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDELGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYKIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEMESNLKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A6W7G9
MTATVNEAPASTSKGATGRIARVIGPVVDVEFSADTMPDQNNALTTQVTMGGTTQTVTLEVASHLGDNMVRAISLKPTDGMVRGAAVVDTGAPISVPVGNATLGHVFNAIGECLNLEEGEQLEVHERWPIHRKAPNFDQLESRTTMFETGIKVIDLLTPYVQGGKIGLFGGAGVGKTVLIQEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEMAEAGVFDKTALVFGQMDEPPGTRLRVALSALTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGVLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSREIASRGLYPAVDPLTSTSRILDPLYIAQDHYDTAVRVKQILQRNKELQDIIAILGVDELSEEDKLTVSRARRIQQFLSQNTYMAEKFTGVEGSTVPLKETIEGFSKIADGELDHVAEQAFFNVGGLEDVERNWARIQKETA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B5XZM4
MATGKIVQVIGAVVDVEFPQDAVPRVYEALEVQNGKEVLVLEVQQQLGGGIVRTIAMGSSDGLRRGLEVKDLEHPIEVPVGKATLGRIMNVLGQPVDMKGDIGEEERWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVALKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A6TG36
MATGKIVQVIGAVVDVEFPQDAVPRVYEALEVQNGNEVLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGQPVDMKGDIGEEERWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVALKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
P49376
MVLPRFYAASSRAALQAARRAVPFTGVRGYAAAASSQGKVRAVIGAIVDVQFEQGQLPAILNALEIDTPEGKLVLEVAQHLGENTVRTIAMDGTEGLVRGENVSDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKMRKPIHADPPLFVEQSTAAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVATQVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGRLVRLKDTISSFKAVLDGKYDHLPENAFYMVGGIEDVVAKAEKLAAEAN
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Peripheral membrane protein. Belongs to the ATPase alpha/beta chains family.
Q1IIG8
MAENFGKVIQISGPAVDVQFSETTLPEIYTALRVVSEGFDVPTPINVVLEIQQHLGEGRVRCVAMEPTEGMVRGMKAIDMGGPISVPVGRGTLGRVMNVIGEPVDQLGPIMVEKRNPIHRQAPAFDEQATTAEMFETGIKVIDLIQPFLKGGKIGLFGGAGVGKTVVIQELINNVAKQHGGFSVFGGVGERTREGNDLWLEFTEAGVITPGDPSKSKAALVYGQMTEPPGARLRVALTALTVAEYFRDEEGTDTLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPNLATEMGELQERITSTKRGSVTSVQAIYVPADDLTDPAPATTFAHLDATTVLSRALTEIGIYPAVDPLGSTSRILDPRIVGQEHYDVAQGVKGILQQYKDLQDIIAILGIDELSEDQKLTVSRARKIQRFLSQPFHVAEQFTGFPGRYVKIADTVRSFREILQGKHDEIPEQAFYMKGTIDEVHEAAEKMKANA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q9RGY1
MSEGEIVQVIGPVVDVKFPIDKNLPDINNALRVIKSEDESIVLEVTLELGDGVLRTIAMESTDGLRRGMKVEDTGAPISVPVGEDTLGRVFNVLGQPIDGGPAFPKDHPREGIHKEAPKYEDLTTSREILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPSTTFAYLDATTNLERSLVEQGIYPAVDPLESSSSALDPEVVGQEHYEVATRVQHVLQRYHELQDIISVLGMDELSDEEKLIVARARKVQFFLSQNFFVAEQFTGVPGSYVPIKETIKGFKLILDGHLDDLPEDAFRGVGPIEDVLKKAQEMGVTPSDPEAKALLEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Increases 2-fold following exposure to low pH. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. By low pH. Belongs to the ATPase alpha/beta chains family.
Q03234
MPNSTGKIAQVIGPVVDVAFPINDNLPEINNALTITRKDGSQLVLEVALELGDGVMRTIAMDSTDGLQRGMAVEDTGGPISVPVGKDTLGRVFNVLGDPIDDGEALDLNHRRDSIHRDAPKFEDLNTSSEILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVMENTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPRTTFAHLDATTNLERRLTEQGIYPAVDPLESSSSALTPEIVGEEHYKVATEVQQVLQRYRELQDIISILGMDELSDEEKVIVARARRVQFFLSQNFNVAERFTGQPGSYVPVEETVKGFKQILEGKYDDYPEDAFRSVGRIEEVVEKAKKMGFAP
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B3WDL8
MPNSTGKIAQVIGPVVDVAFPINGDLPEINNALTVAKKDGSQLVLEVALELGDGVMRTIAMDSTDGLQRNMAVQDTGGPISVPVGKDTLGRVFNVLGDPIDGGEAFGPDHRRDSIHRDAPKFEDLNTSSEILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVLENTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERRLTEQGIYPAVDPLESSSSALTPEIVGDEHYKVATEVQQVLQRYRELQDIISILGMDELSDEEKVVVARARRIQFFLSQNFNVAERFTGQPGSYVPVEETVKGFKAILDGKYDDYPEDAFRSVGRIEEVVEKAKKMGFAPDDQNTDADEKPAAQAAAN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q1GAW5
MSQGEIVQVIGLVVDVKFSIGKDLPDINNALKVIKSDDDSIILEVILEQGDGVLRCIAMESTDGLRRGMKVEDTGSSISVPVGPDTLGRVFNVLGQPIDGGPEFPADHPRSGIHKEAPKYDELTTSREILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTTIIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLDKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAYLDATTNLERSLVEQGIYPAVDPLESTSSALDPEIVGQEHYDVATRVQHILQRYRELQNIISVLGMDELSDEEKLIVARARRIQFFLSQNFFVAEVFTSVPGSYVPIKETIKGFKMILDGHLDDLPEDAFRGVGPIEDVLKKALKMGVTPSDPEAKALLEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q04BA3
MSQGEIVQVIGPVVDVKFSIGKDLPDINNALKVIKSDDDSIILEVILEQGDGVLRCIAMESTDGLRRGMKVEDTGSSISVPVGPDTLGRVFNVLGQPIDGGPEFPADHPRSGIHKEAPKYDELTTSREILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTTIIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLDKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAYLDATTNLERSLVEQGIYPAVDPLESTSSALDPEIVGQEHYDVATRVQHILQRYRELQDIISVLGMDELSDEEKLIVARARRIQFFLSQNFFVAEVFTSVPGSYVPIKETIKGFKMILDGHLDDLPEDAFRGVGPIEDVLKKALKMGVTPSDPEAKALLEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q042L5
MGKGEIVQVIGPVVDVEFPLDKDLPDINNALRVTNNNGDTLVLEVTLELGDGVLRTISMESTDGLRRGMEVEDTGAPISVPVGKDTLGRVFNVLGDPIDGGPALGKDVKREGIHKEAPKYDELSTSEEILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQGIYPAVDPLESTSSALDPEVVGEEHYQVAVQVQHILQRYQELQDIISVLGMDELSDDEKLIVERARKIQFFLSQNFFVAEQFTGLPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPIEDVVKKAEKMGVTPKNPEAKAMLEAK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A8YUK1
MSEGEIVQVIGPVIDVKFPIDKNLPNINNALRVIKSENESIVLEVTVELGDGVLRTIAMESTDGLRRGMKVEDTGGPISVPVGEDTLGRVFNVLGQPIDGGPAFSKDHPRESIHKEAPKYEDLTTSREILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPSTTFAHLDATTNLERSLVEQGIYPAVDPLESSSSALDPEVVGKEHYEVATRVQHVLQRYHELQDIISVLGMDELSDEEKLIVARARKVQFFLSQNFFVAEQFTGVPGSYVPIKETIKGFKLILDGHLDDLPEDSFRGVGPIEDVLKKAQEMGVTPSDPEAKALLEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q74K15
MSKGEIVQVIGPVVDVEFPLDKDLPDINNALRVTNNNGDTLVLEVTLELGDGVLRTISMESTDGLRRGMEVEDTGAPISVPVGKDTLGRVFNVLGDPIDGGPALGKDVKREGIHKEAPKYDELSTSEEILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQGIYPAVDPLESTSSALDPEIVGEEHYEVAVKVQHILQRYQELQDIISVLGMDELSDDEKLIVERARKIQFFLSQNFFVAEQFTGIPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPIEDVIKQAEKMGVTPKNPEAKAILEAK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q9RAU0
MSSGKITQVIGPVVDVEFGSDAKLPEINNALIVYKDVNGLKTKITLEVALELGDGAVRTIAMESTDGLTRGLEVLDTGKAVSVPVGESTLGRVFNVLGDVIDGGEDFPADAERNPIHKKAPTFDELSTANEVLVTGIKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMGIYPAVDPLASSSRALTPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKILVGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPIEDVLAKAKSMGY
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q02XA5
MSSGKITQVIGPVVDVEFGSDAKLPEINNALIVYKDVNGLKTKITLEVALELGDGAVRTIAMESTDGLTRGLEVLDTGKAVSVPVGESTLGRVFNVLGDVIDGGEDFPADAERNPIHKKAPTFDELSTANEVLVTGIKVVDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERRLTQMGIYPAVDPLASSSRAITPEIVGEEHYEVAMEVQRVLQRYKELQDIIAILGMDELSDDEKILVGRARRIQFFLSQNFHVAEQFTGQPGSYVPIDKTVHDFKEILEGKYDEVPEDAFRGVGPIEDVLAKAKSMGY
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q03A18
MPNSTGKIAQVIGPVVDVAFPINGDLPEINNALTVAKKDGSQLVLEVALELGDGVMRTIAMDSTDGLQRNMAVQDTGGPISVPVGKDTLGRVFNVLGDPIDGGEAFGPDHRRDSIHRDAPKFEDLNTSSEILETGIKVIDLLEPYLRGGKVGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMKESGVLENTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERRLTEQGIYPAVDPLESSSSALTPEIVGDEHYKVATEVQQVLQRYRELQDIISILGMDELSDEEKVVVARARRIQFFLSQNFNVAERFTGQPGSYVPVEETVKGFKAILDGKYDDYPEDAFRSVGRIEEVVEKAKKMGFAPDDQNTDADEKPAAQAAAN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A9KK92
MADTNNKLKSGLGKITQIIGAVLDIKFAEGKLPEIYEAIKIKKNDGDTLVVEVAQHLGDDTVRCIAMGPTDGLVRGMDAEGTGAPISVPVGENTLGRMFNVLGNPIDEKEAPKNVEYYPIHRKAPAFEEQSTQTEILETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELITNIATEHGGYSVFTGVGERTREGNDLYYEMIDSGVINKTTMVFGQMNEPPGARMRVGLTGLTMAEYFRDKSGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIVELGIYPAVDPLESTSRMLDPRVVGEEHYKVARDVQEILQRYKELQDIIAILGMDELSEDDKLLVARARKIQRFLSQPFHVAEQFTGLPGRYVPVAETIQGFKEIIEGKHDDIPESYFLNAGNIDDVLARVKANK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
F9UQR3
MSTGKVVQVIGPVVDVEFSLNDKLPDINNALIIQKDNDDTLTVEVSLELGDGVVRTVAMDGTDGLRRGMTVEDTGSSITVPVGKETLGRVFNVLGETIDGGPEFGPDAERNPIHRDAPKYDELTTSTEVLETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLKNTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTEQGIYPAVDPLASSSIALDPSIVGEEHYQVATEVQRVLQRYRELQDIISILGMDELSDEEKTTVARARRIQFFLSQNFFVAENFTGQPGSYVPINDTIKGFKEILEGKYDDLPEDAFRQVGKIDDVVEKAKSMVTD
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A3PES6
MVATPSTSSQTKGVVRQVIGPVLDVEFPAGKLPKILNALRIEAKNPAGQDIALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAIDTGAPISVPVGEATLGRIFNVLGEPVDEQGPVNTKDTAPIHRAAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLTQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILSGELDDLPEQAFYLVGNIDEVKAKAEKIKSEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A2C4I4
MAASATATVGTKGIVRQVIGPVLDVEFPAGKLPSILNALRIEGKNPAGQDVALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEALDTGAPISVPVGEATLGRIFNVLGEPVDEQGDLKNVTTSPIHRSAPSLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINSEDLTKSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYRTARAVQSTLQRYKELQDIIAILGLDELSEEDRKTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIKGFNMILSGELDQLPEQAFYLVGSIDEVKAKAEKLASEAKA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A8G6T8
MVATPSTSSQTKGVVRQVIGPVLDVEFPAGKLPKILNALRIEAKNPAGQDIALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAIDTGAPISVPVGEATLGRIFNVLGEPVDEQGPVNTKDTAPIHRAAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLTQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILSGELDDLPEQAFYLVGNIDEVKAKAEKINSEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A2C6Z4
MAAAATATAGTKGVVRQVIGPVLDVEFPAGKLPKILNALRIDGKNPSGQHIAITAEVQQLLGDHRVRAVAMSSTDGLVRGMEALDTGSAISVPVGEATLGRIFNVLGEPVDEQGPVTTDATAPIHRPAPKLTELETKPTVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINSDDLSKSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYRTARSVQATLQRYKELQDIIAILGLDELSEDDRRTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEETIAGFNMILAGELDHLPEQAFYLVGNIDEVKAKAEKIASEAKG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A9BCC6
MAPAATASTGTKGIVRQVIGPVLDVEFPAGKLPKILNALRIEGKNPAGQDIGLTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAVDTGAPISVPVGEATLGRIFNVLGEPVDEQGPIKSSTTSPIHRSAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADNLTESKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPAVVGDEHYRTARAVQSTLQRYKELQDIIAILGLDELSEEDRKTFDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEETIAGFNMILSGELDNLPEQAFYLVGNIEEVKAKAQKINSENKG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A2BYG3
MVATPSTSAPTKGVVRQVIGPVLDVEFPAGKLPKILNALRIESKNPAGQDIALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEATDTGAPISVPVGEATLGRIFNVLGEPVDEQGPVKTSDTAPIHRSAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINAEDLSQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARGLAAKGIYPAVDPLDSTSTMLQPSVVGDDHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVSRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILAGELDDLPEQAFYLVGNIEEVKAKADKINSEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
Q318V4
MVATPSTSSQTKGVVRQVIGPVLDVEFPAGKLPKILNALRIEAKNPAGQEIALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAVDTGAPISVPVGEATLGRIFNVLGEPVDEQGPVKTKDTAPIHRAAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLTQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEETIAGFNMILSGELDDLPEQAFYLVGNIDEVKAKAEKLKSEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
Q7VA76
MAAAATASTGTKGVVRQVIGPVLDVEFPAGKLPKILNALRIEGKNPAGQDVALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAIDTGSAISVPVGEATLGRIFNVLGEPVDEQGPVKTKTTSPIHREAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLTQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYRTARAVQSTLQRYKELQDIIAILGLDELSEDDRRTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILSGELDDLPEQAFYLVGNITEVKEKAQKISADAKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
B4F0E7
MATGKIVQVIGAVVDAEFPQDSVPKVYDALEVMNGKEKLVLEVQQQLGGGIVRCIAMGTSDGLSRGLKVEDLGHPIEVPVGKATLGRIMNVLGTPIDMKGEIETEERWSIHREAPTYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILNGDYDHLPEQAFYMVGTIEEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q7V5U2
MAAAATATAGTKGVIRQVIGPVLDVEFPAGKLPKILNALRIEGKNPSGQDVAITAEVQQLLGDHRVRAVSMSSTDGLVRGMEALDTGAAISVPVGEATLGRIFNVLGEPVDEQGPVTTDATAPIHRPSPKLTELETKPTVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINSDDLSKSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYRTARSVQATLQRYKELQDIIAILGLDELSEDDRRTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEETIAGFNMIMSGELDHLPEQAFYLVGNIDEVKAKAEKMASEAKG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
P29707
MENKGVITQIIGPVVDVTFENELPRIYNALKIDRGNGEYLVAEVQQHLGNSVVRAVAMDATDGLQRGMEVVDTGPAITVPVGKAVLGRILNVLGEPVDEAGEVKAEEYAPIHREAPAFEDQGTEKEVFETGIKVVDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAQGHGGLSVFAGVGERTREGRDLYDEMLESGVLDKTSLVYGQMNEPPGARLRVGLTGLTMAENFRDKEGQDVLFFVDNIFRFTQAPSEVSALLGRMPSAVGYQPNLATDMGALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLGIYPAVDPLDSTSTALEPQIIGHEHYNTAREVQQILQRYKELQDIIAILGMDELSDEDKVTVNRARKIERFFSQPFHVAEQFTGMDGKYVTVKETIRGFKEIIEGKHDDLPEQAFLYVGTIDEAIAKARELMKGAE
Produces ATP from ADP in the presence of a sodium ion gradient across the membrane. The beta chain is the catalytic subunit. ATP + H2O + 4 Na(+)(in) = ADP + H(+) + 4 Na(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. The ATPase of P.modestum is of special interest because it uses sodium ions instead of protons as the physiological coupling ion. Belongs to the ATPase alpha/beta chains family.
Q7V049
MVATPSTSAPAKGVVRQVIGPVLDVEFPAGKLPKILNALRIEAKNPAGQDIALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEATDTGAPISVPVGEATLGRIFNVLGEPVDEQGPVNTSDIAPIHRSAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLSQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARGLAAKGIYPAVDPLDSTSTMLQPSVVGDEHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVSRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILAGELDDLPEQAFYLVGNIDEVKAKAEKIKEEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A2BT12
MVATPSISSQTKGVVRQVIGPVLDVEFPAGKLPKILNALRIEAKNPAGQDIALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAIDTGAPISVPVGEATLGRIFNVLGEPVDEQGPVNTKDTAPIHRAAPKLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLTQSKVALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYKTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIAGFNMILSGELDDLPEQAFYLVGNIDEVKAKAEKIKSEK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
Q46J68
MAASATATVGTKGVVRQVIGPVLDVEFPAGKLPSILNALRIEGKNPAGQDVALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEALDTGAPISVPVGEATLGRIFNVLGEPVDEQGDLKNVTTSPIHRSAPSLTDLETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINSEDLTKSKLALCFGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLARALAAKGIYPAVDPLDSTSTMLQPSVVGDEHYRTARAVQSTLQRYKELQDIIAILGLDELSEEDRKTVDRARKIEKFLSQPFFVAEIFTGMSGKYVKLEDTIKGFNMILSGELDQLPEQAFYLVGSIDEVKAKAEKIASEAKA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
Q9TJR9
MTVFIETQNFGTITRIIGPVLDITFTGNKMPKIYHALSIIDKNSEGLDIFIVCEVQQLLGDHCVRAISMNATDGLKRGMTVFDTGDVLKVPVGRSTLGRIFNVLGETIDNLGPADTSNQLPIHRSAPKFIDLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKTHGGVSVFGGVGERTREGNDLYMEMKESGIINEALISESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVSSQDVLLFIDNIFRFLQAGSEVSALLGRLPSAVGYQPTLASEMGALQERITSTKDGSITSIQAVYIPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLESTSTMLQPWIVGEEHYKCSQNVKQTLQRYKELQDIIAILGLDELSPDDRLIVARARKIERFLSQPFFVAELFTGLPGKYVSLAKTIQGFNLILSGDLDALSEQAFYLVGDIEEAISKGFLKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits (By similarity). ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12) (By similarity). Belongs to the ATPase alpha/beta chains family.
Q48BG5
MSSGRIVQIIGAVIDVEFPRDSVPSIYNALEVQSAAGTTLEVQQQLGDGVVRTIAMGSTEGLKRGLEVTDSGAAISVPVGKATLGRIMDVLGNPIDEAGPIATEERWGIHRPAPSFAEQAGGNDLLETGIKVIDLVCPFTKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEKFRDEGNDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGTLQERITSTKNGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPNVIGQEHYDTARGVQYVLQRYKELKDIIAILGMDELSETDKQLVNRARKIQRFLSQPFFVAEVFTGASGKYVSLKDTIAGFKGILNGDYDHLPEQAFYMVGGIEEAIEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A6VF32
MSSGRIVQIIGAVIDVEFPRDAVPSIYEALKVQGVETTLEVQQQLGDGVVRSIAMGSTEGLKRGLNVDSTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGEEERWGIHREAPSYADQAGGNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVIGQDHYDTARGVQYVLQRYKELKDIIAILGMDELSEADKLLVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGILNGDYDHLPEQAFYMVGGIEEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B7V791
MSSGRIVQIIGAVIDVEFPRDAVPSIYEALKVQGVETTLEVQQQLGDGVVRSIAMGSTEGLKRGLNVDSTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGEEERWGIHREAPSYADQAGGNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVIGQDHYDTARGVQYVLQRYKELKDIIAILGMDELSEADKLLVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGILNGDYDHLPEQAFYMVGGIEEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q02DF4
MSSGRIVQIIGAVIDVEFPRDAVPSIYEALKVQGVETTLEVQQQLGDGVVRSIAMGSTEGLKRGLNVDSTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGEEERWGIHREAPSYADQAGGNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVIGQDHYDTARGVQYVLQRYKELKDIIAILGMDELSEADKLLVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGILNGDYDHLPEQAFYMVGGIEEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q9HT20
MSSGRIVQIIGAVIDVEFPRDAVPSIYEALKVQGVETTLEVQQQLGDGVVRSIAMGSTEGLKRGLNVDSTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGEEERWGIHREAPSYADQAGGNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVDPLDSTSRQLDPLVIGQDHYDTARGVQYVLQRYKELKDIIAILGMDELSEADKLLVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGILNGDYDHLPEQAFYMVGGIEEAVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
C5BKJ5
MSSGRIVQIIGAVIDVEFPRDSVPAVYDALKVESKGLTLEVQQQLGDGIVRCIAMGSSEGLSRNLEVTGTGAPVSVPVGNETLGRIMDVLGNPIDECGPIGEQERMPIHRKAPAYDELSSTTDLLETGVKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIALEHSGLSVFAGVGERTREGNDFYHEMQESGVVNVENFKESKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIAAKGIYPAIDPLDSTSRQLDPLVIGAEHYDVARGVQSVLQRYKELKDIIAILGMDELSEEDKQTVNRARKIERFLSQPFHVAEVFTGAPGKYVPLKDTIAGFKGLLAGDFDHLPEQAFYMVGTIDEAVEKAAKIAGKAA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q1KVT0
MSDLNTKNVGKISQIIGPVLDIAFGQGQVPNIYNALTIKAKNAAGLEMSVTCEVQQLLGDSCVRAVAMNPTDGLMRGMEVLDTGKPLNVPVGKSTLGRIFNVLGEPVDNLGPVKNEESLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLIDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGALQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPWILGEKHYGCAQSVKRTLQRYKELQDIIAILGLDELSEEDRLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFNKILAGELDDLPEQAFYLVGNINEALTKAASMK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
A0T0R6
MVETTNKGYVCQIIGPVLDIEFPGGKLPPIYSAIKIETADGIGNIVEVQQLLGDNKVRAVSMRSTDGLKRGVEAVDLGAPITVPVGVPTLGRIFNVIGEPVDEQGDVVVDQTLPIHRDAPAFTELETKPSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYEEMKESGVINSSNFAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLDSTSTMLQPGIVSEVHYETAETVKETLQRYKELQDIIAILGIDELSEEDRLVVARARKVERFLSQPFFVAEIFTGSPGKYVSLEETIKGFTMILNGELDDLPEQSFYLVGNIDEAIAKAETLK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
B7IG44
MSKKSKGKILRVIGPVVDVQFEEGDLPDIYDALVVINPQTGKKLVLEVEQLIGDNAVRTVALDTTDGLMRGLEVENTGEPIKVPVGKGALGRMFNVIGEPIDGKEDEIKDVEYWPIHKAPPSITEQSTSVEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHHGFSMFAGVGERTREGNELYLDMQEAEVLDNTVLVFGQMNEPPGARFRVALTALTMAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATVVLSRRRAALGLYPAVDPLDSTSKMLDPNIIGQEHYEVARGVQEILQRYKDLQDIIAILGMEELSEEDKLIVQRARKIERFLSQPVHVAEKFSNIPGKYVPINETIRGFKEILEGKYDDLPEMAFYMVGTIDEAVEKAKQLQKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q47M82
MTATAEGTAAPTTVTGRIARVIGPVVDVEFPVGSLPPIYNALKTEVTLGGETRTITLEVAQHLGDNLVRAISLNPQDGLVRGAEVRDTGAPIRVPVGDGVKGHVFNALGEPQDIPKSELQVKEYWPIHRPAPAFDQLEAKTEMLVTGIKVIDLLTPYVRGGKIGLFGGAGVGKTVLIQEMITRIARNFGGVSVFAGVGERTREGTDLFLEMQEMGVLPDTALVFGQMDEPPGTRLRVALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPNLADEMGLLQERITSTRGHSITSMQAIYVPADDYTDPAPATTFAHLDATTELSRPISQKGIYPAVDPLTSTSRILDPQYVGQEHYEVAQRVKEILQRNHDLQDQIAILGIDELSEEDKIIVHRARRLERFLSQNMFVAEKFTGTPGVFVPLEETIASFKAICDGEYDHLPEQAFLNVGNIEMAVEKAKKLQS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A6LJR1
MSKRSKGKILRVIGPVVDVQFEEGELPDIYDALEVINPQTGKKLILEVEQLIGDNAVRTVALDTTDGLMRGLEVENTGEPIKVPVGKGALGRMFNVIGEPIDGKEDVKDVEYWPIHRTPPSITEQSTSVEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHHGFSMFAGVGERTREGNELYLDMQEAEVLDNTVLVFGQMNEPPGARFRVALSALTMAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATVVLSRRRAALGLYPAVDPLDSTSKMLDPNVVGQEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLIVQRARKIERFLSQPVHVAEKFSNIPGKYVPISETIRGFKEILEGKYDDLPEMAFYMVGTIDEAVEKAKKLQKA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
O50550
MAKGSKGFIVSIMGPVVDVKFPEEELPDIYNALEVVNPQTGQKVVLEVEQLIGDGVVRTVAMDSTDGLTKGLEVVDTGAPITAPVGKEVLGRILNVIGEPVDEAGEIKAKERWPIHRPAPELVEQSTEIEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHKGFSVFAGVGERTREGNELWLEMQESGVLGNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELGLYPAVDPLDSSSKILDPAIVGREHYEVARGVQEVLQRYKDLQDIIAILGVEELSPEDKLVVHRARRIQRFLSQPFHVAERFTGRPGRYVPIEETIRGFKEILDGKLDDVPEQAFLMAGNIDEVKERAKEMRS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B9K7U1
MAKGSKGYIVGVMGPVVDVKFPEEELPDIFNALEVVNPQTGQKIVLEVEQLIGDGVVRTVAMDSTDGLMKGLEVVDTGEPITAPVGKEVLGRILNVIGEPVDEAGEIKSKERWPIHRPAPELIEQSTEIEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHKGFSVFAGVGERTREGNELWLEMQESGVLGNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELGLYPAVDPLDSSSKILDPAVVGREHYEVARGVQEVLQRYKDLQDIIAILGVEELSPEDKLVVHRARRIQRFLSQPFHVAERFTGRPGKYVPLEETIRGFKEILDGKLDDVPEQAFLMAGTIDEVKERAKEMRS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
A5ILX2
MAKGSKGFIVSIMGPVVDVKFPEEELPDIYNALEVVNPQTGQKVVLEVEQLIGDGVVRTVAMDSTDGLTKGLEVVDTGAPITAPVGKEVLGRILNVIGEPVDEAGEIKAKERWPIHRPAPELVEQSTEIEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHKGFSVFAGVGERTREGNELWLEMQESGVLGNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELGLYPAVDPLDSSSKILDPAIVGREHYEVARGVQEVLQRYKDLQDIIAILGVEELSPEDKLVVHRARRIQRFLSQPFHVAERFTGRPGRYVPIEETIRGFKEILDGKLDDVPEQAFLMAGNIDEVKERAKEMRS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B1LBB9
MAKGSKGFIVSIMGPVVDVKFPEEELPDIYNALEVVNPQTGQKVVLEVEQLIGDGVVRTVAMDSTDGLTKGLEVVDTGAPITAPVGKEVLGRILNVIGEPVDEAGEIKAKERWPIHRPAPELVEQSTEIEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHKGFSVFAGVGERTREGNELWLEMQESGVLGNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELGLYPAVDPLDSSSKILDPAIVGREHYEVARGVQEVLQRYKDLQDIIAILGVEELSPEDKLVVHRARRIQRFLSQPFHVAERFTGRPGRYVPIEETIRGFKEILDGKLDDVPEQAFLMAGNIDEVKERAKEMRS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q8DLG8
MVISAERTNVGFITQVIGPVVDIEFPSGKMPAIYNALRIQGKNAAGLDVAVTCEVQQLLGDNRVRAVAMSSTDGLVRGMEVVDTGAPISVPVGTATLGRIFNVLGEPVDEKGAVNATETLPIHRPAPSFTQLETKPSVFETGIKVIDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVIDKDDPSKSKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRSLAAKGIYPAVDPLGSTSNMLQPDIVGEEHYQTARAVQATLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGAPGKYVTLEETIKGFQMILSGELDDLPEQAFYMVGNIEEAKAKAEKLKA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. The complex from the organism is particularly stable to disruption and remains functional after 6 hrs at 55 degrees Celsius. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate Inhibited by dicyclohexylcarbodiimide. Optimum temperature is 55 degrees Celsius, activity was detected from 4 to 95 degrees Celsius. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
B5YI24
MNVGKVVQVIGTVVDCEFEGQLPEVLNALKIEEPGDPAKGIPELHLTLEVAMHLGENRVRTIAMGSTDGLVRGMKVVDTGAPITVPVGKPVLGRIINVIGEPVDEMGPIQAQDKYPIHISAPEFTEQSPTTQQFETGVKVFDLLVPFVRGGKMGMFGGAGVGKTVIIMEMIHNIAMKHGGVSVFAGVGERTREGNDLYLEMKHSGVLPQVALVYGQMNEPPGVRARIALTALTVAEYFRDQGQDVLIFIDNIFRYTLAGSEVSALLGRMPSAVGYQPTLSTEMGALQERITTTAKGSITSMQAIYVPADDLTDPAVAAVFAHLDGTVVLSRQIAELGIYPAVDPLDSTSRILDPRVVGDEHYQVARGVQSVLQRYKELQDIIAILGIEELSEDDKLTVARARKLQRFLSQPFHVAETFTGTPGKYVKLEDTIKGFKAILDGKYDDLPEQAFYMVGPIEEVEEKAKKMGYTRQV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q3SF66
MSNGKIVQIIGAVVDVEFPRDAMPKVMEALKMQAPELTFEVQQQLGDGVVRTIAMGSTDGLRRGMDVLSTGNPIMVPVGQKTLGRIMNVLGDPVDEAGPIGAETTMPIHRKAPAYADQAATVEILETGIKVIDLIMPIAKGGKVGLFGGAGVGKTVTLMELIRNIAVQHSGFSVFAGVGERTREGNDFYHEMKEGGVLDKVALVYGQMNEPPGNRLRVALTGLTMAEYFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLADEMGRLQERITSTKTGSITSFQAVYVPADDLTDPSPATTFAHLDATLVLSRQVAELGIYPAVDPLDSTSRILDPQVVGEEHYTVARKVQGTLQKYKELRDIIAILGMDELSPEDKLAVSRARKLQRFLSQPFFVAEVFTGAPGKYVTLKDTIAGFKAIVEGEYDHLPEQAFYMVGGIEEAVEKAKTIQ
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
B8GRB8
MSAGNIVEIIGAVVDVEFPRDAVPNVYDALRVEDSGLTLEVQQQLGDGVVRTIAMGSTDGMRRGVTVANTGAPISVPVGKGTLGRVMDVLGNPVDNAGDVQTEERWSIHRPAPSFDEQAGSTELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEFFRDEGRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELGIYPAVDPLDSTSRQLDPQVIGNEHYDTARAVQNTLQRYKELKDIIAILGMDELSEDDKLIVARARKIQRFLSQPFFVAEVFTGAPGKYVSLKDTIRGFQAIVAGEYDHLPEQAFYMVGTIDEAVEKAGKLK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
P00826
MRINPTTSGSGVSTLEKKNPGRVVQIIGPVLDVAFPPGKMPNIYNALVVQGRDSVGQPINVACEVQQLLGNNRVRAIAMSATEGLTRGMEVIDTGAPISVPVGGATLGRIFNVLGEPVDNLGPVDTSTTSPIHRSAPAFIQLDTKLSIFETGIEVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLLVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEMESNLKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
C4LDW0
MSNGIIVQVIGAVVDVQFPQDAVPKVYDALKIVSEGQSKGLVMEVQQQIGGGVVRCIAMGTSDGLRRGAEVSNTGEAIKVPVGMKTLGRIMNVLGEPVDEQGPIGAEDNWVIHREAPSYEDQSSATELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKESNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDSTVTLSRQIAALGIYPAVDPLDSTSRQLDPLVVGQEHYETARGVQTVLQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFNVAEVFTGSPGKYVTLKETIRGFKGILDGEYDDLPEQAFYMVGSIDEVVEKAKKL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q9BA92
MRTNPTTSSPVVSTLEEKNLGRIAQIIGPVLDVVFPPGKMPNIYNALVVKGRDTVQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKFSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRVLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTSQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLGETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEVESKLKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
P49647
MVKTNINKGYVNQIIGPVLDIEFPSGTLPPIYSALKIETEDGIGTVVEVQQLLGDNKVRAVSMRSTDGLKRGVEARDLGGPISVPVGISTLGRIFNVIGEPVDEQGDVSYDETLPIHREAPAFTELETKPSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYEEMKESGVINENNFKESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLDSTSTMLQPGIVSGEHYEIAETVKETLQRYKELQDIIAILGIDELSEEDRLTVARARKVERFLSQPFFVAEIFTGSPGKYVSLEETIKGFTMVLKGELDELPEQAFYLVGNIDEAIAKAETLK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
Q10Z38
MVSTLEKTNVGSITQIIGPVVDVKFPSGNLPEIYNALTITAKNEAGQDVSVTCEVQQLLGDNQVRAVAMSATDGLVRGMEVVDTRAAISVPVGNATLGRIFNVVGEPVDELGPVGTEDKSPIHREAPKLVDLETQPSVFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVIIMELINNIAKAHGGVSVFGGVGERTREGNDLYNEMIESKVINPENLSESKVALVYGQMNEPPGARMRVGLSALTMAEYFRDVSKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGELQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPSVVGKEHYDVARAVQSTLQRYKELQDIIAILGLDELSEDDRLVVARARKIERFLSQPFFVAEVFTGSPGQYVKLEDTMKGFKMILSGELDDLPEQAFYMVGGIDQVIAKAEKLKAEA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a(1), b(1), b'(1) and c(9-12). Belongs to the ATPase alpha/beta chains family.
B3EA01
MSQNIGKISQVIGAVIDVEFEPGKLPEIYHALRVTNPAIDDRENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVIDTGKQICAPVGRKTLGRIMNVIGEPVDEMGPIGNEKEYGIHREAPAFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGYSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALTALSVAEYFRDEENQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAVARSVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDNLPEQAFYMVGSIEEAIEKAAKLAAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a(1), b(2) and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF(1) is attached to CF(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase alpha/beta chains family.
Q62FR8
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A1V8T4
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALSPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A3P0Z3
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
Q3JXV5
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A3NF43
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
Q63PH7
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
Q2STE6
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRAQVAELLLATLKSPLASGAQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A4JA32
MAELATIARPYAEALFRVAEGGDIAAWSTLVQELAQVAHLPEVLSVASSPKVTRKQVAELLLVAVKSPLAAGAEAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLEGAELDSLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAALTA
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
Q09544
MLARTIQRFSVVAKRGYAAAAPAANANPEELRLTFASPDTAVFSNAVVKQVDVPTLAGMVGVLANHVPTIGVLKPGVVSVTTNEGTVQRLFVSSGTLSVNIDGSCQVLAEEVLKVEEIDESAARAELDAAQRASGEGSEVARAEAQIRAEVAEALIKAATNQQ
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element (Probable). Subunit of the F-type ATPase which has 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. Belongs to the ATPase epsilon chain family.
B9MS71
MLAAKRYAEALIKLGQEEGKLEIFYEQLFKMFEIIKNNNEFNTIWFDLEMKRSEKKQRIKVFFGGDIDSYILNLLYLLIDKRREIILTYIPFYYKEIYDKIVGNVDVQVIVAHEIGSDVLNKISKWLLKKYGVKNPRFIVKVDKSIIGGIKLLFNNIEVDASIKGALDSMRKELVKIAIL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
Q8RC18
MEQIIAKRYASALFDVAKKEDRVKEYYEELKKAVEILQTEAVWKIFVNKSIDKTKKMKFVEEVLEGFSKEIVNFVKVAISKHRENLIKEILNEFEALYKAYFNMIDVKVISAYPLKEEVLNLVREKLEKKYNKKVNLIPVVDKEILGGLKLVIGNTVIDGSIKARLEALLKNMRQAV
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A4XKX3
MLPAKRYAEGLLKLAQEEGKLEKFYEDLFKIYDLFKTNKQFVDVLFDLEMKVSNKKEKIKQFLDESIDRYIVNLICLLIDKRRETLLPYIPFYYKEMYDKIIGNVEVEVIVSEEVDEGVLRKISNWLLKRYDVKNPRFKVKVDRSIIGGIKLLFNNIEVDATIKGALDSIKKELIQNAI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A7ZC34
MNEVVAKKYVKAILSDVKSNELNAFVENLSELAAAFASDKFKSIISLPTLKASQKVEFVLSLVKNQDAKFANFIKLLGANKRLELIPAILDEMKIEQSLLENTYRGEVVGNFDLSAEQLKALEENFSKKFNSKIKLDGSKSDYNGVKVELDDLGVEVNFSIDRLKSQMSEYILKAI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A7H020
MNEVVAKKYVKAILSDVNSAQLAKFISNLSEISAAFEIEKFRNIISLPTLKNSAKAEFILSLVQDPSENFKNFIKLLGANKRLSLIPAILNEIKSEQTLLDNIYHGSVYGNFELNGEQLSALEDKFSKRFDAKVKLGGSKSDYNGIKVELDDLGVEASFSMDRLKTQMSEYILKAI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A0RR29
MKEVVAKKYVKALILSLSSDEFDKLGNELKDISNAFLLPKLKVIIDSPDISSKQKADFLFSLLDNASNKIHNFLLLLAERKRLGLIPEISKEFEYQQAVRDCKFSGLISGNFELSAAQKTELEERFSKKFGAKIEFENIKNNYNGIKIELDDLGVEVSFSIDRLKAQMSEYILKAI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A7I174
MSENIAKRYVKALIEVCKKDELNDVLKGLKAIVSAFSVAKFNDIIKSPTVSKKDKISLILSFLKEPNVKIENLLKILMKNGRISLLPQIYDGIKESIALSNNEYQGKIYTKENLDEPTIKLLETNFSKKLNANIKFVCIAGNYTGVKIDISDLGYEISFSIDRLKSAMSEYILKAI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A8FJQ9
MENIIARRYAKAIASRADINDFYQNLCILNSAFVLPKFKNIIESNEIKKERKMEFLDSFFDIKNSSFQNFLRLLIENSRLEYIPQIVKELERQKAFKENIFVGIVYSKEKLSQENLKDLEVKLNKKFDANIKLNNKISQDDSVKIELEELGYELSFSMKALQNKLNEYILKII
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.
A7H1H8
MENIIARRYAKAIASRADINDFYQNLCILNSAFVLPKFKNIIESNEIKKERKMEFLDSFFHIKNSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGIVHSKEKLSQENLKDLEVKLNKKFNANIKLNNKISQDDSVKIELEELGYELSFSMKALQNKLNEYVLKII
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase delta chain family.