protein_id
stringlengths
6
10
protein_names
stringlengths
2
1.26k
protein_function
stringlengths
9
5.75k
organism
stringclasses
589 values
length
float64
11
16k
subcellular_location
stringlengths
7
6.16k
sequence
stringlengths
11
16k
go_ids
listlengths
2
494
go_bp
listlengths
0
437
go_mf
listlengths
0
59
go_cc
listlengths
0
67
structure_path
stringlengths
25
29
string_id
stringlengths
10
27
interaction_partners
listlengths
1
668
interpro_ids
listlengths
1
20
interpro_location
stringlengths
3
529
ppi_formatted
stringlengths
0
811
interpro_formatted
stringlengths
0
1.79k
go_pred
stringlengths
369
15k
Q13542
Eukaryotic translation initiation factor 4E-binding protein 2
Repressor of translation initiation involved in synaptic plasticity, learning and memory formation. Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation (By similarity). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways (By similarity)
Homo sapiens (Human)
120
Cytoplasm. Nucleus
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0032838", "GO:0035770", "GO:0036464", "GO:0042995", "GO:0043005", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0071598", "GO:0099080", "GO:0099568", "GO:0110165", "GO:0120025", "GO:0120111" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0032838", "GO:0035770", "GO:0036464", "GO:0042995", "GO:0043005", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0071598", "GO:0099080", "GO:0099568", "GO:0110165", "GO:0120025", "GO:0120111" ]
AF-Q13542-F1-model_v6.pdb
9606.ENSP00000362314
[ "Q96E95", "Q8N102", "Q9P2P3", "O60516", "Q6IBN3", "Q7Z721", "Q9Y4I3" ]
[ "IPR008606" ]
{"IPR008606": [7, 120]}
- Eukaryotic translation initiation factor 4E - Regulatory-associated protein of mTOR - Serine/threonine-protein kinase mTOR - Eukaryotic translation initiation factor 4E-binding protein 1 - Eukaryotic translation initiation factor 4E-binding protein 3 - Ribosomal protein S6 kinase beta-1 - Eukaryotic translation initiation factor 4 gamma 1
- IPR008606: Eukaryotic translation initiation factor 4E binding (family) [7-120]
Molecular Function (MF): GO:0003674 (molecular function), GO:0045182 (translation regulator activity), GO:0005488 (binding), GO:0030371 (translation repressor activity), GO:0005515 (protein binding), GO:0031369 (translation initiation factor binding), GO:0008190 (eukaryotic initiation factor 4E binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0023052 (signaling), GO:0048519 (negative regulation of biological process), GO:0019222 (regulation of metabolic process), GO:0022402 (cell cycle process), GO:0050794 (regulation of cellular process), GO:0007049 (cell cycle), GO:0051716 (cellular response to stimulus), GO:0048523 (negative regulation of cellular process), GO:0007154 (cell communication), GO:0007165 (signal transduction), GO:0009892 (negative regulation of metabolic process), GO:0048522 (positive regulation of cellular process), GO:0051726 (regulation of cell cycle), GO:0051172 (negative regulation of nitrogen compound metabolic process), GO:1903047 (mitotic cell cycle process), GO:0035556 (intracellular signal transduction), GO:0010605 (negative regulation of macromolecule metabolic process), GO:0044770 (cell cycle phase transition), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0009890 (negative regulation of biosynthetic process), GO:0080090 (regulation of primary metabolic process), GO:0031324 (negative regulation of cellular metabolic process), GO:0000278 (mitotic cell cycle), GO:0045787 (positive regulation of cell cycle), GO:0044772 (mitotic cell cycle phase transition), GO:0007346 (regulation of mitotic cell cycle), GO:0034248 (regulation of amide metabolic process), GO:0045947 (negative regulation of translational initiation), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0044843 (cell cycle G1/S phase transition), GO:0051246 (regulation of protein metabolic process), GO:0006446 (regulation of translational initiation), GO:0051248 (negative regulation of protein metabolic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0010558 (negative regulation of macromolecule biosynthetic process), GO:0031327 (negative regulation of cellular biosynthetic process), GO:0045931 (positive regulation of mitotic cell cycle), GO:0031929 (TOR signaling), GO:0010629 (negative regulation of gene expression), GO:0010468 (regulation of gene expression), GO:0034249 (negative regulation of amide metabolic process), GO:0017148 (negative regulation of translation), GO:0000082 (G1/S transition of mitotic cell cycle), GO:2000112 (regulation of cellular macromolecule biosynthetic process), GO:0006417 (regulation of translation), GO:2000113 (negative regulation of cellular macromolecule biosynthetic process), GO:0010608 (post-transcriptional regulation of gene expression) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
P97288
5-hydroxytryptamine receptor 4
G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (By similarity). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide- binding proteins (G proteins) and modulates the activity of downstream effectors (By similarity). HTR4 is coupled to G(s) G alpha proteins and mediates activation of adenylate cyclase activity (By similarity)
Mus musculus (Mouse)
388
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Note=Interaction with SNX27 mediates recruitment to early endosomes, while interaction with NHERF1 and EZR might target the protein to specialized subcellular regions, such as microvilli
MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRDTVECGGQWESRCHLTATSPLVAAQPSDT
[ "GO:0001894", "GO:0003008", "GO:0006810", "GO:0007154", "GO:0007165", "GO:0007186", "GO:0007586", "GO:0007589", "GO:0008150", "GO:0009987", "GO:0010669", "GO:0022600", "GO:0023052", "GO:0030277", "GO:0032501", "GO:0032941", "GO:0042592", "GO:0044087", "GO:0046903", "GO:0048871"...
[ "GO:0001894", "GO:0003008", "GO:0006810", "GO:0007154", "GO:0007165", "GO:0007186", "GO:0007586", "GO:0007589", "GO:0008150", "GO:0009987", "GO:0010669", "GO:0022600", "GO:0023052", "GO:0030277", "GO:0032501", "GO:0032941", "GO:0042592", "GO:0044087", "GO:0046903", "GO:0048871"...
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0030054", "GO:0045202", "GO:0071944", "GO:0098794", "GO:0098978", "GO:0110165" ]
AF-P97288-F1-model_v6.pdb
10090.ENSMUSP00000027560
[ "Q61226", "O70176", "Q9R1C8", "Q3UFE9", "Q544U4", "Q9D887", "Q9Z1N8", "Q8CGK7", "Q5FW59", "Q9QUN1", "Q14A50" ]
[ "IPR017452", "IPR001520", "IPR000276" ]
{"IPR001520": [2, 359], "IPR000276": [21, 327], "IPR017452": [36, 312]}
- Guanine nucleotide-binding protein G(olf) subunit alpha - VIP peptides - VIP peptides - Pro-opiomelanocortin - 5-hydroxytryptamine receptor 6 - 5-hydroxytryptamine receptor 7 - Gastric inhibitory polypeptide - Pro-glucagon - Pituitary adenylate cyclase-activating polypeptide - Natriuretic peptides A
- IPR017452: GPCR, rhodopsin-like, 7TM (domain) [36-312] - IPR001520: 5-Hydroxytryptamine 4 receptor (family) [2-359] - IPR000276: G protein-coupled receptor, rhodopsin-like (family) [21-327]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0038023 (signaling receptor activity), GO:0004888 (transmembrane signaling receptor activity), GO:0099589 (serotonin receptor activity), GO:0004930 (G protein-coupled receptor activity), GO:0008227 (G protein-coupled amine receptor activity), GO:0004993 (G protein-coupled serotonin receptor activity) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0023052 (signaling), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0032501 (multicellular organismal process), GO:0051716 (cellular response to stimulus), GO:0007267 (cell-cell signaling), GO:0003008 (system process), GO:0007154 (cell communication), GO:0007165 (signal transduction), GO:0050794 (regulation of cellular process), GO:0050877 (nervous system process), GO:0007214 (gamma-aminobutyric acid signaling pathway), GO:0007186 (G protein-coupled receptor signaling pathway), GO:0050890 (cognition), GO:0007188 (adenylate cyclase-modulating G protein-coupled receptor signaling pathway), GO:0007189 (adenylate cyclase-activating G protein-coupled receptor signaling pathway) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0005737 (cytoplasm), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q7ZWC3
Oxidized purine nucleoside triphosphate hydrolase
Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy- dATP) into 2-oxo-dAMP. Also has a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress
Danio rerio (Zebrafish) (Brachydanio rerio)
156
Cytoplasm, cytosol. Mitochondrion matrix. Nucleus
MFTSKLLTLVLVVQPGRVLLGMKKRGFGAGKWNGFGGKVQTGETIEQAARRELLEESGLTVDTLHKIGNIKFEFIGETELMDVHIFRADNYEGEPAESDEMRPQWFDIDKIPFSQMWADDILWFPLMLQKKRFLGYFKFQGHDVIVEHKLDEVEDL
[ "GO:0006139", "GO:0006163", "GO:0006753", "GO:0006793", "GO:0006796", "GO:0008150", "GO:0008152", "GO:0009117", "GO:0009151", "GO:0009262", "GO:0009394", "GO:0009987", "GO:0019637", "GO:0044238", "GO:0044281", "GO:0055086", "GO:0072521", "GO:1901135" ]
[ "GO:0006139", "GO:0006163", "GO:0006753", "GO:0006793", "GO:0006796", "GO:0008150", "GO:0008152", "GO:0009117", "GO:0009151", "GO:0009262", "GO:0009394", "GO:0009987", "GO:0019637", "GO:0044238", "GO:0044281", "GO:0055086", "GO:0072521", "GO:1901135" ]
[]
[]
AF-Q7ZWC3-F1-model_v6.pdb
7955.ENSDARP00000040752
[ "Q6IQ66", "E7F6K6", "Q568Q0", "Q1LXZ5", "A0A2R8RL21", "B0R135", "Q6DG97", "Q4V8V2", "A0A0R4ISD4", "F1QQK5" ]
[ "IPR020084", "IPR003563", "IPR000086", "IPR020476", "IPR015797" ]
{"IPR015797": [1, 147], "IPR003563": [4, 154], "IPR000086": [3, 129], "IPR020476": [32, 61], "IPR020084": [37, 58]}
- 8-oxo-dGDP phosphatase NUDT18 - Nucleotide triphosphate diphosphatase NUDT15 - ADP-sugar pyrophosphatase - m7GpppN-mRNA hydrolase NUDT17 - Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] - Uridine diphosphate glucose pyrophosphatase NUDT14 - Nudix (nucleoside diphosphate-linked moiety X)-type motif 22 - N-glycosylase/DNA lyase
- IPR020084: NUDIX hydrolase, conserved site (conserved_site) [37-58] - IPR003563: Oxidized purine nucleoside triphosphate (family) [4-154] - IPR000086: NUDIX hydrolase domain (domain) [3-129] - IPR020476: NUDIX hydrolase (domain) [32-61] - IPR015797: NUDIX hydrolase-like domain superfamily (homologous_superfamily) [1-147]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0016817 (hydrolase activity, acting on acid anhydrides), GO:0016818 (hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides) Biological Process (BP): GO:0008150 (biological process), GO:0032502 (developmental process), GO:0050896 (response to stimulus), GO:0032501 (multicellular organismal process), GO:0009628 (response to abiotic stimulus), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0009653 (anatomical structure morphogenesis), GO:0006950 (response to stress), GO:0048646 (anatomical structure formation involved in morphogenesis), GO:0009408 (response to heat), GO:0009266 (response to temperature stimulus), GO:0001525 (angiogenesis), GO:0035295 (tube development), GO:0006979 (response to oxidative stress), GO:0001568 (blood vessel development), GO:0048731 (system development), GO:0035239 (tube morphogenesis), GO:0048514 (blood vessel morphogenesis), GO:0002040 (sprouting angiogenesis), GO:0001944 (vasculature development), GO:0072359 (circulatory system development) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0005739 (mitochondrion), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle)
Q568L5
Aldo-keto reductase family 1 member A1-B
Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids. Acts as an aldehyde-detoxification enzyme (By similarity). Also acts as an inhibitor of protein S-nitrosylation by mediating degradation of S- nitroso-coenzyme A (S-nitroso-CoA), a cofactor required to S- nitrosylate proteins (By similarity). Also acts as a S-nitroso- glutathione reductase by catalyzing the NADPH-dependent reduction of S- nitrosoglutathione (By similarity). Displays no reductase activity towards retinoids (By similarity)
Danio rerio (Zebrafish) (Brachydanio rerio)
324
Cytoplasm, cytosol. Apical cell membrane
MNDFAVLSTGRKMPLLGLGTWKSEPGLVKQAVIWALESGYRHIDCAPIYANEPEIGEAFQETMGPDKGIRREDVFVTSKLWNTKHHPDDVEPSLLKTLKDLKLEYLDLYLIHWPYAFQRGDTPFPRKEDGTLLYDDIDYKLTWAAMEKLVGKGLVRAIGLSNFNSRQIDDILSVASIKPTVLQVESHPYLAQVELLSHCRDRGLVMTAYSPLGSPDRAWKHPDEPVLLEEPAIAALAKKYNKTPAQIIIRWQTQRGVVTIPKSITQSRIKENIQVFDFTLESEEMSQVTALHRGWRYIVPTITVDGKSVPRDAGHPHYPFNDPY
[ "GO:0006109", "GO:0006111", "GO:0008150", "GO:0009889", "GO:0010906", "GO:0019222", "GO:0033500", "GO:0042592", "GO:0042593", "GO:0043255", "GO:0048878", "GO:0050789", "GO:0050794", "GO:0062012", "GO:0065007", "GO:0080090", "GO:0003674", "GO:0003824", "GO:0008106", "GO:0016491"...
[ "GO:0006109", "GO:0006111", "GO:0008150", "GO:0009889", "GO:0010906", "GO:0019222", "GO:0033500", "GO:0042592", "GO:0042593", "GO:0043255", "GO:0048878", "GO:0050789", "GO:0050794", "GO:0062012", "GO:0065007", "GO:0080090" ]
[ "GO:0003674", "GO:0003824", "GO:0008106", "GO:0016491", "GO:0016614", "GO:0016616", "GO:0018455" ]
[]
AF-Q568L5-F1-model_v6.pdb
7955.ENSDARP00000119785
[ "Q90ZZ8", "B8A4B0", "Q6P696", "F6NZ60", "A2BGR9", "B0S7W5", "Q7ZVB2", "F8W5X0", "B0UYA3", "F8W5X3", "Q6AZW2", "Q90ZZ7", "E9QH31", "F1QGS9", "F1QR17", "Q4V8T0", "F2Z4R7", "F1QGP1", "Q7ZWC2", "X1WBM4", "A0A2R8RIE8", "Q802W2" ]
[ "IPR044481", "IPR023210", "IPR018170", "IPR020471", "IPR036812" ]
{"IPR036812": [2, 324], "IPR020471": [5, 307], "IPR044481": [7, 311], "IPR023210": [16, 291], "IPR018170": [39, 275]}
- Aldehyde dehydrogenase - Beta-glucuronidase - Glucuronokinase with putative uridyl pyrophosphorylase - Klotho - Monoglyceride lipase - Aldo-keto reductase family 1 member A1-A - Inositol oxygenase - Aldehyde dehydrogenase - Lactoylglutathione lyase - Aldehyde dehydrogenase
- IPR044481: Aldo-keto reductase family 1 member A1 (family) [7-311] - IPR023210: NADP-dependent oxidoreductase domain (domain) [16-291] - IPR018170: Aldo/keto reductase, conserved site (conserved_site) [39-275] - IPR020471: Aldo-keto reductase (family) [5-307] - IPR036812: NAD(P)-dependent oxidoreductase domain superfamily (homologous_superfamily) [2-324]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0098754 (detoxification), GO:0050896 (response to stimulus), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0042221 (response to chemical), GO:0044281 (small molecule metabolic process), GO:0051716 (cellular response to stimulus), GO:0071704 (organic substance metabolic process), GO:1990748 (cellular detoxification), GO:0009056 (catabolic process), GO:0044238 (primary metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0044282 (small molecule catabolic process), GO:0044283 (small molecule biosynthetic process), GO:0046483 (heterocycle metabolic process), GO:0070887 (cellular response to chemical stimulus), GO:0006082 (organic acid metabolic process), GO:0044248 (cellular catabolic process), GO:0019637 (organophosphate metabolic process), GO:0009636 (response to toxic substance), GO:0110095 (cellular detoxification of aldehyde), GO:0044249 (cellular biosynthetic process), GO:0005996 (monosaccharide metabolic process), GO:1901700 (response to oxygen-containing compound), GO:0005975 (carbohydrate metabolic process), GO:0006766 (vitamin metabolic process), GO:1901575 (organic substance catabolic process), GO:0010033 (response to organic substance), GO:1901135 (carbohydrate derivative metabolic process), GO:0006081 (cellular aldehyde metabolic process), GO:0006793 (phosphorus metabolic process), GO:1901334 (lactone metabolic process), GO:0016054 (organic acid catabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0097237 (cellular response to toxic substance), GO:0046185 (aldehyde catabolic process), GO:0006767 (water-soluble vitamin metabolic process), GO:0009110 (vitamin biosynthetic process), GO:0046364 (monosaccharide biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0016053 (organic acid biosynthetic process), GO:0018130 (heterocycle biosynthetic process), GO:0110096 (cellular response to aldehyde), GO:0016051 (carbohydrate biosynthetic process), GO:0090407 (organophosphate biosynthetic process), GO:0006796 (phosphate-containing compound metabolic process), GO:0019852 (L-ascorbic acid metabolic process), GO:1901137 (carbohydrate derivative biosynthetic process), GO:1901701 (cellular response to oxygen-containing compound), GO:0019752 (carboxylic acid metabolic process), GO:0042364 (water-soluble vitamin biosynthetic process), GO:1901336 (lactone biosynthetic process), GO:0046395 (carboxylic acid catabolic process), GO:0046394 (carboxylic acid biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process), GO:0072329 (monocarboxylic acid catabolic process), GO:0006063 (uronic acid metabolic process), GO:0019585 (glucuronate metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
P31037
Protein A49R
Plays a role in the inhibition of host NF-kappa-B activation. Interacts with host BTRC and thereby diminishes ubiquitination of NF- kappa-B inhibitor alpha/NFKBIA. This stabilizes NFKBIA and its interaction with NF-kappaB, so retaining p65/RELA in the cytoplasm and preventing NF-kappa-B-dependent gene expression
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain
162
Host cytoplasm. Host nucleus
MDEAYYSGNLESVLGYVSDMHTELASISQLVIAKIETIDNDILNKDIVNFIMCRSNLDNPFISFLDTVYTIIDQENYQTELINSLDDNEIIDCIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL
[ "GO:0007154", "GO:0007165", "GO:0008150", "GO:0009987", "GO:0023052", "GO:0035556", "GO:0035821", "GO:0038061", "GO:0044003", "GO:0044068", "GO:0044403", "GO:0044419", "GO:0050789", "GO:0050794", "GO:0050896", "GO:0051701", "GO:0051716", "GO:0052027", "GO:0052029", "GO:0065007"...
[ "GO:0007154", "GO:0007165", "GO:0008150", "GO:0009987", "GO:0023052", "GO:0035556", "GO:0035821", "GO:0038061", "GO:0044003", "GO:0044068", "GO:0044403", "GO:0044419", "GO:0050789", "GO:0050794", "GO:0050896", "GO:0051701", "GO:0051716", "GO:0052027", "GO:0052029", "GO:0065007"...
[ "GO:0003674", "GO:0140311", "GO:0140313" ]
[ "GO:0005575", "GO:0018995", "GO:0030430", "GO:0033643", "GO:0033646", "GO:0043656", "GO:0044217", "GO:0110165" ]
null
null
null
[ "IPR009473" ]
{"IPR009473": [1, 162]}
- IPR009473: Orthopoxvirus A49 (family) [1-162]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0016032 (viral process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0009605 (response to external stimulus), GO:0035821 (modulation of process of another organism), GO:0044068 (modulation by symbiont of host cellular process), GO:0019048 (modulation by virus of host process), GO:0044403 (biological process involved in symbiotic interaction), GO:0009607 (response to biotic stimulus), GO:0051707 (response to other organism), GO:0051701 (biological process involved in interaction with host), GO:0075136 (response to host), GO:0043207 (response to external biotic stimulus), GO:0052173 (response to defenses of other organism), GO:0019054 (modulation by virus of host cellular process), GO:0044003 (modulation by symbiont of host process), GO:0052200 (response to host defenses), GO:0019049 (mitigation of host antiviral defense response), GO:0030682 (mitigation of host defenses by symbiont) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0033643 (host cell part), GO:0043657 (host cell), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0033647 (host intracellular organelle), GO:0030430 (host cell cytoplasm), GO:0033648 (host intracellular membrane-bounded organelle), GO:0042025 (host cell nucleus)
Q01220
Protein A52
Bcl-2-like protein which targets host toll-like receptor signaling complexes to suppress innate immune response. Interacts with host TRAF6 to activate p38 and subsequently induce the expression of several cytokines such as IL-10. Also associates with host IRAK2 to inhibit NF-kappa-B signaling
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain
190
null
MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMFTILEEYFMYRGLLGLRIKYGRLFNEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYCLRAIKLFINDHMLDKIKSILQNRLVYVEMS
[ "GO:0007154", "GO:0007165", "GO:0007249", "GO:0008150", "GO:0009987", "GO:0023052", "GO:0035556", "GO:0035821", "GO:0038061", "GO:0044003", "GO:0044068", "GO:0044403", "GO:0044419", "GO:0050789", "GO:0050794", "GO:0050896", "GO:0051701", "GO:0051716", "GO:0052027", "GO:0052029"...
[ "GO:0007154", "GO:0007165", "GO:0007249", "GO:0008150", "GO:0009987", "GO:0023052", "GO:0035556", "GO:0035821", "GO:0038061", "GO:0044003", "GO:0044068", "GO:0044403", "GO:0044419", "GO:0050789", "GO:0050794", "GO:0050896", "GO:0051701", "GO:0051716", "GO:0052027", "GO:0052029"...
[]
[ "GO:0005575", "GO:0018995", "GO:0030430", "GO:0033643", "GO:0033646", "GO:0043656", "GO:0044217", "GO:0110165" ]
null
null
null
[ "IPR043018", "IPR022819" ]
{"IPR043018": [36, 190], "IPR022819": [20, 174]}
- IPR043018: Poxvirus domain superfamily (homologous_superfamily) [36-190] - IPR022819: Poxvirus Bcl-2-like (family) [20-174]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0034470 (ncRNA processing), GO:0034660 (ncRNA metabolic process), GO:0006399 (tRNA metabolic process), GO:0008033 (tRNA processing) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0033643 (host cell part), GO:0043657 (host cell), GO:0033644 (host cell membrane), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0033655 (host cell cytoplasm part), GO:0033647 (host intracellular organelle), GO:0020002 (host cell plasma membrane), GO:0030430 (host cell cytoplasm), GO:0033648 (host intracellular membrane-bounded organelle), GO:0044164 (host cell cytosol), GO:0042025 (host cell nucleus)
Q59RR0
Cell wall transcription factor ACE2
Transcription factor involved in the RAM (regulation of ACE2 transcription factor and polarized morphogenesis) signaling network that regulates polarized morphogenesis. Regulates expression of genes involved in cell separation such as CHT3, DSE1, and SCW11; or other cell wall genes such as ASH1, DSE4, PIR1, PRY2, and RME1. Required for regulation of morphogenesis, cell separation, adherence, biofilm formation, invasion, as well as virulence in a mouse model of infection
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
783
Nucleus. Note=Localized in the nuclei of daughter cells
MHWKFSNFRKYHLSFHLNLFDLSLFFISFYCFPILYICFFNQVHSFRSTQPSLIMNKFDLFDDYSTKGSTIPLPNENFDQLFLSSEANDMEFLFNETLMGLQDLDVPSGYGIPQNTINNDFQHTPNKSKSHSRQYSGTAIFGFADHNKDLSINGVNNDLCKQSNKAINTQSVSPGELLKRSRGSQTPTPTSALPDTAQDILDFNFEEKPILLLEEDELEEEKHKQQQRMMTQSSPLKRVTTPSQSPFVQQPQTMKQRKPHKKTNEYIVANENPNSYKFPPSPSPTAKRQQYPPSSPIPYNPKSDSVGGNSYSAKYLQSLNKTQQIEYVDDIEPLLQEDNNNMKYIPIPVQEPMSYQKQKPVTPPLQSQNDSQQLEPLKTPQPQPKQQQQQQQPNNEQDKEFTANFNFNTFLPPPTPPNLINGSPDWNSSPEPHSPSPGRLQPPQQISPIHQNLGAMGNNINFYTPMYYELPVQAEQPQPQPQPHQQQHQQQQHQPELQNTYQQIKHIQQQQQMLQHQFHNQNNQLRQQHPNQFQNQNQNQNQNQTKTPYSQQSQFSPTHSNFNLSPAKQLNSNVGSMHLSPLKKQLPNTPTKQPPVTIEWSPVISPNSKQPLHKQIKESSPRRRIKKTSLLPPGELDNYWTGPDEDKIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYSKCPCGKEFARLDALRKHQDRNICVGGNKNVISKPTKKKGTNNTQQQLLKTDTVVERIEKQLLQEDKSVTEEFLMLQ
[ "GO:0006355", "GO:0006357", "GO:0007155", "GO:0008150", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010564", "GO:0010570", "GO:0010604", "GO:0010810", "GO:0010811", "GO:0016043", "GO:0019219", "GO:0019222", "GO:0030155"...
[ "GO:0006355", "GO:0006357", "GO:0007155", "GO:0008150", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010564", "GO:0010570", "GO:0010604", "GO:0010810", "GO:0010811", "GO:0016043", "GO:0019219", "GO:0019222", "GO:0030155"...
[]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q59RR0-F1-model_v6.pdb
237561.Q59RR0
[ "Q5ACY4", "Q59U34", "Q5AP53", "Q5ABC6" ]
[ "IPR013087", "IPR036236" ]
{"IPR036236": [647, 701], "IPR013087": [649, 706]}
- Serine/threonine-protein kinase CBK1 - Cdh1p - CBK1 kinase activator protein MOB2 - Biofilm and cell wall regulator 1
- IPR013087: Zinc finger C2H2-type (domain) [649-706] - IPR036236: Zinc finger C2H2 superfamily (homologous_superfamily) [647-701]
Molecular Function (MF): GO:0003674 (molecular function), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0019222 (regulation of metabolic process), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:0050794 (regulation of cellular process), GO:0048522 (positive regulation of cellular process), GO:1900190 (regulation of single-species biofilm formation), GO:0030448 (hyphal growth), GO:0098630 (aggregation of unicellular organisms), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0030155 (regulation of cell adhesion), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0045785 (positive regulation of cell adhesion), GO:0090609 (single-species submerged biofilm formation), GO:0080090 (regulation of primary metabolic process), GO:0010811 (positive regulation of cell-substrate adhesion), GO:1900231 (regulation of single-species biofilm formation on inanimate substrate), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0010810 (regulation of cell-substrate adhesion), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0042710 (biofilm formation), GO:0051252 (regulation of RNA metabolic process), GO:0044011 (single-species biofilm formation on inanimate substrate), GO:0010468 (regulation of gene expression), GO:1900187 (regulation of cell adhesion involved in single-species biofilm formation), GO:0090605 (submerged biofilm formation), GO:2001141 (regulation of RNA biosynthetic process), GO:1900189 (positive regulation of cell adhesion involved in single-species biofilm formation), GO:0006355 (regulation of DNA-templated transcription), GO:0006357 (regulation of transcription by RNA polymerase II), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
P83773
Acetyl-CoA hydrolase
Presumably involved in regulating the intracellular acetyl- CoA pool for fatty acid and cholesterol synthesis and fatty acid oxidation
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
524
Cytoplasm
MSAILKQRVRYAPYLKKLRTGEQCIDLFKHGQYLGWSGFTGVGAPKVIPTTLVDHVEKNNLQGKLGFHLFVGASAGPEESRWAENNMILTRAPHQVGKPIAAAINDGRTQFFDKHLSMFPQDLTYGFYTKDKPNGSNLDYTIIEATAITEDGSIVPGPAVGASPEMISVSDKIIIEVNTKTPSFEGIHDIDMPVNPPFRQPYPHTSADFKIGKTAIPVDPEKVVAIVESTSGDKVPPNTPSDEQSRGIANHLIEFLEHEVKQGRLPANLHPLQSGIGNIANAVVEGLASSNFKNLTVWTEVLQDSFLDFFESGSLDYATATSIRLTNDGFKKFYDNWDTYSKKLCLRSQVVSNSPEIIRRLGVIAMNTPVEVDIYGHANSTNVMGSRMLNGLGGSADFLRNAKLSIMHTPSARPSKVDPTGLSCIVPMASHVDQTEHDLDVVVTEQGLADLRGLAPKARAKVIIDKCSHPDYKPQLQEYYDRSVFYATKKKTLHEPHILRDVFKMHLNFQENGTMKLDSWDQKF
[ "GO:0006082", "GO:0006083", "GO:0008150", "GO:0008152", "GO:0009268", "GO:0009628", "GO:0009987", "GO:0010446", "GO:0019752", "GO:0032787", "GO:0043436", "GO:0044281", "GO:0050896", "GO:0051716", "GO:0071214", "GO:0071467", "GO:0071469", "GO:0104004", "GO:0003674", "GO:0003824"...
[ "GO:0006082", "GO:0006083", "GO:0008150", "GO:0008152", "GO:0009268", "GO:0009628", "GO:0009987", "GO:0010446", "GO:0019752", "GO:0032787", "GO:0043436", "GO:0044281", "GO:0050896", "GO:0051716", "GO:0071214", "GO:0071467", "GO:0071469", "GO:0104004" ]
[ "GO:0003674", "GO:0003824", "GO:0003986", "GO:0016289", "GO:0016787", "GO:0016788", "GO:0016790", "GO:0160215" ]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005739", "GO:0005829", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-P83773-F1-model_v6.pdb
237561.P83773
[ "Q5AH20", "Q8NJN3", "Q59TC4", "A0A1D8PH52", "A0A1D8PSH3", "Q5AB86", "Q5AGX8", "A0A1D8PRR7", "Q9P8Q2", "A0A1D8PTB5", "A0A1D8PM94", "A0A1D8PSW6", "A0A1D8PIF8", "Q59XW4", "A0A1D8PH13", "Q59VG1", "A0A1D8PC76", "A0A1D8PGT5", "Q5A8X6", "A0A1D8PNQ8" ]
[ "IPR003702", "IPR038460", "IPR026888", "IPR037171", "IPR046433" ]
{"IPR037171": [6, 516], "IPR038460": [350, 496], "IPR046433": [2, 520], "IPR003702": [10, 228], "IPR026888": [329, 479]}
- Acetyl-coenzyme A synthetase 2 - Malate synthase - Acetyl-coenzyme A synthetase - Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial - Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial - Acetyl-CoA acetyltransferase - Aldehyde dehydrogenase (NAD(P)(+)) - Acetyltransferase component of pyruvate dehydrogenase complex - Acetyl-CoA carboxylase - Aldehyde dehydrogenase domain-containing protein
- IPR003702: Acetyl-CoA hydrolase/transferase, N-terminal (domain) [10-228] - IPR038460: Acetyl-CoA hydrolase/transferase, C-terminal domain superfamily (homologous_superfamily) [350-496] - IPR026888: Acetyl-CoA hydrolase/transferase, C-terminal domain (domain) [329-479] - IPR037171: NagB/RpiA transferase-like (homologous_superfamily) [6-516] - IPR046433: Acetyl-CoA hydrolase/transferase (family) [2-520]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016787 (hydrolase activity), GO:0016788 (hydrolase activity, acting on ester bonds), GO:0016782 (transferase activity, transferring sulphur-containing groups), GO:0008410 (CoA-transferase activity), GO:0016790 (thiolester hydrolase activity), GO:0016289 (CoA hydrolase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044238 (primary metabolic process), GO:0044255 (cellular lipid metabolic process), GO:0006629 (lipid metabolic process), GO:0019541 (propionate metabolic process), GO:0006082 (organic acid metabolic process), GO:0006631 (fatty acid metabolic process), GO:0019679 (propionate metabolic process, methylcitrate cycle), GO:0043436 (oxoacid metabolic process), GO:0019752 (carboxylic acid metabolic process), GO:0046459 (short-chain fatty acid metabolic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0009986 (cell surface), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0005618 (cell wall), GO:0009277 (fungal-type cell wall), GO:0030445 (yeast-form cell wall)
Q4V9P6
N6-Methyl-AMP deaminase
Catalyzes the hydrolysis of the free cytosolic methylated adenosine nucleotide N(6)-methyl-AMP (N6-mAMP) to produce inositol monophosphate (IMP) and methylamine. Is required for the catabolism of cytosolic N6-mAMP, which is derived from the degradation of mRNA containing N6-methylated adenine (m6A)
Danio rerio (Zebrafish) (Brachydanio rerio)
348
null
MDTEADLFYRQLPKVELHAHLNGSVSFETMEKLIKRKPHLNIEHSMTAIRRGQRRTLDECFQVFKVIHQLVDSEEDILMVAKSVIQEFAADGVKYLELRSTPREVTETGLSKQRYIETVLEAIRQCKQEGVDIDVRFLVAVDRRHGPEVAMQTVKLAEDFLLSSDGTVVGLDLSGDPTVGHGKDLLAALQKAKNCGLKLALHLSEVPSQIDETELLLNLPPDRIGHGTFLHPDVGGSDSLVDKVCKQNIPIEICLTSNVKGQTVPSYDKHHFKYWYNRGHPCVLCTDDKGVFCTDLSQEYQLAASTFGLTKEAVWILSQQAIGYTFAPEPIKQRLEKTWAELKQQILQ
[ "GO:0001654", "GO:0007275", "GO:0007423", "GO:0008150", "GO:0032501", "GO:0032502", "GO:0043010", "GO:0048513", "GO:0048731", "GO:0048856", "GO:0048880", "GO:0150063" ]
[ "GO:0001654", "GO:0007275", "GO:0007423", "GO:0008150", "GO:0032501", "GO:0032502", "GO:0043010", "GO:0048513", "GO:0048731", "GO:0048856", "GO:0048880", "GO:0150063" ]
[]
[]
AF-Q4V9P6-F1-model_v6.pdb
7955.ENSDARP00000067287
[ "A0A0G2KGL2", "Q6ZM69", "F8W4R3", "A0A0R4ISR7", "F1QG13" ]
[ "IPR006330", "IPR032466", "IPR001365" ]
{"IPR032466": [8, 342], "IPR006330": [9, 345], "IPR001365": [13, 336]}
- IPR006330: Adenosine/adenine deaminase (family) [9-345] - IPR032466: Metal-dependent hydrolase (homologous_superfamily) [8-342] - IPR001365: Adenosine deaminase domain (domain) [13-336]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0016810 (hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds), GO:0016814 (hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines), GO:0019239 (deaminase activity) Biological Process (BP): GO:0008150 (biological process), GO:0032502 (developmental process), GO:0002376 (immune system process), GO:0009987 (cellular process), GO:0032501 (multicellular organismal process), GO:0048869 (cellular developmental process), GO:0048856 (anatomical structure development), GO:0001775 (cell activation), GO:0045321 (leukocyte activation), GO:0048468 (cell development), GO:0030154 (cell differentiation), GO:0046649 (lymphocyte activation), GO:0030097 (hemopoiesis), GO:0002521 (leukocyte differentiation), GO:0030098 (lymphocyte differentiation), GO:1903131 (mononuclear cell differentiation) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005622 (intracellular anatomical structure)
P05552
Transcription factor Adf-1
May play an important role not only in the regulation of Adh expression but also in the transcription of other genes
Drosophila melanogaster (Fruit fly)
262
Nucleus
MHTLTAAIEMDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNKY
[ "GO:0006355", "GO:0006357", "GO:0008150", "GO:0009889", "GO:0010468", "GO:0010556", "GO:0019219", "GO:0019222", "GO:0050789", "GO:0050794", "GO:0051252", "GO:0060255", "GO:0065007", "GO:0080090", "GO:2001141", "GO:0000976", "GO:0000981", "GO:0001067", "GO:0003674", "GO:0003676"...
[ "GO:0006355", "GO:0006357", "GO:0008150", "GO:0009889", "GO:0010468", "GO:0010556", "GO:0019219", "GO:0019222", "GO:0050789", "GO:0050794", "GO:0051252", "GO:0060255", "GO:0065007", "GO:0080090", "GO:2001141" ]
[ "GO:0000976", "GO:0000981", "GO:0001067", "GO:0003674", "GO:0003676", "GO:0003677", "GO:0003690", "GO:0003700", "GO:0005488", "GO:0043565", "GO:0140110", "GO:1990837" ]
[]
AF-P05552-F1-model_v6.pdb
7227.FBpp0303284
[ "Q9VUH2" ]
[ "IPR039353", "IPR006578", "IPR004210" ]
{"IPR039353": [16, 260], "IPR006578": [24, 104], "IPR004210": [217, 256]}
- Transcription activator GAGA
- IPR039353: Transcription factor Adf-1 (family) [16-260] - IPR006578: MADF domain (domain) [24-104] - IPR004210: BESS motif (domain) [217-256]
Molecular Function (MF): GO:0003674 (molecular function), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0001216 (DNA-binding transcription activator activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0001228 (DNA-binding transcription activator activity, RNA polymerase II-specific) Biological Process (BP): GO:0008150 (biological process), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0032501 (multicellular organismal process), GO:0065007 (biological regulation), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0019222 (regulation of metabolic process), GO:0071840 (cellular component organization or biogenesis), GO:0003008 (system process), GO:0050793 (regulation of developmental process), GO:0048522 (positive regulation of cellular process), GO:0050794 (regulation of cellular process), GO:0009893 (positive regulation of metabolic process), GO:0007610 (behavior), GO:0050773 (regulation of dendrite development), GO:0044085 (cellular component biogenesis), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0048731 (system development), GO:0060255 (regulation of macromolecule metabolic process), GO:0009891 (positive regulation of biosynthetic process), GO:0031325 (positive regulation of cellular metabolic process), GO:0007611 (learning or memory), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0016043 (cellular component organization), GO:0031323 (regulation of cellular metabolic process), GO:0050877 (nervous system process), GO:0080090 (regulation of primary metabolic process), GO:0051128 (regulation of cellular component organization), GO:0051173 (positive regulation of nitrogen compound metabolic process), GO:0050890 (cognition), GO:0031344 (regulation of cell projection organization), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0010468 (regulation of gene expression), GO:0022607 (cellular component assembly), GO:0007613 (memory), GO:0010557 (positive regulation of macromolecule biosynthetic process), GO:0045935 (positive regulation of nucleobase-containing compound metabolic process), GO:0051254 (positive regulation of RNA metabolic process), GO:0007399 (nervous system development), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0051252 (regulation of RNA metabolic process), GO:0034330 (cell junction organization), GO:0031328 (positive regulation of cellular biosynthetic process), GO:0007416 (synapse assembly), GO:0120035 (regulation of plasma membrane bounded cell projection organization), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0034329 (cell junction assembly), GO:1902680 (positive regulation of RNA biosynthetic process), GO:0007616 (long-term memory), GO:0050808 (synapse organization), GO:0006357 (regulation of transcription by RNA polymerase II), GO:0045893 (positive regulation of DNA-templated transcription), GO:1903508 (positive regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription), GO:0010975 (regulation of neuron projection development), GO:0045944 (positive regulation of transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0098687 (chromosomal region), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0005705 (polytene chromosome interband), GO:0043228 (non-membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0005694 (chromosome), GO:0005634 (nucleus), GO:0005700 (polytene chromosome)
Q5AF56
Transcriptional regulator ADR1
Transcription factor involved in the regulation of hyphal growth
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,418
Nucleus
MISPTHQSQYLNYFVNPVLMTESGDIIDSVTGTTTTTANMSNTTIDAPTPASTTKNYKHKKQNTNTGTSMSPSNSINSTNNNAAAAAATTTTSKKSKDIPLELTAFGTTPSGKPRLFVCQVCTRAFARLEHLRRHERSHTKEKPFSCGVCQRKFSRRDLLLRHAQKLHAGCTDAITRLRRKSIKKSQDGDDDDDDDDDDEEMANSEDENDHDESGNASTKNGKKDKKDPPPEFNLNLFNSKQKPTKANTTKSKVAKLSTTTSRKNSTNPTRKNSSSLHKQVLDQRQKAAVNTKIVSSTKIVSGTNSGVSITPTRSRRGASFSAQSGANYAINIPEFNDIYPQSDNVEFSTPQFLPSSLDNEMTWLNNIPNIPGLSDSVSAANLMRQNSITNSADHVTPPVNVSQHGSFSHQSTFSATDMGQTRSESVNSLNTPFDGSYMMPTVTISNQEIQNGVAAHHHHQQQQQHQQHNHQHQPNQSSLGLSRNDMLSEDHYGYSFYDIPENILNFPMDSISTTSNAMSSGPIQNFKPLSPITQEIEHEITPRIDGRIGDFQNNNNTNDNPIHQNINYDLNFLHTIDDIGQDVISKFMPGGYSFYGDNNVSATSSANDYNSPNNIVSPSQQNNQFALHNQSSHPSGASPHLNQAMMNKMRLHNYSSNKLFTNHIRHMINKALGKYPISGIMTPTIPSNEKLEFYLSVFIQSFLAHLPFIHPSKLNEYEIMAMTGNEDINNESARVCLPLLTATMGALLANNKNDAEHLYEASRRTIHIYLESRKTNSTNDKNYKNGKDKSSSGNPLWLLQSLMLSVLYGLFSDNENNVYIVIRQLNALNSLVKTSIKNKGPIFFSNNGEDEELYNKLNSHDNGTSLFSNNLNDEMRYKNNINMQSQTRIVFIIYRLTNFLLMMYNVPLTFSINDINQLAVTSKDEETLWNFKNYQEFQEFSHKNNKTLDDYLNHKNEPIIFRELLLTVIKFGISDSNISPEIEKKVTHQLQNLCKYGFNCLVHGIYEIKQYQEMKEVDTFKVLDYLTKFYPTNDGLGFNCFRLPANKDLEKIDYALLVDFTKISSIIDLKLLKEQSWLKNYQDLTQNYHRLLDAHSTGNPLNSINDYDYLKLADCCISVLKLILFKVEDSNSNSRNRSKNDPTNEINNKLNNNNNNNNDMNNNNSNGDQLISAFDTDFGYLNMDNNGYAKKEEFSRFTDDELRYDKENTMSYFDKHIKLDIFEEVEKSSNLIQAQMLFHAFSVLSIFSVYVMRKNDNNSSPFANTDLIFELNHRYSMVLRLLERLETFLKLRYQTSAGGGGGGVNNNNNNALSIKLEQEFTNLYLYNGNVLSSDHNTNTNTTNTITTTTTTDNGTKQNQHHSQDFGLEKTLYILKMGENVLNYIYDLNLKVCVFKKLGDSLSEIRKYLIDNESTLNG
[ "GO:0006066", "GO:0006109", "GO:0006629", "GO:0006694", "GO:0006696", "GO:0006950", "GO:0006996", "GO:0007031", "GO:0008150", "GO:0008152", "GO:0008202", "GO:0008204", "GO:0008610", "GO:0009058", "GO:0009267", "GO:0009607", "GO:0009987", "GO:0016043", "GO:0016125", "GO:0016126"...
[ "GO:0006066", "GO:0006109", "GO:0006629", "GO:0006694", "GO:0006696", "GO:0006950", "GO:0006996", "GO:0007031", "GO:0008150", "GO:0008152", "GO:0008202", "GO:0008204", "GO:0008610", "GO:0009058", "GO:0009267", "GO:0009607", "GO:0009987", "GO:0016043", "GO:0016125", "GO:0016126"...
[ "GO:0001216", "GO:0003674", "GO:0003700", "GO:0140110" ]
[]
AF-Q5AF56-F1-model_v6.pdb
237561.Q5AF56
[ "A0A1D8PN61", "Q5A766" ]
[ "IPR013087", "IPR051059", "IPR036236" ]
{"IPR036236": [114, 163], "IPR051059": [98, 1403], "IPR013087": [117, 173]}
- DNA-binding transcription factor - Carbon catabolite-derepressing protein kinase
- IPR013087: Zinc finger C2H2-type (domain) [117-173] - IPR051059: Transcription factor verF-like (family) [98-1403] - IPR036236: Zinc finger C2H2 superfamily (homologous_superfamily) [114-163]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044249 (cellular biosynthetic process), GO:0006520 (amino acid metabolic process), GO:1901576 (organic substance biosynthetic process), GO:1901564 (organonitrogen compound metabolic process), GO:0044283 (small molecule biosynthetic process), GO:0006082 (organic acid metabolic process), GO:1901566 (organonitrogen compound biosynthetic process), GO:0008652 (amino acid biosynthetic process), GO:0016053 (organic acid biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:1901605 (alpha-amino acid metabolic process), GO:0019752 (carboxylic acid metabolic process), GO:0046394 (carboxylic acid biosynthetic process), GO:1901607 (alpha-amino acid biosynthetic process), GO:0009066 (aspartate family amino acid metabolic process), GO:0009067 (aspartate family amino acid biosynthetic process), GO:0006553 (lysine metabolic process), GO:0009085 (lysine biosynthetic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q9D1K7
Adipose-secreted signaling protein
Adipocyte-secreted protein (adipokine) that acts as a key regulator for white adipose tissue (WAT) thermogenesis and glucose homeostasis at least in part through activation of protein kinase A (PKA)
Mus musculus (Mouse)
174
Secreted
MAAANRGSKPRVRSIRFAAGHDAEGSQSHVHFDEKLHDSVVMVTQESDNSFLVKVGFLKILHRYEITFTLPPVRRLSKDIRETPVHSLHLKLLSVTPTSEGYSIKCEYSAHKEGVLKEEMLLACEGDIGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEQSDWLGFD
[ "GO:0008150", "GO:0008152", "GO:0009987", "GO:0033500", "GO:0042592", "GO:0042593", "GO:0048878", "GO:1990845", "GO:0005575", "GO:0005576", "GO:0005615", "GO:0110165" ]
[ "GO:0008150", "GO:0008152", "GO:0009987", "GO:0033500", "GO:0042592", "GO:0042593", "GO:0048878", "GO:1990845" ]
[]
[ "GO:0005575", "GO:0005576", "GO:0005615", "GO:0110165" ]
AF-Q9D1K7-F1-model_v6.pdb
10090.ENSMUSP00000028800
null
[ "IPR026794" ]
{"IPR026794": [1, 174]}
- IPR026794: Adipose-secreted signaling protein (family) [1-174]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding), GO:0019899 (enzyme binding), GO:0019902 (phosphatase binding), GO:0019903 (protein phosphatase binding), GO:0008157 (protein phosphatase 1 binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0023056 (positive regulation of signaling), GO:0048584 (positive regulation of response to stimulus), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0023051 (regulation of signaling), GO:0048522 (positive regulation of cellular process), GO:0090287 (regulation of cellular response to growth factor stimulus), GO:0009967 (positive regulation of signal transduction), GO:0010646 (regulation of cell communication), GO:1903846 (positive regulation of cellular response to transforming growth factor beta stimulus), GO:0009966 (regulation of signal transduction), GO:0010647 (positive regulation of cell communication), GO:0090100 (positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway), GO:0030511 (positive regulation of transforming growth factor beta receptor signaling pathway), GO:0090092 (regulation of transmembrane receptor protein serine/threonine kinase signaling pathway), GO:1902533 (positive regulation of intracellular signal transduction), GO:1903844 (regulation of cellular response to transforming growth factor beta stimulus), GO:1902531 (regulation of intracellular signal transduction), GO:1901224 (positive regulation of NIK/NF-kappaB signaling), GO:1901222 (regulation of NIK/NF-kappaB signaling), GO:0017015 (regulation of transforming growth factor beta receptor signaling pathway) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005829 (cytosol), GO:0005737 (cytoplasm), GO:0031974 (membrane-enclosed lumen), GO:0005654 (nucleoplasm), GO:0043233 (organelle lumen), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0070013 (intracellular organelle lumen), GO:0031981 (nuclear lumen), GO:0005634 (nucleus)
P37127
Putative oxidoreductase AegA
Involved in formate-dependent uric acid degradation under microaerobic and anaerobic conditions. May reduce the enzymes necessary for uric acid degradation
Escherichia coli (strain K12)
659
null
MNRFIMANSQQCLGCHACEIACVMAHNDEQHVLSQHHFHPRITVIKHQQQRSAVTCHHCEDAPCARSCPNGAISHVDDSIQVNQQKCIGCKSCVVACPFGTMQIVLTPVAAGKVKATAHKCDLCAGRENGPACVENCPADALQLVTDVALSGMAKSRRLRTARQEHQPWHASTAAQEMPVMSKVEQMQATPARGEPDKLAIEARKTGFDEIYLPFRADQAQREASRCLKCGEHSVCEWTCPLHNHIPQWIELVKAGNIDAAVELSHQTNTLPEITGRVCPQDRLCEGACTIRDEHGAVTIGNIERYISDQALAKGWRPDLSHVTKVDKRVAIIGAGPAGLACADVLTRNGVGVTVYDRHPEIGGLLTFGIPSFKLDKSLLARRREIFSAMGIHFELNCEVGKDVSLDSLLEQYDAVFVGVGTYRSMKAGLPNEDAPGVYDALPFLIANTKQVMGLEELPEEPFINTAGLNVVVLGGGDTAMDCVRTALRHGASNVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVALELNEQGHVCGIRFLRTRLGEPDAQGRRRPVPVEGSEFVMPADAVIMAFGFNPHGMPWLESHGVTVDKWGRIIADVESQYRYQTTNPKIFAGGDAVRGADLVVTAMAEGRHAAQGIIDWLGVKSVKSH
[ "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009987", "GO:0019628", "GO:0044281", "GO:0044282", "GO:0046415", "GO:0072521", "GO:0072523" ]
[ "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009987", "GO:0019628", "GO:0044281", "GO:0044282", "GO:0046415", "GO:0072521", "GO:0072523" ]
[]
[]
AF-P37127-F1-model_v6.pdb
511145.b2468
[ "Q2MAT2", "Q2M900", "P78239", "Q2M6M5" ]
[ "IPR006006", "IPR017900", "IPR009051", "IPR023753", "IPR017896", "IPR036188", "IPR028261" ]
{"IPR009051": [161, 326], "IPR036188": [327, 651], "IPR006006": [187, 653], "IPR017896": [54, 145], "IPR028261": [205, 315], "IPR023753": [329, 640], "IPR017900": [87, 98]}
- Glutamate synthase [NADPH] large chain - NAD-dependent dihydropyrimidine dehydrogenase subunit PreA - Formate dehydrogenase H - NADH-quinone oxidoreductase subunit F
- IPR006006: Glutamate synthase NADPH small chain-like (family) [187-653] - IPR017900: 4Fe-4S ferredoxin, iron-sulphur binding, conserved site (conserved_site) [87-98] - IPR009051: Alpha-helical ferredoxin (homologous_superfamily) [161-326] - IPR023753: FAD/NAD(P)-binding domain (domain) [329-640] - IPR017896: 4Fe-4S ferredoxin-type, iron-sulphur binding domain (domain) [54-145] - IPR036188: FAD/NAD(P)-binding domain superfamily (homologous_superfamily) [327-651] - IPR028261: Dihydroprymidine dehydrogenase domain II (domain) [205-315]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0005515 (protein binding), GO:0016491 (oxidoreductase activity), GO:0009055 (electron transfer activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0006091 (generation of precursor metabolites and energy), GO:0015980 (energy derivation by oxidation of organic compounds), GO:0045333 (cellular respiration), GO:0009061 (anaerobic respiration) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex), GO:1990204 (oxidoreductase complex)
Q8TGA2
Fatty acid synthase alpha subunit aflA
Fatty acid synthase alpha subunit; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the fungal fatty acid synthase aflA/aflB provides the hexanoyl starter unit to the acyl-carrier protein (ACP) domain of the norsolorinic acid synthase to allow the first step of the pathway. The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin (AVN) and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'- hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'- oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'-oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring-opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
1,671
null
MVIQGKRLAASSIQLLASSLDAKKLCYEYDERQAPGVTQITEEAPTEQPPLSTPPSLPQTPNISPISASKIVIDDVALSRVQIVQALVARKLKTAIAQLPTSKSIKELSGGRSSLQNELVGDIHNEFSSIPDAPEQILLRDFGDANPTVQLGKTSSAAVAKLISSKMPSDFNANAIRAHLANKWGLGPLRQTAVLLYAIASEPPSRLASSSAAEEYWDNVSSMYAESCGITLRPRQDTMNEDAMASSAIDPAVVAEFSKGHRRLGVQQFQALAEYLQIDLSGSQASQSDALVAELQQKVDLWTAEMTPEFLAGISPMLDVKKSRRYGSWWNMARQDVLAFYRRPSYSEFVDDALAFKVFLNRLCNRADEALLNMVRSLSCDAYFKQGSLPGYHAASRLLEQAITSTVADCPKARLILPAVGPHTTITKDGTIEYAEAPRQGVSGPTAYIQSLRQGASFIGLKSADVDTQSNLTDALLDAMCLALHNGISFVGKTFLVTGAGQGSIGAGVVRLLLEGGARVLVTTSREPATTSRYFQQMYDNHGAKFSELRVVPCNLASAQDCEGLIRHVYDPRGLNWDLDAILPFAAASDYSTEMHDIRGQSELGHRLMLVNVFRVLGHIVHCKRDAGVDCHPTQVLLPLSPNHGIFGGDGMYPESKLALESLFHRIRSESWSDQLSICGVRIGWTRSTGLMTAHDIIAETVEEHGIRTFSVAEMALNIAMLLTPDFVAHCEDGPLDADFTGSLGTLGSIPGFLAQLHQKVQLAAEVIRAVQAEDEHERFLSPGTKPTLQAPVAPMHPRSSLRVGYPRLPDYEQEIRPLSPRLERLQDPANAVVVVGYSELGPWGSARLRWEIESQGQWTSAGYVELAWLMNLIRHVNDESYVGWVDTQTGKPVRDGEIQALYGDHIDNHTGIRPIQSTSYNPERMEVLQEVAVEEDLPEFEVSQLTADAMRLRHGANVSIRPSGNPDACHVKLKRGAVILVPKTVPFVWGSCAGELPKGWTPAKYGIPENLIHQVDPVTLYTICCVAEAFYSAGITHPLEVFRHIHLSELGNFIGSSMGGPTKTRQLYRDVYFDHEIPSDVLQDTYLNTPAAWVNMLLLGCTGPIKTPVGACATGVESIDSGYESIMAGKTKMCLVGGYDDLQEEASYGFAQLKATVNVEEEIACGRQPSEMSRPMAESRAGFVEAHGCGVQLLCRGDIALQMGLPIYAVIASSAMAADKIGSSVPAPGQGILSFSRERARSSMISVTSRPSSRSSTSSEVSDKSSLTSITSISNPAPRAQRARSTTDMAPLRAALATWGLTIDDLDVASLHGTSTRGNDLNEPEVIETQMRHLGRTPGRPLWAICQKSVTGHPKAPAAAWMLNGCLQVLDSGLVPGNRNLDTLDEALRSASHLCFPTRTVQLREVKAFLLTSFGFGQKGGQVVGVAPKYFFATLPRPEVEGYYRKVRVRTEAGDRAYAAAVMSQAVVKIQTQNPYDEPDAPRIFLDPLARISQDPSTGQYRFRSDATPALDDDALPPPGEPTELVKGISSAWIEEKVRPHMSPGGTVGVDLVPLASFDAYKNAIFVERNYTVRERDWAEKSADVRAAYASRWCAKEAVFKCLQTHSQGAGAAMKEIEIEHGGNGAPKVKLRGAAQTAARQRGLEGVQLSISYGDDAVIAVALGLMSGAS
[ "GO:0005575", "GO:0005835", "GO:0032991", "GO:0140535", "GO:1902494", "GO:1990234" ]
[]
[]
[ "GO:0005575", "GO:0005835", "GO:0032991", "GO:0140535", "GO:1902494", "GO:1990234" ]
AF-Q8TGA2-F1-model_v6.pdb
1403190.Q8TGA2
[ "A0A0F0IGH1", "A0A0F0HZD0", "A0A0F0IN54", "A0A0F0I3U8", "A0A0F0ILF1", "A0A0F0IHY3", "A0A0F0I549", "A0A0F0I494", "A0A0F0IK72", "A0A0F0HZA4", "A0A0F0III1", "Q8TGA1", "A0A0F0ILA6" ]
[ "IPR036291", "IPR040899", "IPR008278", "IPR020841", "IPR018201", "IPR016039", "IPR009081", "IPR047224", "IPR037143", "IPR026025", "IPR050830", "IPR041550", "IPR014030", "IPR004568", "IPR014031", "IPR013968" ]
{"IPR036291": [492, 729], "IPR016039": [794, 1515], "IPR037143": [1547, 1665], "IPR026025": [10, 1666], "IPR050830": [25, 1493], "IPR040899": [74, 232], "IPR009081": [75, 153], "IPR041550": [259, 456], "IPR013968": [494, 569], "IPR020841": [833, 1428], "IPR047224": [994, 1425], "IPR014030": [1002, 1198], "IPR014031": [1275, 1382], "IPR004568": [1548, 1663], "IPR008278": [1549, 1642], "IPR018201": [1104, 1120]}
- Fatty acid synthase beta subunit aflB - Acyl transferase domain protein - Malonyl-CoA:ACP transacylase (MAT) domain-containing protein - Acyl transferase domain protein - Acetyl-CoA carboxylase central region - Fatty acid synthase subunit alpha - Ketosynthase family 3 (KS3) domain-containing protein - Beta-ketoacyl synthase C-terminal domain protein - Eukaryotic long-chain fatty acid CoA synthetase LC-FACS - Fatty acid synthase subunit alpha
- IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [492-729] - IPR040899: Fatty acid synthase subunit alpha, acyl carrier domain (domain) [74-232] - IPR008278: 4'-phosphopantetheinyl transferase domain (domain) [1549-1642] - IPR020841: Polyketide synthase, beta-ketoacyl synthase domain (domain) [833-1428] - IPR018201: Beta-ketoacyl synthase, active site (active_site) [1104-1120] - IPR016039: Thiolase-like (homologous_superfamily) [794-1515] - IPR009081: Phosphopantetheine binding ACP domain (domain) [75-153] - IPR047224: Fatty acid synthase subunit alpha-like, C-terminal (domain) [994-1425] - IPR037143: 4'-phosphopantetheinyl transferase domain superfamily (homologous_superfamily) [1547-1665] - IPR026025: Fatty acid synthase alpha subunit, yeast (family) [10-1666] - IPR050830: Fungal fatty acid synthase (family) [25-1493] - IPR041550: Fatty acid synthase type I, helical (domain) [259-456] - IPR014030: Beta-ketoacyl synthase-like, N-terminal (domain) [1002-1198] - IPR004568: Phosphopantetheine-protein transferase domain (domain) [1548-1663] - IPR014031: Beta-ketoacyl synthase, C-terminal (domain) [1275-1382] - IPR013968: Polyketide synthase-like, ketoreductase domain (domain) [494-569]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016746 (acyltransferase activity), GO:0016747 (acyltransferase activity, transferring groups other than amino-acyl groups), GO:0004312 (fatty acid synthase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0032991 (protein-containing complex), GO:0005829 (cytosol), GO:1902494 (catalytic complex), GO:0005622 (intracellular anatomical structure), GO:0005737 (cytoplasm), GO:0140535 (intracellular protein-containing complex)
Q8TGA1
Fatty acid synthase beta subunit aflB
Fatty acid synthase beta subunit; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the fungal fatty acid synthase aflA/aflB provides the hexanoyl starter unit to the acyl-carrier protein (ACP) domain of the norsolorinic acid synthase to allow the first step of the pathway. The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin (AVN) and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'-hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'-oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'- oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring- opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
1,888
null
MGSVSREHESIPIQAAQRGAARICAAFGGQGSNNLDVLKGLLELYKRYGPDLDELLDVASNTLSQLASSPAAIDVHEPWGFDLRQWLTTPEVAPSKEILALPPRSFPLNTLLSLALYCATCRELELDPGQFRSLLHSSTGHSQGILAAVAITQAESWPTFYDACRTVLQISFWIGLEAYLFTPSSAASDAMIQDCIEHGEGLLSSMLSVSGLSRSQVERVIEHVNKGLGECNRWVHLALVNSHEKFVLAGPPQSLWAVCLHVRRIRADNDLDQSRILFRNRKPIVDILFLPISAPFHTPYLDGVQDRVIEALSSASLALHSIKIPLYHTGTGSNLQELQPHQLIPTLIRAITVDQLDWPLVCRGLNATHVLDFGPGQTCSLIQELTQGTGVSVIQLTTQSGPKPVGGHLAAVNWEAEFGLRLHANVHGAAKLHNRMTTLLGKPPVMVAGMTPTTVRWDFVAAVAQAGYHVELAGGGYHAERQFEAEIRRLATAIPADHGITCNLLYAKPTTFSWQISVIKDLVRQGVPVEGITIGAGIPSPEVVQECVQSIGLKHISFKPGSFEAIHQVIQIARTHPNFLIGLQWTAGRGGGHHSWEDFHGPILATYAQIRSCPNILLVVGSGFGGGPDTFPYLTGQWAQAFGYPCMPFDGVLLGSRMMVAREAHTSAQAKRLIIDAQGVGDADWHKSFDEPTGGVVTVNSEFGQPIHVLATRGVMLWKELDNRVFSIKDTSKRLEYLRNHRQEIVSRLNADFARPWFAVDGHGQNVELEDMTYLEVLRRLCDLTYVSHQKRWVDPSYRILLLDFVHLLRERFQCAIDNPGEYPLDIIVRVEESLKDKAYRTLYPEDVSLLMHLFSRRDIKPVPFIPRLDERFETWFKKDSLWQSEDVEAVIGQDVQRIFIIQGPMAVQYSISDDESVKDILHNICNHYVEALQADSRETSIGDVHSITQKPLSAFPGLKVTTNRVQGLYKFEKVGAVPEMDVLFEHIVGLSKSWARTCLMSKSVFRDGSRLHNPIRAALQLQRGDTIEVLLTADSEIRKIRLISPTGDGGSTSKVVLEIVSNDGQRVFATLAPNIPLSPEPSVVFCFKVDQKPNEWTLEEDASGRAERIKALYMSLWNLGFPNKASVLGLNSQFTGEELMITTDKIRDFERVLRQTSPLQLQSWNPQGCVPIDYCVVIAWSALTKPLMVSSLKCDLLDLLHSAISFHYAPSVKPLRVGDIVKTSSRILAVSVRPRGTMLTVSADIQRQGQHVVTVKSDFFLGGPVLACETPFELTEEPEMVVHVDSEVRRAILHSRKWLMREDRALDLLGRQLLFRLKSEKLFRPDGQLALLQVTGSVFSYSPDGSTTAFGRVYFESESCTGNVVMDFLHRYGAPRAQLLELQHPGWTGTSTVAVRGPRRSQSYARVSLDHNPIHVCPAFARYAGLSGPIVHGMETSAMMRRIAEWAIGDADRSRFRSWHITLQAPVHPNDPLRVELQHKAMEDGEMVLKVQAFNERTEERVAEADAHVEQETTAYVFCGQGSQRQGMGMDLYVNCPEAKALWARADKHLWEKYGFSILHIVQNNPPALTVHFGSQRGRRIRANYLRMMGQPPIDGRHPPILKGLTRNSTSYTFSYSQGLLMSTQFAQPALALMEMAQFEWLKAQGVVQKGARFAGHSLGEYAALGACASFLSFEDLISLIFYRGLKMQNALPRDANGHTDYGMLAADPSRIGKGFEEASLKCLVHIIQQETGWFVEVVNYNINSQQYVCAGHFRALWMLGKICDDLSCHPQPETVEGQELRAMVWKHVPTVEQVPREDRMERGRATIPLPGIDIPYHSTMLRGEIEPYREYLSERIKVGDVKPCELVGRWIPNVVGQPFSVDKSYVQLVHGITGSPRLHSLLQQMA
[ "GO:0005575", "GO:0005835", "GO:0032991", "GO:0140535", "GO:1902494", "GO:1990234" ]
[]
[]
[ "GO:0005575", "GO:0005835", "GO:0032991", "GO:0140535", "GO:1902494", "GO:1990234" ]
AF-Q8TGA1-F1-model_v6.pdb
1403190.Q8TGA1
[ "A0A0F0IN54", "Q8TGA2", "A0A0F0I3U8", "A0A0F0ILF1", "A0A0F0IGH1", "A0A0F0HZD0", "A0A0F0I2A0", "A0A0F0III1", "A0A0F0ILA6", "A0A0F0IHY3", "A0A0F0IK72", "A0A0F0I494", "A0A0F0HZA4" ]
[ "IPR001227", "IPR013565", "IPR029069", "IPR039569", "IPR040883", "IPR016452", "IPR003965", "IPR050830", "IPR002539", "IPR013785", "IPR014043", "IPR032088", "IPR016035" ]
{"IPR001227": [10, 1706], "IPR016035": [23, 1862], "IPR013785": [412, 695], "IPR029069": [1166, 1510], "IPR016452": [4, 1887], "IPR050830": [16, 1887], "IPR032088": [27, 257], "IPR003965": [434, 1704], "IPR013565": [581, 922], "IPR040883": [977, 1118], "IPR039569": [1134, 1255], "IPR002539": [1399, 1500], "IPR014043": [1517, 1877]}
- Fatty acid synthase subunit alpha - Fatty acid synthase alpha subunit aflA - Fatty acid synthase subunit alpha - Ketosynthase family 3 (KS3) domain-containing protein - Beta-ketoacyl synthase C-terminal domain protein - Acetyl-CoA carboxylase central region - Acyl transferase domain protein - Malonyl-CoA:ACP transacylase (MAT) domain-containing protein - Eukaryotic long-chain fatty acid CoA synthetase LC-FACS - Acyl transferase domain protein
- IPR001227: Acyl transferase domain superfamily (homologous_superfamily) [10-1706] - IPR013565: Fatty acid synthase beta subunit AflB /Fas1-like, central domain (domain) [581-922] - IPR029069: HotDog domain superfamily (homologous_superfamily) [1166-1510] - IPR039569: FAS1-like, dehydratase domain region (domain) [1134-1255] - IPR040883: Fatty acid synthase, meander beta sheet domain (domain) [977-1118] - IPR016452: Fatty acid synthase beta subunit AflB /Fas1-like, fungi (family) [4-1887] - IPR003965: Fatty acid synthase (domain) [434-1704] - IPR050830: Fungal fatty acid synthase (family) [16-1887] - IPR002539: MaoC-like dehydratase domain (domain) [1399-1500] - IPR013785: Aldolase-type TIM barrel (homologous_superfamily) [412-695] - IPR014043: Acyl transferase domain (domain) [1517-1877] - IPR032088: Starter unit:ACP transacylase, SAT domain (domain) [27-257] - IPR016035: Acyl transferase/acyl hydrolase/lysophospholipase (homologous_superfamily) [23-1862]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016491 (oxidoreductase activity), GO:0016746 (acyltransferase activity), GO:0016627 (oxidoreductase activity, acting on the CH-CH group of donors), GO:0016747 (acyltransferase activity, transferring groups other than amino-acyl groups), GO:0016628 (oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex)
Q00278
Norsolorinic acid ketoreductase
Norsolorinic acid ketoreductase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the norsolorinic acid ketoreductase aflD performs the second step by catalyzing the dehydration of norsolorinic acid (NOR) to form (1'S)- averantin (AVN). The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'-hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'-oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'- oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring- opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
271
Cytoplasm, cytosol. Vacuole
MNGSLSQHDQERLSTPYRDGPPEETVYLVTGASRGIGRGLIEAFLQRPKSTVVAWLRNVRTATPALSALTVAEGSRMIIVQLNSDSETDAQAAVQTLREEHGVTHLDVVVANAAMATNFGPASTMPLEHLQAHMMVNMYAPVLLFQATRLMLQQSKQQAKFVLIGAPISTITNMHDYSRAPLTAYGVSKLAANYMVRKFHFENKWLTAFIIDPGHVQTDMGDQGARLMGRPQAPTTVADSVAGICARIDEATKETTSGHFVIHTDGSQLPW
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005773", "GO:0005775", "GO:0031974", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0043233", "GO:0070013", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005773", "GO:0005775", "GO:0031974", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0043233", "GO:0070013", "GO:0110165" ]
AF-Q00278-F1-model_v6.pdb
1403190.Q00278
null
[ "IPR036291", "IPR051468", "IPR002347" ]
{"IPR036291": [26, 271], "IPR002347": [26, 247], "IPR051468": [27, 271]}
- IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [26-271] - IPR051468: Fungal Secondary Metabolite SDRs (family) [27-271] - IPR002347: Short-chain dehydrogenase/reductase SDR (family) [26-247]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
Q12732
Averantin hydroxylase
Averantin hydroxylase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the cytochrome P450 monooxygenase aflG catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'-hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'-oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'- oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring- opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
495
Membrane; Single-pass membrane protein
MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRGNLVRDLQRLHQQFGPVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRHERSLIERSIDLLITQLHENCGQGPLDLALWFNWATFDIIGDLAFGDSFGCLENVQTHPWIASIQGNVKLIPILNAFRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPPMTRDEMISNASAIVLAGSETSATLLSGCTWLLLKNPSHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAVLEESLRLYPPVPMQSNRIVPQAGAYIAGGWVPGGTSVGLQQFVACRSSSNFHRPDEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVEMRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKKPLWVTLEPRNE
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016705", "GO:0140395" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016705", "GO:0140395" ]
[]
AF-Q12732-F1-model_v6.pdb
1403190.Q12732
[ "A0A0F0IM89", "P87017" ]
[ "IPR050121", "IPR017972", "IPR001128", "IPR002401", "IPR036396" ]
{"IPR036396": [29, 495], "IPR050121": [13, 466], "IPR001128": [40, 469], "IPR002401": [69, 459], "IPR017972": [429, 438]}
- Short chain dehydrogenase - 5'-hydroxyaverantin dehydrogenase
- IPR050121: Cytochrome P450 monooxygenase (family) [13-466] - IPR017972: Cytochrome P450, conserved site (conserved_site) [429-438] - IPR001128: Cytochrome P450 (family) [40-469] - IPR002401: Cytochrome P450, E-class, group I (family) [69-459] - IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [29-495]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0031984 (organelle subcompartment), GO:0042175 (nuclear outer membrane-endoplasmic reticulum membrane network), GO:0031090 (organelle membrane), GO:0005783 (endoplasmic reticulum), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0098827 (endoplasmic reticulum subcompartment), GO:0043231 (intracellular membrane-bounded organelle), GO:0005789 (endoplasmic reticulum membrane)
P87017
5'-hydroxyaverantin dehydrogenase
5'-hydroxyaverantin dehydrogenase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the 5'-hydroxyaverantin dehydrogenase aflH transforms 5'hydroxyaverantin (HAVN) to 5'-oxoaverantin (OAVN). The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'-hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'-oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'- oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring- opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
278
Cytoplasm, cytosol
MEVLDTTVDLGTLQGKSALITGGASGIGLATARAWAAAGMYVTIADIQPLETGQNILADLAGGHVHYVCCDVTSWESQITAFKEAIQFTPSKALDIVAAFAGVSFAGGNQVDHVLAAGDPRLDVNPSPPDIRNIQVNLIGVYYTSWLGLYYLRLSPTNKAANPSPDKSLILMGSIGSYMDSPKASTYPASKFGVRGLFRSTRARTRELGVRCNLLAPWFIDTPLIAPMKKAMAARGIDMAQRLTFASVDACVEAATTCAANPQLHGTPPIRYAYCLKT
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0110165" ]
AF-P87017-F1-model_v6.pdb
1403190.P87017
[ "Q12062", "Q12732" ]
[ "IPR036291", "IPR020904", "IPR002347" ]
{"IPR036291": [12, 265], "IPR002347": [16, 229], "IPR020904": [174, 202]}
- Versicolorin B synthase - Averantin hydroxylase
- IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [12-265] - IPR020904: Short-chain dehydrogenase/reductase, conserved site (conserved_site) [174-202] - IPR002347: Short-chain dehydrogenase/reductase SDR (family) [16-229]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0005515 (protein binding), GO:0016491 (oxidoreductase activity), GO:0042802 (identical protein binding), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0046983 (protein dimerization activity), GO:0042803 (protein homodimerization activity), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
Q12437
Averufin oxidase A
Averufin oxidase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the averufin oxidase aflI catalyzes the conversion of averufin (AVF) to versiconal hemiacetal acetate (VHA). The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'- hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'- oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'-oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring-opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
285
Membrane; Single-pass membrane protein
MVTYALLGATGATGSSILRHLLQKSPDSLHIQVLVRSKVKLLQAFPDLETTRRPQVHVIQGMSTDSDALSECLRNASIVFMCVAQNGSPIGTTLCQDSARPIISVLQQQQQSEGASYQPCTIVQLRSASLNPALAAQVPAFVHRIVSFCLFANYADIKQACQYYSEAQKQGTLEYILVDPPTLHDANGTHPTGYRLISTEPQATALSYADLGAAMCEIAHRESEFHGRAVGVTATGRVRQTWGVLLRHLLEGGSSRLRETIAKEAVVVRVLCIFLVILACLMSSL
[ "GO:0003674", "GO:0003824", "GO:0016491" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0016491" ]
[]
AF-Q12437-F1-model_v6.pdb
1403190.Q12437
null
[ "IPR036291", "IPR051606", "IPR016040" ]
{"IPR036291": [3, 232], "IPR051606": [3, 234], "IPR016040": [8, 220]}
- IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [3-232] - IPR051606: Polyketide Oxidoreductase-like (family) [3-234] - IPR016040: NAD(P)-binding domain (domain) [8-220]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0031975 (envelope), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0031090 (organelle membrane), GO:0031967 (organelle envelope), GO:0005739 (mitochondrion), GO:0005783 (endoplasmic reticulum), GO:0005635 (nuclear envelope), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0009536 (plastid), GO:0043228 (non-membrane-bounded organelle), GO:0009526 (plastid envelope), GO:0042170 (plastid membrane), GO:0010646 (regulation of cell communication), GO:0043231 (intracellular membrane-bounded organelle), GO:0031976 (plastid thylakoid), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0009941 (chloroplast envelope), GO:0005811 (lipid droplet)
Q9UW95
Versicolorin B desaturase
Versicolorin B desaturase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the versicolorin B desaturase aflL catalyzes the conversion of versicolorin B (VERB) to versicolorin A (VERA). The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'- hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'- oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'-oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring-opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
500
Membrane; Single-pass membrane protein
MYFLSLPSLVIVIPVGYLLFHLGYNLFFHPLRGYPGPLLWRASSLPWKIALLRGTMHHDLMRFHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLREVADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDNQRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPEDIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPASGATVCGRFVPEETRVGVSHLATYFADYNFTHADKFIPERHLQKTEEPFKYDNYGAYQPWSVGLRNCIGRNLAYAEVRLTLAKLLWHFDFTLDVDKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSSPQ
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016705", "GO:0016717", "GO:0140398" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016705", "GO:0016717", "GO:0140398" ]
[]
AF-Q9UW95-F1-model_v6.pdb
1403190.Q9UW95
null
[ "IPR050121", "IPR017972", "IPR001128", "IPR002401", "IPR036396" ]
{"IPR036396": [24, 497], "IPR050121": [7, 465], "IPR001128": [38, 468], "IPR002401": [177, 461], "IPR017972": [431, 440]}
- IPR050121: Cytochrome P450 monooxygenase (family) [7-465] - IPR017972: Cytochrome P450, conserved site (conserved_site) [431-440] - IPR001128: Cytochrome P450 (family) [38-468] - IPR002401: Cytochrome P450, E-class, group I (family) [177-461] - IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [24-497]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
P50161
Versicolorin reductase 1
Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, with the cytochrome P450 monooxygenase aflN, the versicolorin reductase aflM, is involved in conversion of VERA to demethylsterigmatocystin (DMST). The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'- hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'- oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'-oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring-opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
262
Cytoplasm, cytosol
MSDNHRLDGKVALVTGAGRGIGAAIAVALGERGAKVVVNYAHSREAAEKVVEQIKANGTDAIAIQADVGDPEATAKLMAETVRHFGYLDIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREGGRIILTSSNTACVKGVPKHAVYSGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTDMFLAVSREYIPNGETFTDEQVDECAAWLSPLNRVGLPVDVARVVSFLASDTAEWVSGKIIGVDGGAFR
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016614", "GO:0042469", "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0110165" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016614", "GO:0042469" ]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0110165" ]
AF-P50161-F1-model_v6.pdb
1403190.P50161
[ "Q6UEF2" ]
[ "IPR036291", "IPR020904", "IPR002347", "IPR057326" ]
{"IPR036291": [8, 260], "IPR002347": [11, 259], "IPR057326": [10, 194], "IPR020904": [145, 173]}
- Oxidoreductase aflX
- IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [8-260] - IPR020904: Short-chain dehydrogenase/reductase, conserved site (conserved_site) [145-173] - IPR002347: Short-chain dehydrogenase/reductase SDR (family) [11-259] - IPR057326: Ketoreductase domain (domain) [10-194]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex)
Q12120
Sterigmatocystin 8-O-methyltransferase
Sterigmatocystin 8-O-methyltransferase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the O-methyltransferase aflP uses both sterigmatocystin (ST) and dihydrosterigmatocystin (DHST) as substrates to yield O- methylsterigmatocystin (OMST) and dihydro-O-methylsterigmatocystin (DHOMST), respectively. The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'-hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'-oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'- oxoaverantin cyclase that mediates conversion of 5'-oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA- binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring-opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
418
Cytoplasm. Vacuole
MALPSKAALVGLANTLSEQVKRYLATAGETKSPEDHKLCIESERTPSSNEHAQAWEIVRTCDRIGSLVHGPVPWLLSNALSHLDSACLAAATHLNLQDIIVDGPSPTSLDTIVAATGVSEDLLRRILRGCAQRFIFEEVAPDQYAHTDASKMLRVTGIHALVGFSCDEVMRSGASFSDFLQQTKGKPPSWNVPSPFSLAFDPTKGLFDYYSTVDEVRGRRFDLGMGGTEATKPLVEEMFDFSSLPEGSTVVDVGGGRGHLSRRVSQKHPHLRFIVQDLPAVIHGVEDTDKVTMMEHDIRRPNPVRGADVYLLRSILHDYPDAACVEILSNIVTAMDPSKSRILLDEMIMPDLLAQDSQRFMNQIDMTVVLTLNGKERSTKEWNSLITTVDGRLETEKIWWRKGEEGSHWGVQQLRLRK
[ "GO:0003674", "GO:0003824", "GO:0008168", "GO:0008171", "GO:0016740", "GO:0016741", "GO:0047146", "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0110165" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0008168", "GO:0008171", "GO:0016740", "GO:0016741", "GO:0047146" ]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0110165" ]
AF-Q12120-F1-model_v6.pdb
1403190.Q12120
[ "Q6UEG8", "Q9UQY0", "A0A0F0IBA6", "A0A0F0IG46", "O13345" ]
[ "IPR016461", "IPR036388", "IPR012967", "IPR036390", "IPR001077", "IPR029063" ]
{"IPR036390": [65, 154], "IPR036388": [71, 153], "IPR029063": [158, 404], "IPR016461": [76, 415], "IPR012967": [80, 153], "IPR001077": [206, 387]}
- O-methylsterigmatocystin oxidoreductase - Demethylsterigmatocystin 6-O-methyltransferase - O-methyltransferase - O-methyltransferase - Aflatoxin biosynthesis regulatory protein
- IPR016461: O-methyltransferase-like (family) [76-415] - IPR036388: Winged helix-like DNA-binding domain superfamily (homologous_superfamily) [71-153] - IPR012967: O-methyltransferase, dimerisation domain (domain) [80-153] - IPR036390: Winged helix DNA-binding domain superfamily (homologous_superfamily) [65-154] - IPR001077: O-methyltransferase, C-terminal domain (domain) [206-387] - IPR029063: S-adenosyl-L-methionine-dependent methyltransferase superfamily (homologous_superfamily) [158-404]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016741 (transferase activity, transferring one-carbon groups), GO:0008168 (methyltransferase activity), GO:0008171 (O-methyltransferase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005622 (intracellular anatomical structure)
O13345
O-methylsterigmatocystin oxidoreductase
O-methylsterigmatocystin oxidoreductase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), aflatoxin G1 (AFG1) and aflatoxin G2 (AFG2). Within the aflatoxin pathway, the O-methylsterigmatocystin oxidoreductase aflQ is involved in the last steps in which OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2. The biosynthesis of aflatoxins begins with the norsolorinic acid synthase aflC that combines a hexanoyl starter unit produced by the fatty acid synthase aflA/aflB and 7 malonyl-CoA extender units to synthesize the precursor NOR. The second step is the conversion of NOR to averantin and requires the norsolorinic acid ketoreductase aflD, which catalyzes the dehydration of norsolorinic acid to form (1'S)-averantin. The norsolorinic acid reductases aflE and aflF may also play a role in the conversion of NOR to AVN. The cytochrome P450 monooxygenase aflG then catalyzes the hydroxylation of AVN to 5'hydroxyaverantin (HAVN). The next step is performed by the 5'-hydroxyaverantin dehydrogenase aflH that transforms HAVN to 5'-oxoaverantin (OAVN) which is further converted to averufin (AVF) by aflK that plays a dual role in the pathway, as a 5'-oxoaverantin cyclase that mediates conversion of 5'- oxoaverantin, as well as a versicolorin B synthase in a later step in the pathway. The averufin oxidase aflI catalyzes the conversion of AVF to versiconal hemiacetal acetate (VHA). VHA is then the substrate for the versiconal hemiacetal acetate esterase aflJ to yield versiconal (VAL). Versicolorin B synthase aflK then converts VAL to versicolorin B (VERB) by closing the bisfuran ring of aflatoxin which is required for DNA-binding, thus giving to aflatoxin its activity as a mutagen. Then, the activity of the versicolorin B desaturase aflL leads to versicolorin A (VERA). A branch point starts from VERB since it can also be converted to dihydrodemethylsterigmatocystin (DMDHST), probably also by aflL, VERA being a precursor for aflatoxins B1 and G1, and DMDHST for aflatoxins B2 and G2. Next, the versicolorin reductase aflM and the cytochrome P450 monooxygenase aflN are involved in conversion of VERA to demethylsterigmatocystin (DMST). AflX and aflY seem also involved in this step, through probable aflX-mediated epoxide ring- opening step following versicolorin A oxidation and aflY-mediated Baeyer-Villiger oxidation required for the formation of the xanthone ring. The methyltransferase aflO then leads to the modification of DMST to sterigmatocystin (ST), and of DMDHST to dihydrosterigmatocystin (DHST). Both ST and DHST are then substrates of the O-methyltransferase aflP to yield O-methylsterigmatocystin (OMST) and dihydro-O- methylsterigmatocystin (DHOMST), respectively. Finally OMST is converted to aflatoxins B1 and G1, and DHOMST to aflatoxins B2 and G2, via the action of several enzymes including O-methylsterigmatocystin oxidoreductase aflQ, the cytochrome P450 monooxygenase aflU, but also the NADH-dependent flavin oxidoreductase nadA which is specifically required for the synthesis of AFG1
Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
528
null
MIYSIIICAGALLGFLILQKLLAPKDTRPPLPPGPWRKPIIGNLTDFPPKGTPEWLFWAKHHERYGPMSSLEVMGQTIIMINDAHLGIEIMHKKSALSQMIPDAPFAHMAGWGMSLATERNKQAWKTIRANMKQEIGTRRAIATFHPKMEIGIRRFLLRTLDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHIFSPGEWSVNFFPILRYVPSWFPGASFQIKAAEYKRTIERMTMVPYLWIKDQVARGCTRPSILLRLLQKGHYESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSFFVAMALYPEVQHQAREELDRVVGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLLPNIWTFTHDPSVYHDPMVFKPERFLERQSSPPETDPMKFVFGFGRRICPGRFVTDEKLFLIACHAISCFLISPKDPGAPEPDWLPGVISQPGPFDLNVVPRSPAHEELIRSIETDHPWKNADATDISQFMARNQMI
[ "GO:0003674", "GO:0003824", "GO:0004497", "GO:0016491" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0004497", "GO:0016491" ]
[]
AF-O13345-F1-model_v6.pdb
1403190.O13345
[ "Q12120" ]
[ "IPR017972", "IPR001128", "IPR002401", "IPR050364", "IPR036396" ]
{"IPR036396": [23, 496], "IPR050364": [6, 507], "IPR001128": [32, 489], "IPR002401": [62, 463], "IPR017972": [433, 442]}
- Sterigmatocystin 8-O-methyltransferase
- IPR017972: Cytochrome P450, conserved site (conserved_site) [433-442] - IPR001128: Cytochrome P450 (family) [32-489] - IPR002401: Cytochrome P450, E-class, group I (family) [62-463] - IPR050364: Cytochrome P450 monooxygenase, fungi (family) [6-507] - IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [23-496]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044550 (secondary metabolite biosynthetic process), GO:0044249 (cellular biosynthetic process), GO:0009404 (toxin metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006083 (acetate metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:1901376 (organic heteropentacyclic compound metabolic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0043385 (mycotoxin metabolic process), GO:0009403 (toxin biosynthetic process), GO:0045122 (aflatoxin biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0043386 (mycotoxin biosynthetic process), GO:0046222 (aflatoxin metabolic process), GO:1901378 (organic heteropentacyclic compound biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0043229 (intracellular organelle), GO:0005783 (endoplasmic reticulum), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle)
Q59Z29
Iron-regulated transcriptional activator AFT2
Transcription factor involved in iron metabolism, oxidative stress, surface adhesion, hyphal development and virulence. Functions as a negative regulator of MRS4 expression through the CACCC AFT-type sequence in a gene dose-dependent fashion. Acts as a repressor in flocculation, plastic adhesion, and surface hydrophobicity
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
798
Nucleus
MTDRVTHRVSLDDLNLEKQKFDSKDDIKPWLQDNLQSTKGINVVIERSDTSKIIFKCKNKEKKTKIVESKKTASKTMIRKHTSCPFKIRANYSVRNKVWTLSIVSDEHDHVVDLPRSFVGKNLISNTIPGSSLNVLDSVAPRSNKKGIKPTSEIANTPSVTSYSPSCAVKRNEDVDAPKISSKKARNLTKKPSTQSTRSSSSSDGSSIVSFGSLTSQSSSTSLPENYKGQVPTSMDSMVVEESLTGKSLKPAASHPVKRKNMKANTMKKSKKLKQNPIVVSPIEEDSNLNSFDDANIDLQRQQSLQSPLSHLVQNQDPISLEQNPQLHTVYPQPRHSKQSSSLLKKNQQQDRIPDNMPLQPQENNRTLQNFPLNQFNANEILQNVQQVVRETVKSEILDSPNIDNTYKTDMMDSFVSSVILDYKDYLSSQFLFSLKQNLYDRREATHTNVDLEQNGSNENLFDEQPQHKHNHQHNENQFSYQSQIQNQRQNQNQNQGQNQNQNQSQSQTPGQNSNQNDSQTQIPLQSQTPQDRKSAMQQNWLPGSTPGVGGLIRLSPLLNDNDNNEYAAVAAAAVVGSTPGNPNGNSLENFTHLPGINSSTLNYLMQLPHPSANPNSGGVSSSQPASLMSLQGHQGLLQQQQQQQPMFSMQNSGQQLPPLSSIPKLPSSNNANVNLNSSSTLPLPLNNTGPTLNPSSLLKSTSRNSTNSGNINVNNINNSNNNSNSAFNSVFLNSSITTNPAFIFNSQGNPTNSNQSMVNSIMTTNSNKDGTATSNNNSSGNTSNNLLNDMPNYGPGW
[ "GO:0002831", "GO:0002833", "GO:0006355", "GO:0006357", "GO:0006873", "GO:0006879", "GO:0006950", "GO:0006979", "GO:0007155", "GO:0008150", "GO:0009267", "GO:0009607", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010570"...
[ "GO:0002831", "GO:0002833", "GO:0006355", "GO:0006357", "GO:0006873", "GO:0006879", "GO:0006950", "GO:0006979", "GO:0007155", "GO:0008150", "GO:0009267", "GO:0009607", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010570"...
[]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q59Z29-F1-model_v6.pdb
237561.Q59Z29
[ "Q5AF81", "Q59SS1" ]
[ "IPR014842" ]
{"IPR014842": [21, 111]}
- Monothiol glutaredoxin - Ccc1p
- IPR014842: Iron-regulated transcriptional activator AFT (family) [21-111]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0050789 (regulation of biological process), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0009987 (cellular process), GO:0048519 (negative regulation of biological process), GO:0009605 (response to external stimulus), GO:0009628 (response to abiotic stimulus), GO:0042221 (response to chemical), GO:0019222 (regulation of metabolic process), GO:0009892 (negative regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0051716 (cellular response to stimulus), GO:0006950 (response to stress), GO:0048523 (negative regulation of cellular process), GO:0007154 (cell communication), GO:0051172 (negative regulation of nitrogen compound metabolic process), GO:0006979 (response to oxidative stress), GO:0060255 (regulation of macromolecule metabolic process), GO:1901700 (response to oxygen-containing compound), GO:0031324 (negative regulation of cellular metabolic process), GO:0010033 (response to organic substance), GO:0009408 (response to heat), GO:0009991 (response to extracellular stimulus), GO:0010035 (response to inorganic substance), GO:0104004 (cellular response to environmental stimulus), GO:0042594 (response to starvation), GO:0070887 (cellular response to chemical stimulus), GO:0033554 (cellular response to stress), GO:0010605 (negative regulation of macromolecule metabolic process), GO:0071214 (cellular response to abiotic stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0009890 (negative regulation of biosynthetic process), GO:0031668 (cellular response to extracellular stimulus), GO:0009268 (response to pH), GO:0080090 (regulation of primary metabolic process), GO:0071496 (cellular response to external stimulus), GO:0034599 (cellular response to oxidative stress), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0071310 (cellular response to organic substance), GO:0009267 (cellular response to starvation), GO:0062197 (cellular response to chemical stress), GO:0010446 (response to alkaline pH), GO:0010468 (regulation of gene expression), GO:0071467 (cellular response to pH), GO:0031667 (response to nutrient levels), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0010558 (negative regulation of macromolecule biosynthetic process), GO:0031327 (negative regulation of cellular biosynthetic process), GO:0051252 (regulation of RNA metabolic process), GO:0042542 (response to hydrogen peroxide), GO:0051253 (negative regulation of RNA metabolic process), GO:1901701 (cellular response to oxygen-containing compound), GO:0031669 (cellular response to nutrient levels), GO:0000302 (response to reactive oxygen species), GO:0045934 (negative regulation of nucleobase-containing compound metabolic process), GO:0071469 (cellular response to alkaline pH), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0036244 (cellular response to neutral pH), GO:0043618 (regulation of transcription from RNA polymerase II promoter in response to stress), GO:1902679 (negative regulation of RNA biosynthetic process), GO:0006357 (regulation of transcription by RNA polymerase II), GO:0045892 (negative regulation of DNA-templated transcription), GO:1903507 (negative regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription), GO:0000122 (negative regulation of transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
O67434
Protein argonaute
A DNA-guided RNA endonuclease. Uses short ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in cleavage of the target RNA. The cleavage site is 10 nucleotides downstream of the residue base paired with the 5'-end of the gDNA. Binds ssDNA better than ssRNA, binds dsDNA and DNA- RNA hybrids but does not bind dsRNA. A 2 nucleotide 3'-overhang (possibly on the guide strand) may help load nucleic acids into the complex (Probable)
Aquifex aeolicus (strain VF5)
706
null
MGKEALLNLYRIEYRPKDTTFTVFKPTHEIQKEKLNKVRWRVFLQTGLPTFRREDEFWCAGKVEKDTLYLTLSNGEIVELKRVGEEEFRGFQNERECQELFRDFLTKTKVKDKFISDFYKKFRDKITVQGKNRKIALIPEVNEKVLKSEEGYFLLHLDLKFRIQPFETLQTLLERNDFNPKRIRVKPIGIDFVGRVQDVFKAKEKGEEFFRLCMERSTHKSSKKAWEELLKNRELREKAFLVVLEKGYTYPATILKPVLTYENLEDEERNEVADIVRMEPGKRLNLIRYILRRYVKALRDYGWYISPEEERAKGKLNFKDTVLDAKGKNTKVITNLRKFLELCRPFVKKDVLSVEIISVSVYKKLEWRKEEFLKELINFLKNKGIKLKIKGKSLILAQTREEAKEKLIPVINKIKDVDLVIVFLEEYPKVDPYKSFLLYDFVKRELLKKMIPSQVILNRTLKNENLKFVLLNVAEQVLAKTGNIPYKLKEIEGKVDAFVGIDISRITRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGDVFSLLEKLGFKKGSKIVVHRDGRLYRDEVAAFKKYGELYGYSLELLEIIKRNNPRFFSNEKFIKGYFYKLSEDSVILATYNQVYEGTHQPIKVRKVYGELPVEVLCSQILSLTLMNYSSFQPIKLPATVHYSDKITKLMLRGIEPIKKEGDIMYWL
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004521", "GO:0004540", "GO:0140098", "GO:0140640" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004521", "GO:0004540", "GO:0140098", "GO:0140640" ]
[]
AF-O67434-F1-model_v6.pdb
224324.aq_1447
[ "O67435", "O67433" ]
[ "IPR003165", "IPR012337", "IPR003100", "IPR036397", "IPR036085" ]
{"IPR036085": [4, 314], "IPR012337": [334, 706], "IPR036397": [492, 705], "IPR003100": [168, 259], "IPR003165": [419, 694]}
- 8-OXO-dGTPase domain (MutT domain) - Uncharacterized protein aq_1446
- IPR003165: Piwi domain (domain) [419-694] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [334-706] - IPR003100: PAZ domain (domain) [168-259] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [492-705] - IPR036085: PAZ domain superfamily (homologous_superfamily) [4-314]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0008380 (RNA splicing), GO:0034470 (ncRNA processing), GO:0034660 (ncRNA metabolic process), GO:0006399 (tRNA metabolic process), GO:0000394 (RNA splicing, via endonucleolytic cleavage and ligation), GO:0008033 (tRNA processing), GO:0006388 (tRNA splicing, via endonucleolytic cleavage and ligation) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex), GO:0140535 (intracellular protein-containing complex), GO:1905348 (endonuclease complex), GO:1905347 (endodeoxyribonuclease complex)
A4WYU7
Protein argonaute
A catalytically inactive argonaute protein. Binds 5'- phosphorylated RNA as the guide (gRNA) and short DNA as target DNA (tDNA); does not bind other nucleic acid combinations, does not bind tDNA alone. Has highest affinity for gRNA that begins with 5'-phospho-U and poor affinity for gRNA with 5'-OH. Upon expression in E.coli, plasmid sequences are found in RsAgo, its induction leads to plasmid degradation and suppression of genes encoded on foreign plasmids, suggesting it may also interfere with transcription. Does not interact with preformed gRNA:tDNA duplexes. Mismatches and nt bulges are tolerated in the ternary complex, however, they significantly reduce the affinity of RsAgo:gRNA for tDNA. Mismatched tDNA can cause dissociation of gRNA from RsAgo. In situ binds 2 populations of RNA (15-19 and 45 nucleotides, nt) and a population of ssDNA 22-24 nt in length. The small sense RNA is probably derived from mRNA degradation and strongly enriched for U in the first and U/C in the second positions. The small DNA is enriched for sequences complementary to the RNA, with 3 nt overhangs on both ends; another nuclease may trim the ends. The sequences are largely derived from exogenous plasmids or genome-encoded foreign elements such as prophages and transposons. Forms a ternary complex with gRNA and double-stranded tDNA only when the tDNA is open
Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) (Rhodobacter
777
null
MAPVQAADEMYDSNPHPDRRQLVSNGFEVNLPDQVEVIVRDLPDPSKVKEERTRLMGYWFVHWFDGKLFHLRIKAGGPNVDGEHRAIRTAEHPWLLRARLDDALEEALPKYAAVKKRPFTFLAQKDELIDAAATAAGLSHRLLNSFKVIPRFALSPKIYEPVDGTTRVGVFVTIGMRYDIEASLRDLLEAGIDLRGMYVVRRKRQPGERGLLGRVRAISDDMVQLFEETDLASVNVNDAKLEGSKENFTRCLSALLGHNYKKLLNALDDQEAGYRTGPRFDDAVRRMGEFLAKKPIRLADNINAQVGDRIVFSNEGQARNVRLAPKVEYVFDRTGAKSAEYAWRGLSQFGPFDRPSFANRSPRILVVYPSSTQGKVENFLSAFRDGMGSNYSGFSKGFVDLMGLTKVEFVMCPVEVSSADRNGAHTKYNSAIEDKLAGAGEVHAGIVVLFEDHARLPDDRNPYIHTKSLLLTLGVPTQQVRMPTVLLEPKSLQYTLQNFSIATYAKLNGTPWTVNHDKAINDELVVGMGLAELSGSRTEKRQRFVGITTVFAGDGSYLLGNVSKECEYEGYSDAIRESMTGILRELKKRNNWRPGDTVRVVFHAHRPLKRVDVASIVFECTREIGSDQNIQMAFVTVSHDHPFVLIDRSERGLEAYKGSTARKGVFAPPRGAISRVGRLTRLLAVNSPQLIKRANTPLPTPLLVSLHPDSTFKDVDYLAEQALKFTSLSWRSTLPAATPVTIFYSERIAELLGRLKSIPNWSSANLNIKLKWSRWFL
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546", "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097"...
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546" ]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
AF-A4WYU7-F1-model_v6.pdb
null
null
[ "IPR003165", "IPR036397", "IPR012337" ]
{"IPR012337": [321, 777], "IPR036397": [516, 777], "IPR003165": [445, 757]}
- IPR003165: Piwi domain (domain) [445-757] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [516-777] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [321-777]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0090305 (nucleic acid phosphodiester bond hydrolysis), GO:0016070 (RNA metabolic process), GO:0090501 (RNA phosphodiester bond hydrolysis), GO:0090502 (RNA phosphodiester bond hydrolysis, endonucleolytic) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0043657 (host cell), GO:0033643 (host cell part), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0033647 (host intracellular organelle), GO:0033648 (host intracellular membrane-bounded organelle), GO:0042025 (host cell nucleus)
A0A1M5A5Z8
Protein argonaute
A highly versatile argonaute that uses 5'-phospho- and 5'- OH- guide RNA (gRNA) or DNA (gDNA) to cleave target RNA or ssDNA (tDNA) in all possible combinations; has no detectable activity in the absence of guide. Uses short guide sequences (18-21 nucleotides (nt) on average) to bind complementary target nucleic acids resulting in target cleavage in a site-specific manner. Using 5'-phospho-gRNA or 5'-OH-gRNA the cleavage site is 10 nt downstream of the target residue base-paired with the 5'-end of the gRNA, using 5'-phospho-gDNA the cleavage site is 11 nucleotides (nt) downstream, while with 5'-OH-gDNA the cleavage site is 9 nt downstream
Marinitoga hydrogenitolerans (strain DSM 16785 / JCM 12826 / AT1271)
640
null
MYLNLYEIKIPYRVKRLYYFNKENDPKEFARNLSRVNNIRFNDSKDLVWLEIPDIDFKITPQQAEKYKIEKNEIIGEKEDSDLFVKTIYRYIKKKFIDNNFYYKRGNNYISINDKFPLDSNTNVNAHLTYKIKLYKINERYYISVLPKFTFLSDKPALESPIKSTYLFNIKSGKTFPYISGLNGVLKIDLGENGIKEVLFPENYYFNFTSKEAEKFGFSKEIHNIYKEKIFSGYKKIKQSLYFLEDIININNYNLTMDKKIYVNIEYEFKKGISRNIKDVFKYSFYKNDQKIKIAFFFSSKKQIYEIQRSLKMLFQNKNSIFYQTIYEMGFSKVIFLREPKTNSSAFMYNPETFEISNKDFFENLEGNIMAIIILDKFLGNIDSLIQKFPENLILQPILKEKLEKIQPYIIKSYVYKMGNFIPECQPYVIRNLKDKNKTLYIGIDLSHDNYLKKSNLAISAVNNFGDIIYLNKYKNLELNEKMNLDIVEKEYIQILNEYYERNKNYPENIIVLRDGRYLEDIEIIKNILNIENIKYSLIEVNKSVNINSCEDLKEWIIKLSDNNFIYYPKTYFNQKGVEIKIIENNTDYNNEKILEQVYSLTRVVHPTPYVNYRLPYPLQVVNKVALTELEWKLYIPYMK
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004521", "GO:0004536", "GO:0004540", "GO:0140097", "GO:0140098", "GO:0140640" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004521", "GO:0004536", "GO:0004540", "GO:0140097", "GO:0140098", "GO:0140640" ]
[]
AF-A0A1M5A5Z8-F1-model_v6.pdb
1122195.SAMN02745164_02104
[ "A0A1M5A5N0", "A0A1M5A679", "A0A1M5A5P1" ]
[ "IPR054434", "IPR054387", "IPR003165", "IPR012337", "IPR036397" ]
{"IPR012337": [410, 626], "IPR036397": [433, 604], "IPR054387": [13, 75], "IPR054434": [262, 430], "IPR003165": [369, 633]}
- CRISPR-associated endonuclease Cas1 - TOTE conflict system primase domain-containing protein - CRISPR-associated endoribonuclease Cas2
- IPR054434: Argonaute, middle domain, bacteria (domain) [262-430] - IPR054387: Argonaute, N-terminal domain, bacteria (domain) [13-75] - IPR003165: Piwi domain (domain) [369-633] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [410-626] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [433-604]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0006397 (mRNA processing), GO:0016071 (mRNA metabolic process), GO:0036260 (RNA capping), GO:0006370 (7-methylguanosine mRNA capping), GO:0009452 (7-methylguanosine RNA capping) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0043657 (host cell), GO:0033643 (host cell part), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0033647 (host intracellular organelle), GO:0033648 (host intracellular membrane-bounded organelle), GO:0042025 (host cell nucleus)
H2J4R4
Protein argonaute
An RNA-guided ssDNA endonuclease that may play a role in defense against invading mobile genetic elements. Uses short 5'-OH- ssRNA sequences as guides (gRNA) to bind complementary target DNA (tDNA) or target RNA resulting in target cleavage. The cleavage site is 10 nucleotides (nt) downstream of the target residue base-paired with the 5'-end of the gRNA. Reaction rates are fastest on 5'-OH-gRNA:tDNA followed by 5'-OH-gRNA:target RNA. gRNA between 17-21 nt supports equivalent rates of cleavage, has no preferred 5'-nt. Has weak activity on tDNA with 5'-phospho-gRNA, yielding products 1-2 nt longer. Unlike other characterized prokaryotic Ago proteins symmetric mismatches centered around the cleavage site reduce cleavage efficiency
Marinitoga piezophila (strain DSM 14283 / JCM 11233 / KA3)
639
Cytoplasm
MYLNLYKIDIPKKIKRLYFYNPDMEPKLFARNLSRVNNFKFQDSNDLVWIEIPDIDFQITPKNVFQYKVEKEEIIKEEEDKKLFVKTLYKYIKKLFLDNDFYFKKGNNFISNSEVFSLDSNENVNAHLTYKIKIHNISNEYYLSILPKFTFLSKEPALESAIKSGYLYNIKSGKSFPYISGLDGILKIDIGNNQIVEVAYPENYLFNFTTRDAEKYGFSKEVHEIYKNKVFEGFKKIPKTLGFLNKITNLNENYQLKDGYKIFINVIYKFKNGESRYAKDVFKYSFYKNEQPLKAIFFFSSKKQFFEVQKSLKELFHNKHSVFYRAAAELGFSKVEFLRDSKTKSSAFLYNPEEFTVKNTEFINQIEDNVMAIVLLDKYIGNIDPLVRNFPDNLILQPILKEKLEDIKPFIIKSYVYKMGNFIPECKPFILKKMEDKEKNLYIGIDLSHDTYARKTNLCIAAVDNTGDILYIGKHKNLELNEKMNLDILEKEYIKAFEKYIEKFNVSPENVFILRDGRFIEDIEIIKNFISYNDTKYTLVEVNKNTNINSYDDLKEWIIKLDENTYIYYPKTFLNQKGVEVKILENNTDYTIEEIIEQIYLLTRVAHSTPYTNYKLPYPLHIANKVALTDYEWKLYIPY
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
AF-H2J4R4-F1-model_v6.pdb
443254.Marpi_0405
[ "H2J4R1", "H2J4R2", "H2J4R3" ]
[ "IPR054434", "IPR054387", "IPR003165", "IPR012337", "IPR036397" ]
{"IPR012337": [415, 627], "IPR036397": [436, 634], "IPR054387": [12, 76], "IPR054434": [263, 432], "IPR003165": [394, 634]}
- CRISPR-associated endonuclease Cas1 - CRISPR-associated endoribonuclease Cas2 - TOTE conflict system primase domain-containing protein
- IPR054434: Argonaute, middle domain, bacteria (domain) [263-432] - IPR054387: Argonaute, N-terminal domain, bacteria (domain) [12-76] - IPR003165: Piwi domain (domain) [394-634] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [415-627] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [436-634]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0006397 (mRNA processing), GO:0016071 (mRNA metabolic process), GO:0036260 (RNA capping), GO:0006370 (7-methylguanosine mRNA capping), GO:0009452 (7-methylguanosine RNA capping) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0043657 (host cell), GO:0033643 (host cell part), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0030430 (host cell cytoplasm), GO:0033655 (host cell cytoplasm part), GO:0033647 (host intracellular organelle), GO:0033648 (host intracellular membrane-bounded organelle)
Q58717
Protein argonaute
A DNA-guided ssDNA endonuclease that may play a role in defense against invading genetic elements. Uses short ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in slicing of the target DNA (tDNA). Endonucleolytically cleaves tDNA (the gDNA indicates where to cleave); two major and two minor products are seen which correspond to cleavage sites between nucleotides 9/10, 10/11, 13/14, and 14/15 downstream of the target residue base-paired with the 5'-end of the gDNA. Efficient guide-dependent tDNA cleavage requires a minimal length of 15 bp and is maximal at 19 bp. Prefers gDNA with 5'-phosphorylated purines and 3'- pyrimidines; changing these bases alters the cleavage activity and patterns. Also has guide-independent activity on tDNA called 'chopping'. Probably a first round of guide- independent activity on an invading plasmid or virus would generate guide DNAs for subsequent, more efficient, guide-dependent degradation of invading nucleic acids. Has no activity on substrate with a mismatch at positions 10 and 11, on ssDNA or RNA, nor on DNA:RNA hybrids. Digests longer (750 bp) dsDNA as well as circular plasmid and naked genomic DNA, but not chromatin, in a guide DNA-independent manner. Addition of endogenous histone A3 protects DNA from cleavage, while cleavage is insensitive to methylation. When plasmid encoding active or mutated protein (Ala-541) is transformed into Sulfolobus acidocaldarius about 25-fold fewer transformants are found with active protein; reduced levels of plasmid are found in wild-type transformed cells. While S.acidocaldarius grows at a similar temperature to M.jannaschii (70 to 80 degrees Celsius) it has very different histone-like proteins, which presumably do not protect against MjAgo. Binds ssDNA, dsDNA and DNA-RNA hybrids; binding is most efficient with dsDNA
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM
713
null
MVLNKVTYKINAYKIKEEFIPKEVHFYRIKSFVNEAFNFYRFVNFYGGMIINKKDKSFVLPYKVDNKVLKYKDGNNEIPIDIEYIKSLKLEYVKPEIAEKLVRGYLKSVHKIEPELSRIIKNIRKHKVVENIKVESYCEYEVKKHDGDYYLILNFRHTASITKHLWDFVNRDKALLEEYVGKKIIFKPNPKVRYTISLVDAPNPQKIEEIMSHIIKYYKWSEDMVKSTFGEIDYNQPIMYCEEILEPFAPQFCNLVFYMDELDSYILKELQSYWRLSNENKGKIINEIAKKLRFIDNTPKELEFMKFNNTPLLVKDVNKNPTKIYSTNTLFTWIYNQNAKIYLPYDVPEIIRNKNLLTYILIDEEIKDELKAIKDKVNKMFRNYNKIANKTELPKFNYANRWKYFSTDDIRGIIKEIKSEFNDEICFALIIGKEKYKDNDYYEILKKQLFDLKIISQNILWENWRKDDKGYMTNNLLIQIMGKLGIKYFILDSKTPYDYIMGLDTGLGIFGNHRVGGCTVVYDSEGKIRRIQPIETPAPGERLHLPYVIEYLENKANIDMENKNILFLRDGFIQNSERNDLKEISKELNSNIEVISIRKNNKYKVFTSDYRIGSVFGNDGIFLPHKTPFGSNPVKLSTWLRFNCGNEEGLKINESIMQLLYDLTKMNYSALYGEGRYLRIPAPIHYADKFVKALGKNWKIDEELLKHGFLYFI
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546", "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097"...
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546" ]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
AF-Q58717-F1-model_v6.pdb
243232.MJ_1321
[ "Q58907", "Q58719", "Q58716", "Q57841", "Q58718" ]
[ "IPR003100", "IPR054390", "IPR012337", "IPR003165", "IPR054436", "IPR036085", "IPR036397" ]
{"IPR036085": [5, 305], "IPR012337": [301, 713], "IPR036397": [494, 713], "IPR054390": [22, 90], "IPR054436": [163, 258], "IPR003100": [164, 257], "IPR003165": [426, 699]}
- Uncharacterized protein MJ0398 - Reverse gyrase - DNA double-strand break repair protein Mre11 - DNA double-strand break repair Rad50 ATPase - Ribonuclease VapC4
- IPR003100: PAZ domain (domain) [164-257] - IPR054390: Argonaute, N-terminal domain, archaea (domain) [22-90] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [301-713] - IPR003165: Piwi domain (domain) [426-699] - IPR054436: Argonaute, PAZ domain, methanocaldococcus (domain) [163-258] - IPR036085: PAZ domain superfamily (homologous_superfamily) [5-305] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [494-713]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0006397 (mRNA processing), GO:0016071 (mRNA metabolic process), GO:0036260 (RNA capping), GO:0006370 (7-methylguanosine mRNA capping), GO:0009452 (7-methylguanosine RNA capping) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0043657 (host cell), GO:0033643 (host cell part), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0030430 (host cell cytoplasm), GO:0033655 (host cell cytoplasm part), GO:0033647 (host intracellular organelle), GO:0033648 (host intracellular membrane-bounded organelle)
Q8U3D2
Protein argonaute
A DNA-guided ssDNA endonuclease that may play a role in defense against invading mobile genetic elements. Uses short 5'- phospho-ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in cleavage of the target DNA (tDNA). Endonucleolytically cleaves DNA in short dsDNA (the gDNA indicates where to cleave on the tDNA). Efficient guide-dependent target DNA cleavage requires a minimal gDNA length of 15 nucleotides (nt) and works up to at least 31 nt. Overexpression decreases plasmid transformation efficiency. Has no appreciable activity with gRNA or on target RNA. Also has guide-independent activity on plasmid DNA called 'chopping'. The cleavage site is 10 nucleotides (nt) downstream of the target residue base-paired with the 5'-end of the gDNA, cleavage is insensitive to adenine methylation. DNA cleavage produces 5'-phosphomonoesters (as it can be ligated by T4 DNA ligase)
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
770
null
MKAKVVINLVKINKKIIPDKIYVYRLFNDPEEELQKEGYSIYRLAYENVGIVIDPENLIIATTKELEYEGEFIPEGEISFSELRNDYQSKLVLRLLKENGIGEYELSKLLRKFRKPKTFGDYKVIPSVEMSVIKHDEDFYLVIHIIHQIQSMKTLWELVNKDPKELEEFLMTHKENLMLKDIASPLKTVYKPCFEEYTKKPKLDHNQEIVKYWYNYHIERYWNTPEAKLEFYRKFGQVDLKQPAILAKFASKIKKNKNYKIYLLPQLVVPTYNAEQLESDVAKEILEYTKLMPEERKELLENILAEVDSDIIDKSLSEIEVEKIAQELENKIRVRDDKGNSVPISQLNVQKSQLLLWTNYSRKYPVILPYEVPEKFRKIREIPMFIILDSGLLADIQNFATNEFRELVKSMYYSLAKKYNSLAKKARSTNEIGLPFLDFRGKEKVITEDLNSDKGIIEVVEQVSSFMKGKELGLAFIAARNKLSSEKFEEIKRRLFNLNVISQVVNEDTLKNKRDKYDRNRLDLFVRHNLLFQVLSKLGVKYYVLDYRFNYDYIIGIDVAPMKRSEGYIGGSAVMFDSQGYIRKIVPIKIGEQRGESVDMNEFFKEMVDKFKEFNIKLDNKKILLLRDGRITNNEEEGLKYISEMFDIEVVTMDVIKNHPVRAFANMKMYFNLGGAIYLIPHKLKQAKGTPIPIKLAKKRIIKNGKVEKQSITRQDVLDIFILTRLNYGSISADMRLPAPVHYAHKFANAIRNEWKIKEEFLAEGFLYFV
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546", "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0005488"...
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546" ]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0005488", "GO:0030145", "GO:0036094", "GO:0043167", "GO:0043169", "GO:0046872", "GO:0046914", "GO:0140097", "GO:0140640" ]
[]
AF-Q8U3D2-F1-model_v6.pdb
186497.PF0537
null
[ "IPR003100", "IPR012337", "IPR057272", "IPR003165", "IPR021103", "IPR036085", "IPR036397", "IPR055253" ]
{"IPR036085": [4, 323], "IPR012337": [325, 770], "IPR036397": [547, 770], "IPR055253": [19, 78], "IPR021103": [146, 272], "IPR003100": [154, 272], "IPR057272": [333, 753], "IPR003165": [473, 756]}
- IPR003100: PAZ domain (domain) [154-272] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [325-770] - IPR057272: Piwi domain, nematodes (domain) [333-753] - IPR003165: Piwi domain (domain) [473-756] - IPR021103: Argonaute PAZ domain, archaea (domain) [146-272] - IPR036085: PAZ domain superfamily (homologous_superfamily) [4-323] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [547-770] - IPR055253: Argonaute, N-terminal domain, thermococcales (domain) [19-78]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0034470 (ncRNA processing), GO:0034660 (ncRNA metabolic process), GO:0006399 (tRNA metabolic process), GO:0008033 (tRNA processing) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex), GO:0140535 (intracellular protein-containing complex), GO:1905348 (endonuclease complex), GO:1905347 (endodeoxyribonuclease complex)
Q31N05
Protein argonaute
A DNA-guided ssDNA endonuclease that might play a role in defense against invading mobile genetic elements. Uses short ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in cleavage of the target DNA (tDNA). The cleavage site is 10 nucleotides (nt) downstream of the target residue base-paired with the 5'-end of the gDNA. Both 5'-P and 5'-OH gDNAs confer activity; a 5'-OH guide cleaves between nt 10-11 and nt 11-12. Guide DNA mismatches in the seed (nt 2-9) can enhance activity, mismatches 1-5 nt after the cleavage site block activity. Has no appreciable activity with guide RNA or on target RNA. In situ binds to 5'-phosphorylated DNA 14-20 nt in length; small DNA maps over the chromosome and plasmid with some preference for the replication origin and the probable termination site. Also has weak guide-independent nuclease activity on DNA called 'chopping'. Overexpression of wild-type or catalytically inactive mutant has no visible effect during growth under continuous high light for up to a month
Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
735
null
MDLLSNLRRSSIVLNRFYVKSLSQSDLTAYEYRCIFKKTPELGDEKRLLASICYKLGAIAVRIGSNIITKEAVRPEKLQGHDWQLVQMGTKQLDCRNDAHRCALETFERKFLERDLSASSQTEVRKAAEGGLIWWVVGAKGIEKSGNGWEVHRGRRIDVSLDAEGNLYLEIDIHHRFYTPWTVHQWLEQYPEIPLSYVRNNYLDERHGFINWQYGRFTQERPQDILLDCLGMSLAEYHLNKGATEEEVQQSYVVYVKPISWRKGKLTAHLSRRLSPSLTMEMLAKVAEDSTVCDREKREIRAVFKSIKQSINQRLQEAQKTASWILTKTYGISSPAIALSCDGYLLPAAKLLAANKQPVSKTADIRNKGCAKIGETSFGYLNLYNNQLQYPLEVHKCLLEIANKNNLQLSLDQRRVLSDYPQDDLDQQMFWQTWSSQGIKTVLVVMPWDSHHDKQKIRIQAIQAGIATQFMVPLPKADKYKALNVTLGLLCKAGWQPIQLESVDHPEVADLIIGFDTGTNRELYYGTSAFAVLADGQSLGWELPAVQRGETFSGQAIWQTVSKLIIKFYQICQRYPQKLLLMRDGLVQEGEFQQTIELLKERKIAVDVISVRKSGAGRMGQEIYENGQLVYRDAAIGSVILQPAERSFIMVTSQPVSKTIGSIRPLRIVHEYGSTDLELLALQTYHLTQLHPASGFRSCRLPWVLHLADRSSKEFQRIGQISVLQNISRDKLIAV
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
AF-Q31N05-F1-model_v6.pdb
1140.Synpcc7942_1534
null
[ "IPR040895", "IPR003165", "IPR036397", "IPR012337" ]
{"IPR012337": [307, 732], "IPR036397": [507, 735], "IPR040895": [185, 276], "IPR003165": [441, 720]}
- IPR040895: Argonaute, PAZ domain (domain) [185-276] - IPR003165: Piwi domain (domain) [441-720] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [507-735] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [307-732]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0044260 (cellular macromolecule metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0006259 (DNA metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0006260 (DNA replication), GO:0006261 (DNA-templated DNA replication) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex), GO:0140535 (intracellular protein-containing complex), GO:1905348 (endonuclease complex), GO:1902555 (endoribonuclease complex)
Q746M7
Protein argonaute
A DNA-guided ssDNA endonuclease. Uses short ssDNA sequences as guides (gDNA, also called small interfering DNA, siDNA) to bind complementary DNA target strands, resulting in cleavage of the target DNA (tDNA). The cleavage site is 10 nucleotides (nt) downstream of the target residue base-paired with the 5'-end of the gDNA. Plays a role in completion of DNA replication, participates in decatenating replicated DNA and plasmid. In situ purifies with 5'-phosphorylated long DNA (about 1160 nt, maps to the whole chromosome and plasmid), 25-35 nt RNAs that map to the whole chromosome and 15-18 nt DNA that maps to the replication terminus region (ter) on the chromosome and plasmid. Most short DNA starts with dC. Has been shown to have guide sequence-independent dsDNase activity called 'chopping', which requires unstable DNA (high AT-content, multiple mismatches or low salt conditions), and could be used to generate gDNA. Preferentially binds tDNA with dC at its 3'- terminus. Has also been shown to have no detectable guide sequence-independent dsDNase activity. The latter study proposes TtAgo may acquire gDNA from nicked dsDNA, by binding to 5'-phosphorylated-dC nicks, then cleaving 10 nt away on the opposite strand; subsequently an exonuclease (maybe AddA-AddB helicase/nuclease) trims the ends to generate the gDNA (Probable)
Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
685
null
MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLARMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPKLMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKEEGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAGGRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEALAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTRLYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546", "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0005488"...
[ "GO:0006950", "GO:0006952", "GO:0008150", "GO:0009605", "GO:0009607", "GO:0043207", "GO:0044355", "GO:0044419", "GO:0050896", "GO:0051707", "GO:0098542", "GO:0099046", "GO:0140546" ]
[ "GO:0003674", "GO:0003824", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0005488", "GO:0030145", "GO:0036094", "GO:0043167", "GO:0043169", "GO:0046872", "GO:0046914", "GO:0140097", "GO:0140640" ]
[]
AF-Q746M7-F1-model_v6.pdb
null
null
[ "IPR040895", "IPR012337", "IPR003165", "IPR054764", "IPR054763", "IPR003100", "IPR036397" ]
{"IPR012337": [282, 685], "IPR036397": [467, 685], "IPR054764": [26, 96], "IPR003100": [169, 265], "IPR040895": [181, 263], "IPR054763": [327, 444], "IPR003165": [404, 671]}
- IPR040895: Argonaute, PAZ domain (domain) [181-263] - IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [282-685] - IPR003165: Piwi domain (domain) [404-671] - IPR054764: Argonaute, N-terminal domain, thermus (domain) [26-96] - IPR054763: Argonaute, middle domain (domain) [327-444] - IPR003100: PAZ domain (domain) [169-265] - IPR036397: Ribonuclease H superfamily (homologous_superfamily) [467-685]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0016032 (viral process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019058 (viral life cycle), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0019079 (viral genome replication), GO:0044249 (cellular biosynthetic process), GO:0006725 (cellular aromatic compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0009059 (macromolecule biosynthetic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0044271 (cellular nitrogen compound biosynthetic process), GO:0090304 (nucleic acid metabolic process), GO:0034654 (nucleobase-containing compound biosynthetic process), GO:0019438 (aromatic compound biosynthetic process), GO:0018130 (heterocycle biosynthetic process), GO:0016070 (RNA metabolic process), GO:0032774 (RNA biosynthetic process), GO:0097659 (nucleic acid-templated transcription), GO:0006351 (DNA-templated transcription), GO:0006366 (transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0031974 (membrane-enclosed lumen), GO:0043233 (organelle lumen), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043228 (non-membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0070013 (intracellular organelle lumen), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0031981 (nuclear lumen), GO:0005730 (nucleolus), GO:0005634 (nucleus)
Q8R4S7
Aryl hydrocarbon receptor
Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Regulates a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. Xenobiotics can act as ligands: upon xenobiotic-binding, activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Next to xenobiotics, natural ligands derived from plants, microbiota, and endogenous metabolism are potent AHR agonists. Tryptophan (Trp) derivatives constitute an important class of endogenous AHR ligands. Acts as a negative regulator of anti-tumor immunity: indoles and kynurenic acid generated by Trp catabolism act as ligand and activate AHR, thereby promoting AHR-driven cancer cell motility and suppressing adaptive immunity. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription
Mus caroli (Ryukyu mouse) (Ricefield mouse)
854
Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus
MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTDSAQGVDEAHGPPQTAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPSGCDAKGQLILGYTEVELCTRGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAKHSRWRWVQSNARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSMSLPFMFATGEAVLYEISSPFSPIMDPLPIRAKSNTSRKDWAPQSTPSKDSFHPSSLMSALIQQDESIYLCPPSSPAPLDSHFLMGSVSKCGSWQDSFAAAGSEAALKHEQIGHAQDVNLALSGGPSELFPDNKNNDLYSIMRNLGIDFEDIRSMQNEEFFRTDSTATGEVDFKDIDITDEILTYVQDSLNNSTLLNSACQQQPVTQHLSCMLQERLQLEQQQQQQLQQPPTQALEPQQQLCQMECPQQDLGQRHTQINGSFASWNPTPPVSFNCPQQELKHYHLFSSLQGTAQEFPYKPEVDGMPYTQNFAPCNQPLLPEHSKSVQLDFPGRDFEPSLHPTTSNLDFVSCLQVPENQSHGINSQSAMVSPQTYYAGAMSMYQCQPGPQHTPVDQTQYSSEIPGSQAFLSKVQSRGVFNETYPSDLSSIGHAAQTTGHLHHLAEARPLPDITPGGFL
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613", "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226"...
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613" ]
[ "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110" ]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q8R4S7-F1-model_v6.pdb
null
null
[ "IPR036638", "IPR035965", "IPR033348", "IPR013767", "IPR011598", "IPR000014", "IPR013655", "IPR001610", "IPR039091" ]
{"IPR036638": [30, 80], "IPR035965": [120, 386], "IPR039091": [6, 811], "IPR011598": [26, 87], "IPR033348": [27, 87], "IPR000014": [111, 384], "IPR013767": [112, 185], "IPR013655": [298, 380], "IPR001610": [346, 387]}
- IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [30-80] - IPR035965: PAS domain superfamily (homologous_superfamily) [120-386] - IPR033348: Aryl hydrocarbon receptor, basic helix-loop-helix domain (domain) [27-87] - IPR013767: PAS fold (domain) [112-185] - IPR011598: Myc-type, basic helix-loop-helix (bHLH) domain (domain) [26-87] - IPR000014: PAS domain (domain) [111-384] - IPR013655: PAS fold-3 (domain) [298-380] - IPR001610: PAC motif (repeat) [346-387] - IPR039091: Aryl hydrocarbon receptor/Aryl hydrocarbon receptor repressor (family) [6-811]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0038023 (signaling receptor activity), GO:0005515 (protein binding), GO:0008134 (transcription factor binding), GO:0004879 (nuclear receptor activity), GO:0051087 (chaperone binding), GO:0042802 (identical protein binding), GO:0003676 (nucleic acid binding), GO:0031072 (heat shock protein binding), GO:0098531 (ligand-activated transcription factor activity), GO:0005102 (signaling receptor binding), GO:0046983 (protein dimerization activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0051879 (Hsp90 protein binding), GO:0001067 (transcription regulatory region nucleic acid binding), GO:0046982 (protein heterodimerization activity), GO:0140297 (DNA-binding transcription factor binding), GO:0042803 (protein homodimerization activity), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding), GO:0000976 (transcription cis-regulatory region binding), GO:0061629 (RNA polymerase II-specific DNA-binding transcription factor binding), GO:0003690 (double-stranded DNA binding), GO:1990837 (sequence-specific double-stranded DNA binding), GO:0000987 (cis-regulatory region sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0042221 (response to chemical), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0051716 (cellular response to stimulus), GO:0009410 (response to xenobiotic stimulus), GO:0070887 (cellular response to chemical stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0071466 (cellular response to xenobiotic stimulus), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0051252 (regulation of RNA metabolic process), GO:0010468 (regulation of gene expression), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0006357 (regulation of transcription by RNA polymerase II), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q8R4S6
Aryl hydrocarbon receptor
Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Regulates a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. Xenobiotics can act as ligands: upon xenobiotic-binding, activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Next to xenobiotics, natural ligands derived from plants, microbiota, and endogenous metabolism are potent AHR agonists. Tryptophan (Trp) derivatives constitute an important class of endogenous AHR ligands. Acts as a negative regulator of anti-tumor immunity: indoles and kynurenic acid generated by Trp catabolism act as ligand and activate AHR, thereby promoting AHR-driven cancer cell motility and suppressing adaptive immunity. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription
Mus musculus castaneus (Southeastern Asian house mouse)
848
Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus
MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPDSAQGVDEAHGPPQAAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGQLILGYTEVELCTRGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAKHSRWRWVQSNARLIYRNGRPDYIIVTQRPLTDEEGREHLQKRSTSLPFMFATGEAVLYEISSPFSPIMDPLPIRTKSNTSRKDWAPQSTPSKDSFHPSSLMSALIQQDESIYLCPPSSPAPLDSHFLMGSVSKCGSWQDSFAAAGSEAALKHEQIGHAQDVNLALSGGPSELFPDNKNNDLYNIMRNLGIDFEDIRSMQNEEFFRTDSTAAGEVDFKDIDITDEILTYMQDSLNNSTLMNSACQQQPVTQHLSCMLQERLQLEQQQQLQQPPPQALEPQQQLCQMVCPQQDLGPKHTQINGTFASWNPTPPVSFNCPQQELKHYQLFSSLQGTAQEFPYKPEVDSVPYTQNFAPCNQPLLPEHSKSVQLDFPGRDFEPSLHPTTSNLDFVSCLQVPENQSHGINSQSAMVSPQAYYAGAMSMYQCQPGPQRTPVDQTQYSSEIPGSQAFLSKVQSRGIFNETYSSDLSSIGHAAQTTGHLHHLAEARPLPDITPGGFL
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613", "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226"...
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613" ]
[ "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110" ]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q8R4S6-F1-model_v6.pdb
null
null
[ "IPR036638", "IPR035965", "IPR033348", "IPR013767", "IPR011598", "IPR000014", "IPR013655", "IPR001610", "IPR039091" ]
{"IPR036638": [30, 80], "IPR035965": [120, 382], "IPR039091": [6, 791], "IPR011598": [26, 87], "IPR033348": [27, 87], "IPR000014": [111, 380], "IPR013767": [112, 177], "IPR013655": [293, 376], "IPR001610": [342, 383]}
- IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [30-80] - IPR035965: PAS domain superfamily (homologous_superfamily) [120-382] - IPR033348: Aryl hydrocarbon receptor, basic helix-loop-helix domain (domain) [27-87] - IPR013767: PAS fold (domain) [112-177] - IPR011598: Myc-type, basic helix-loop-helix (bHLH) domain (domain) [26-87] - IPR000014: PAS domain (domain) [111-380] - IPR013655: PAS fold-3 (domain) [293-376] - IPR001610: PAC motif (repeat) [342-383] - IPR039091: Aryl hydrocarbon receptor/Aryl hydrocarbon receptor repressor (family) [6-791]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0038023 (signaling receptor activity), GO:0005515 (protein binding), GO:0008134 (transcription factor binding), GO:0004879 (nuclear receptor activity), GO:0051087 (chaperone binding), GO:0042802 (identical protein binding), GO:0003676 (nucleic acid binding), GO:0031072 (heat shock protein binding), GO:0098531 (ligand-activated transcription factor activity), GO:0005102 (signaling receptor binding), GO:0046983 (protein dimerization activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0051879 (Hsp90 protein binding), GO:0001067 (transcription regulatory region nucleic acid binding), GO:0046982 (protein heterodimerization activity), GO:0140297 (DNA-binding transcription factor binding), GO:0042803 (protein homodimerization activity), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding), GO:0000976 (transcription cis-regulatory region binding), GO:0061629 (RNA polymerase II-specific DNA-binding transcription factor binding), GO:0003690 (double-stranded DNA binding), GO:1990837 (sequence-specific double-stranded DNA binding), GO:0000987 (cis-regulatory region sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0042221 (response to chemical), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0051716 (cellular response to stimulus), GO:0009410 (response to xenobiotic stimulus), GO:0070887 (cellular response to chemical stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0071466 (cellular response to xenobiotic stimulus), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0051252 (regulation of RNA metabolic process), GO:0010468 (regulation of gene expression), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0006357 (regulation of transcription by RNA polymerase II), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q8R4S5
Aryl hydrocarbon receptor
Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Regulates a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. Xenobiotics can act as ligands: upon xenobiotic-binding, activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Next to xenobiotics, natural ligands derived from plants, microbiota, and endogenous metabolism are potent AHR agonists. Tryptophan (Trp) derivatives constitute an important class of endogenous AHR ligands. Acts as a negative regulator of anti-tumor immunity: indoles and kynurenic acid generated by Trp catabolism act as ligand and activate AHR, thereby promoting AHR-driven cancer cell motility and suppressing adaptive immunity. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription
Mus musculus molossinus (Japanese house mouse)
883
Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus
MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPDSAQGVDEAHGPPQAAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGQLILGYTEVELCTRGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAKHSRWRWVQSNARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSTSLPFMFATGEAVLYEISSPFSPIMDPLPIRTKSNTSRKDWAPQSTPSKDSFHPSSLMSALIQQDESIYLCPPSSPAPLDSHFLMGSVSKCGSWQDSFAAAGSEAALKHEQIGHAQDVNLALSGGPSELFPDNKNNDLYNIMRNLGIDFEDIRSMQNEEFFRTDSTAAGEVDFKDIDITDEILTYVQDSLNNSTLMNSACQQQPVTQHLSCMLQERLQLEQQQQLQQPPPQALEPQQQLCQMVCPQQDLGPKHTQINGTFASWNPTPPVSFNCPQQELKHYQLFSSLQGTAQEFPYKPEVDSVPYTQNFAPCNQPLLPEHSKSVQLDFPGRDFEPSLHPTTSNLDFVSCLQVPENQSHGINSQSAMVSPQAYYAGAMSMYQCQPGPQRTPVDQTQYSSEIPGSQAFLSKVQSRGVFNETYSSDLSSIDHAVQTTGHLHHLAEARPLPDISHLVGSCSSHARMKFIQEQDTGTVRVGHQYTFSKTDFDSCI
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613", "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226"...
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613" ]
[ "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110" ]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q8R4S5-F1-model_v6.pdb
null
null
[ "IPR036638", "IPR035965", "IPR033348", "IPR013767", "IPR011598", "IPR000014", "IPR013655", "IPR001610", "IPR039091" ]
{"IPR036638": [30, 80], "IPR035965": [120, 382], "IPR039091": [6, 791], "IPR011598": [26, 87], "IPR033348": [27, 87], "IPR000014": [111, 380], "IPR013767": [112, 177], "IPR013655": [293, 376], "IPR001610": [342, 383]}
- IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [30-80] - IPR035965: PAS domain superfamily (homologous_superfamily) [120-382] - IPR033348: Aryl hydrocarbon receptor, basic helix-loop-helix domain (domain) [27-87] - IPR013767: PAS fold (domain) [112-177] - IPR011598: Myc-type, basic helix-loop-helix (bHLH) domain (domain) [26-87] - IPR000014: PAS domain (domain) [111-380] - IPR013655: PAS fold-3 (domain) [293-376] - IPR001610: PAC motif (repeat) [342-383] - IPR039091: Aryl hydrocarbon receptor/Aryl hydrocarbon receptor repressor (family) [6-791]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0038023 (signaling receptor activity), GO:0005515 (protein binding), GO:0008134 (transcription factor binding), GO:0004879 (nuclear receptor activity), GO:0051087 (chaperone binding), GO:0042802 (identical protein binding), GO:0003676 (nucleic acid binding), GO:0031072 (heat shock protein binding), GO:0098531 (ligand-activated transcription factor activity), GO:0005102 (signaling receptor binding), GO:0046983 (protein dimerization activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0051879 (Hsp90 protein binding), GO:0001067 (transcription regulatory region nucleic acid binding), GO:0046982 (protein heterodimerization activity), GO:0140297 (DNA-binding transcription factor binding), GO:0042803 (protein homodimerization activity), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding), GO:0000976 (transcription cis-regulatory region binding), GO:0061629 (RNA polymerase II-specific DNA-binding transcription factor binding), GO:0003690 (double-stranded DNA binding), GO:1990837 (sequence-specific double-stranded DNA binding), GO:0000987 (cis-regulatory region sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0042221 (response to chemical), GO:0048522 (positive regulation of cellular process), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0009893 (positive regulation of metabolic process), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0031325 (positive regulation of cellular metabolic process), GO:0009410 (response to xenobiotic stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0010033 (response to organic substance), GO:0009891 (positive regulation of biosynthetic process), GO:0051173 (positive regulation of nitrogen compound metabolic process), GO:0010557 (positive regulation of macromolecule biosynthetic process), GO:0045935 (positive regulation of nucleobase-containing compound metabolic process), GO:0051254 (positive regulation of RNA metabolic process), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0014070 (response to organic cyclic compound), GO:0051252 (regulation of RNA metabolic process), GO:0031328 (positive regulation of cellular biosynthetic process), GO:0010468 (regulation of gene expression), GO:1902680 (positive regulation of RNA biosynthetic process), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0045893 (positive regulation of DNA-templated transcription), GO:1903508 (positive regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:0005667 (transcription regulator complex), GO:0043235 (receptor complex), GO:0140535 (intracellular protein-containing complex)
Q8R4S4
Aryl hydrocarbon receptor
Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Regulates a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. Xenobiotics can act as ligands: upon xenobiotic-binding, activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Next to xenobiotics, natural ligands derived from plants, microbiota, and endogenous metabolism are potent AHR agonists. Tryptophan (Trp) derivatives constitute an important class of endogenous AHR ligands. Acts as a negative regulator of anti-tumor immunity: indoles and kynurenic acid generated by Trp catabolism act as ligand and activate AHR, thereby promoting AHR-driven cancer cell motility and suppressing adaptive immunity. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription
Mus spicilegus (Steppe mouse)
854
Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus
MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTDSAQGVDEAHGPPQAAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGQLILGYTEVELCTRGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAKHSRWRWVQSNARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSMSLPFMFATGEAVLYEISSPFSPIMDPLPIRTKSNTSRKDWAPQSTPSKDSFHPSSLMSALIQQDESIYLCPPSSPAPLDSHFLMGSVSKCGSWQDSFAATGSEAALKHEQIGHAQDVNLALSGGPSELFPDNKNNDLYSIMRNLGIDFEDIRSMQNEEFFRTDSTAAAAGEVDFKDIDITDEILTYVQDSLNNSTLLNSACQQQPVTQHLSCMLQERLQLEQQQQLQQPPPQALEPQQQLCQMVCPQQDLGPKHTQINGTFASWNPTPPVSFNCPQQELKHYQLFSSLQGTAQEFPYKPEVDSVPYTQNFAPCNQPLLPEHSKSVQLDFPGRDFEPSLHPTTSNLDFVSCLQVPENQSHGINSQSAMVSPQAYYAGAMSMYQCQPGPQRTPVDQTQYSSEIPGSQAFLSKVQSRGVFNETYSSDLSSIGHAAQTTGHLHHLAEAQPLPDITPGGFL
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613", "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226"...
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613" ]
[ "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110" ]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q8R4S4-F1-model_v6.pdb
null
null
[ "IPR036638", "IPR035965", "IPR033348", "IPR013767", "IPR011598", "IPR000014", "IPR013655", "IPR001610", "IPR039091" ]
{"IPR036638": [30, 80], "IPR035965": [120, 386], "IPR039091": [6, 803], "IPR011598": [26, 87], "IPR033348": [27, 87], "IPR000014": [111, 384], "IPR013767": [112, 184], "IPR013655": [297, 380], "IPR001610": [346, 387]}
- IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [30-80] - IPR035965: PAS domain superfamily (homologous_superfamily) [120-386] - IPR033348: Aryl hydrocarbon receptor, basic helix-loop-helix domain (domain) [27-87] - IPR013767: PAS fold (domain) [112-184] - IPR011598: Myc-type, basic helix-loop-helix (bHLH) domain (domain) [26-87] - IPR000014: PAS domain (domain) [111-384] - IPR013655: PAS fold-3 (domain) [297-380] - IPR001610: PAC motif (repeat) [346-387] - IPR039091: Aryl hydrocarbon receptor/Aryl hydrocarbon receptor repressor (family) [6-803]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0038023 (signaling receptor activity), GO:0005515 (protein binding), GO:0008134 (transcription factor binding), GO:0004879 (nuclear receptor activity), GO:0051087 (chaperone binding), GO:0042802 (identical protein binding), GO:0003676 (nucleic acid binding), GO:0031072 (heat shock protein binding), GO:0098531 (ligand-activated transcription factor activity), GO:0005102 (signaling receptor binding), GO:0046983 (protein dimerization activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0051879 (Hsp90 protein binding), GO:0001067 (transcription regulatory region nucleic acid binding), GO:0046982 (protein heterodimerization activity), GO:0140297 (DNA-binding transcription factor binding), GO:0042803 (protein homodimerization activity), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding), GO:0000976 (transcription cis-regulatory region binding), GO:0061629 (RNA polymerase II-specific DNA-binding transcription factor binding), GO:0003690 (double-stranded DNA binding), GO:1990837 (sequence-specific double-stranded DNA binding), GO:0000987 (cis-regulatory region sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0042221 (response to chemical), GO:0048522 (positive regulation of cellular process), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0009893 (positive regulation of metabolic process), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0031325 (positive regulation of cellular metabolic process), GO:0009410 (response to xenobiotic stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0010033 (response to organic substance), GO:0009891 (positive regulation of biosynthetic process), GO:0051173 (positive regulation of nitrogen compound metabolic process), GO:0010557 (positive regulation of macromolecule biosynthetic process), GO:0045935 (positive regulation of nucleobase-containing compound metabolic process), GO:0051254 (positive regulation of RNA metabolic process), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0014070 (response to organic cyclic compound), GO:0051252 (regulation of RNA metabolic process), GO:0031328 (positive regulation of cellular biosynthetic process), GO:0010468 (regulation of gene expression), GO:1902680 (positive regulation of RNA biosynthetic process), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0045893 (positive regulation of DNA-templated transcription), GO:1903508 (positive regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q8R4S2
Aryl hydrocarbon receptor
Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Regulates a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. Xenobiotics can act as ligands: upon xenobiotic-binding, activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Next to xenobiotics, natural ligands derived from plants, microbiota, and endogenous metabolism are potent AHR agonists. Tryptophan (Trp) derivatives constitute an important class of endogenous AHR ligands. Acts as a negative regulator of anti-tumor immunity: indoles and kynurenic acid generated by Trp catabolism act as ligand and activate AHR, thereby promoting AHR-driven cancer cell motility and suppressing adaptive immunity. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription
Mus spretus (Western Mediterranean mouse) (Algerian mouse)
854
Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus
MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQNLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTDSAQGVDEAHGPPQAAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGQLILGYTEVELCTRGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAKHSRWRWVQSNARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSMSLPFMFATGEAVLYEISSPFSPIMDPLPIRTKSNTSRKDWAPQSTPSKDSFHPSSLMSALIQQDESIYLCPPSSPAPLDSHFLMGSVSKCGSWQDSFAATGSEAALKHEQIGHAQDVNLALSGGPSELFPDNKNNDLYSIMRDLGIDFEDIRSMQNEEFFRTDSTAAAAGEVDFKDIDITDEILTYVQDSLNNSTLLNSACQQQPVTQHLSCMLQERLQLEQQQQLQQPPPQALEPQQQLCQMVCPQQDLGPKHTQINGTFASWNPTPPVSFNCPQQELKHYQIFSSLQGTAQEFPYKPEVDSVPYTQNFAPCNQPLLPEHSKSVQLDFPGRDFEPSLHPTTSNLDFVSCLQVPENQSHGINSQSAMVSPQAYYAGAMSMYQCQPGPQRTPVDQTQYGSEIPGSQAFLSKVQSRGVFNETYSSDLSSIGHAAQTTGHLHHLAEARPLPDITPGGFL
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613", "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226"...
[ "GO:0008150", "GO:0009987", "GO:0042221", "GO:0050896", "GO:0051716", "GO:0070887", "GO:1904612", "GO:1904613" ]
[ "GO:0000981", "GO:0003674", "GO:0003700", "GO:0004879", "GO:0038023", "GO:0060089", "GO:0098531", "GO:0140110" ]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q8R4S2-F1-model_v6.pdb
null
null
[ "IPR036638", "IPR035965", "IPR033348", "IPR013767", "IPR011598", "IPR000014", "IPR013655", "IPR001610", "IPR039091" ]
{"IPR036638": [30, 80], "IPR035965": [120, 386], "IPR039091": [6, 806], "IPR011598": [26, 87], "IPR033348": [27, 87], "IPR000014": [109, 384], "IPR013767": [112, 184], "IPR013655": [297, 380], "IPR001610": [346, 387]}
- IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [30-80] - IPR035965: PAS domain superfamily (homologous_superfamily) [120-386] - IPR033348: Aryl hydrocarbon receptor, basic helix-loop-helix domain (domain) [27-87] - IPR013767: PAS fold (domain) [112-184] - IPR011598: Myc-type, basic helix-loop-helix (bHLH) domain (domain) [26-87] - IPR000014: PAS domain (domain) [109-384] - IPR013655: PAS fold-3 (domain) [297-380] - IPR001610: PAC motif (repeat) [346-387] - IPR039091: Aryl hydrocarbon receptor/Aryl hydrocarbon receptor repressor (family) [6-806]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0038023 (signaling receptor activity), GO:0005515 (protein binding), GO:0008134 (transcription factor binding), GO:0004879 (nuclear receptor activity), GO:0051087 (chaperone binding), GO:0042802 (identical protein binding), GO:0003676 (nucleic acid binding), GO:0031072 (heat shock protein binding), GO:0098531 (ligand-activated transcription factor activity), GO:0005102 (signaling receptor binding), GO:0046983 (protein dimerization activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0051879 (Hsp90 protein binding), GO:0001067 (transcription regulatory region nucleic acid binding), GO:0046982 (protein heterodimerization activity), GO:0140297 (DNA-binding transcription factor binding), GO:0042803 (protein homodimerization activity), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding), GO:0000976 (transcription cis-regulatory region binding), GO:0061629 (RNA polymerase II-specific DNA-binding transcription factor binding), GO:0003690 (double-stranded DNA binding), GO:1990837 (sequence-specific double-stranded DNA binding), GO:0000987 (cis-regulatory region sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0042221 (response to chemical), GO:0048522 (positive regulation of cellular process), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0009893 (positive regulation of metabolic process), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0031325 (positive regulation of cellular metabolic process), GO:0009410 (response to xenobiotic stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0010033 (response to organic substance), GO:0009891 (positive regulation of biosynthetic process), GO:0051173 (positive regulation of nitrogen compound metabolic process), GO:0010557 (positive regulation of macromolecule biosynthetic process), GO:0045935 (positive regulation of nucleobase-containing compound metabolic process), GO:0051254 (positive regulation of RNA metabolic process), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0014070 (response to organic cyclic compound), GO:0051252 (regulation of RNA metabolic process), GO:0031328 (positive regulation of cellular biosynthetic process), GO:0010468 (regulation of gene expression), GO:1902680 (positive regulation of RNA biosynthetic process), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0045893 (positive regulation of DNA-templated transcription), GO:1903508 (positive regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q09701
Palmitoyltransferase akr1
Palmitoyltransferase specific for casein kinase 1
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
642
Early endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein
MGSLFLAASQGELDTVKNLISSEKIDVNATDEGGATALHWAALNQQIPICKFLLEHGADVNAIGGDLQAAPIHWAAKRGSVKTVHYLVQHGADPLLKDKQGFNCLHLAVHAASPLLVVYLLHLDISVDLRDDQQHTPLMWASYHGNEPITNCLLRWGADVLATDEDKMTPLHWSIVGGNLKCMKLILKEGGIPCTAVTANLSGQLKTPWALASELRVSHLFKQALISNGLKVKETSEEPEKWVVVPSKFQFSQKTFIIFCFLSSFIITGVFFFIMSICPMVISLIIAPLWIYFTFKYITTCIHANIDIVHFYLETPFLAGIFSSIFFWVWCHSLLYIVPKTLPIKPLSSLLFVLISFTCIGLYVRTAFQNPGYVDKIGAVVQRREEISKLLDKDLFNQSHYCLKCFQVKPPRSYHCGACKRCINRYDHHCPWTGNCVGARNHRTFLLFVFTLSTLIPIYFYVAFYYLQNIPIQKKYESYRCLFISGTICQWSLKDMFVLVASLTLFVNWCWVVVLAFTQICQVAHNVTTAEFRLFKRYGTLVPPTKQNSSPKNGHGIHGSFLRTVCGILGLDQCILLIRESNCFVRCFPSRAELGSQNSTSLSRNLSTVNPYDEGSIIKNCKTFWKQNFLNDGRQDEATRHV
[ "GO:0003674", "GO:0003824", "GO:0016409", "GO:0016417", "GO:0016740", "GO:0016746", "GO:0016747", "GO:0019706", "GO:0019707", "GO:0140096" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0016409", "GO:0016417", "GO:0016740", "GO:0016746", "GO:0016747", "GO:0019706", "GO:0019707", "GO:0140096" ]
[]
AF-Q09701-F1-model_v6.pdb
284812.Q09701
[ "O43028", "O60069" ]
[ "IPR036770", "IPR002110", "IPR001594" ]
{"IPR036770": [1, 224], "IPR001594": [396, 532], "IPR002110": [1, 196]}
- Vacuolar protein 8 - Palmitoyltransferase swf1
- IPR036770: Ankyrin repeat-containing domain superfamily (homologous_superfamily) [1-224] - IPR002110: Ankyrin repeat (repeat) [1-196] - IPR001594: Palmitoyltransferase, DHHC domain (domain) [396-532]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0005515 (protein binding), GO:0016746 (acyltransferase activity), GO:0016747 (acyltransferase activity, transferring groups other than amino-acyl groups), GO:0016409 (palmitoyltransferase activity) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0051179 (localization), GO:0051234 (establishment of localization), GO:0051641 (cellular localization), GO:0033036 (macromolecule localization), GO:0051668 (localization within membrane), GO:0070727 (cellular macromolecule localization), GO:0045184 (establishment of protein localization), GO:0090150 (establishment of protein localization to membrane), GO:0072657 (protein localization to membrane), GO:0008104 (protein localization), GO:1990778 (protein localization to cell periphery), GO:0061951 (establishment of protein localization to plasma membrane), GO:0072659 (protein localization to plasma membrane) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0005794 (Golgi apparatus), GO:0005773 (vacuole), GO:0031090 (organelle membrane), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0000323 (lytic vacuole), GO:0043231 (intracellular membrane-bounded organelle), GO:0005774 (vacuolar membrane), GO:0098588 (bounding membrane of organelle), GO:0000322 (storage vacuole), GO:0000324 (fungal-type vacuole), GO:0098852 (lytic vacuole membrane), GO:0000329 (fungal-type vacuole membrane)
Q6UXT8
ALK and LTK ligand 1
Cytokine that acts as a physiological ligand for receptor tyrosine kinase LTK, leading to its activation. Monomeric ALKAL1 binds to LTK, leading to LTK homodimerization and activation. In contrast to ALKAL2, does not act as a potent physiological ligand for ALK
Homo sapiens (Human)
129
Secreted. Cell membrane. Note=Following interaction with receptor tyrosine kinase LTK, associates with the cell membrane, membrane-binding is required to activate LTK
MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
[ "GO:0005575", "GO:0005576", "GO:0005615", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005576", "GO:0005615", "GO:0110165" ]
AF-Q6UXT8-F1-model_v6.pdb
9606.ENSP00000351345
[ "P29376" ]
[ "IPR029364" ]
{"IPR029364": [21, 129]}
- Leukocyte tyrosine kinase receptor
- IPR029364: ALK and LTK ligand 1/2 (family) [21-129]
Molecular Function (MF): GO:0003674 (molecular function), GO:0098772 (molecular function regulator activity), GO:0005488 (binding), GO:0030234 (enzyme regulator activity), GO:0140677 (molecular function activator activity), GO:0030545 (signaling receptor regulator activity), GO:0005515 (protein binding), GO:0005102 (signaling receptor binding), GO:0019207 (kinase regulator activity), GO:0008047 (enzyme activator activity), GO:0030546 (signaling receptor activator activity), GO:0048018 (receptor ligand activity), GO:0019209 (kinase activator activity), GO:0019887 (protein kinase regulator activity), GO:0030295 (protein kinase activator activity), GO:0005125 (cytokine activity), GO:0030296 (protein tyrosine kinase activator activity) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0008219 (cell death), GO:0012501 (programmed cell death), GO:0006915 (apoptotic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005576 (extracellular region)
Q8BS35
Alkylglycerol monooxygenase
Glyceryl-ether monooxygenase that cleaves the O-alkyl bond of ether lipids. Ether lipids are essential components of brain membranes (By similarity)
Mus musculus (Mouse)
447
Endoplasmic reticulum membrane; Multi-pass membrane protein
MRSPGAQDNVSVSQGMRAMFYMMEPSETAFQTVEEVPDYVKKATPFFIFLILLELVISWILKGKPSGRLDDALTSISAGVVSRLPSLFFRSLEVTSYIYIWENYRLLELPWDSTWTWYFTFLGVDFGYYWFHRMAHEINIFWAAHQAHHSSEDYNLSTALRQSVLQQYSSWVFYCPLALFIPPSVFAVHIQFNLLYQFWIHTEIIRTLGPLEVILNTPSHHRVHHGRNRYCIDKNYAGTLIIWDRIFGTFEAENEQVIYGLTHPIGTFEPFNVQFHHLLYIWTTFWTTPGFCHKFSVLFKGPGWGPGKPRLGLSEEIPEVTGQEVPFSSSASQLLKIYTVLQFAVMLAFYEETFANTAVLSQVTLLLRIFFFILTLTSIGFLLDQRSKAATMETFRCLLFLTLHRFGHLKPLIPSLSFAFEIFFSVCIAFWGVRSITQLTSGSWKKP
[ "GO:0006629", "GO:0006638", "GO:0006639", "GO:0006641", "GO:0008150", "GO:0008152", "GO:0008610", "GO:0009058", "GO:0009987", "GO:0019432", "GO:0044238", "GO:0045017", "GO:0046460", "GO:0046463", "GO:0046486", "GO:0003674", "GO:0003824", "GO:0004497", "GO:0016491", "GO:0016705"...
[ "GO:0006629", "GO:0006638", "GO:0006639", "GO:0006641", "GO:0008150", "GO:0008152", "GO:0008610", "GO:0009058", "GO:0009987", "GO:0019432", "GO:0044238", "GO:0045017", "GO:0046460", "GO:0046463", "GO:0046486" ]
[ "GO:0003674", "GO:0003824", "GO:0004497", "GO:0016491", "GO:0016705", "GO:0016714", "GO:0050479" ]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005783", "GO:0005789", "GO:0012505", "GO:0016020", "GO:0031090", "GO:0031984", "GO:0042175", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0098827", "GO:0110165" ]
AF-Q8BS35-F1-model_v6.pdb
10090.ENSMUSP00000051441
null
[ "IPR056853", "IPR006694", "IPR051689" ]
{"IPR051689": [7, 445], "IPR006694": [118, 249], "IPR056853": [335, 422]}
- IPR056853: Alkylglycerol monooxygenase, C-terminal (domain) [335-422] - IPR006694: Fatty acid hydroxylase (domain) [118-249] - IPR051689: Sterol desaturase/TMEM195-like (family) [7-445]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity), GO:0016705 (oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen), GO:0016714 (oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0044238 (primary metabolic process), GO:0044255 (cellular lipid metabolic process), GO:0044249 (cellular biosynthetic process), GO:0018904 (ether metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006629 (lipid metabolic process), GO:0006662 (glycerol ether metabolic process), GO:0006638 (neutral lipid metabolic process), GO:0046460 (neutral lipid biosynthetic process), GO:0046486 (glycerolipid metabolic process), GO:0008610 (lipid biosynthetic process), GO:0045017 (glycerolipid biosynthetic process), GO:0046485 (ether lipid metabolic process), GO:0006643 (membrane lipid metabolic process), GO:0046463 (acylglycerol biosynthetic process), GO:0006639 (acylglycerol metabolic process), GO:0006641 (triglyceride metabolic process), GO:0019432 (triglyceride biosynthetic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0031984 (organelle subcompartment), GO:0042175 (nuclear outer membrane-endoplasmic reticulum membrane network), GO:0031090 (organelle membrane), GO:0005783 (endoplasmic reticulum), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0098827 (endoplasmic reticulum subcompartment), GO:0043231 (intracellular membrane-bounded organelle), GO:0005789 (endoplasmic reticulum membrane)
P0A6B4
Alanine racemase, biosynthetic
Catalyzes the interconversion of L-alanine and D-alanine. Provides the D-alanine required for cell wall biosynthesis
Escherichia coli (strain K12)
359
null
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
[ "GO:0006082", "GO:0006520", "GO:0006522", "GO:0006523", "GO:0008150", "GO:0008152", "GO:0008652", "GO:0009058", "GO:0009987", "GO:0016053", "GO:0019752", "GO:0030632", "GO:0043436", "GO:0044238", "GO:0044281", "GO:0044283", "GO:0046394", "GO:0046416", "GO:0046436", "GO:0046437"...
[ "GO:0006082", "GO:0006520", "GO:0006522", "GO:0006523", "GO:0008150", "GO:0008152", "GO:0008652", "GO:0009058", "GO:0009987", "GO:0016053", "GO:0019752", "GO:0030632", "GO:0043436", "GO:0044238", "GO:0044281", "GO:0044283", "GO:0046394", "GO:0046416", "GO:0046436", "GO:0046437"...
[ "GO:0003674", "GO:0003824", "GO:0005488", "GO:0005515", "GO:0008784", "GO:0016853", "GO:0016854", "GO:0016855", "GO:0019842", "GO:0030170", "GO:0036094", "GO:0042802", "GO:0042803", "GO:0043167", "GO:0043168", "GO:0046983", "GO:0047661", "GO:0070279", "GO:1901363" ]
[]
AF-P0A6B4-F1-model_v6.pdb
511145.b4053
[ "Q2M6Q2", "Q2M8R2", "Q2M923", "P77636", "P78246", "P17952", "P29011", "P07862", "P77727", "Q2MC44", "P14900", "P22188" ]
[ "IPR000821", "IPR011079", "IPR009006", "IPR029066", "IPR020622", "IPR001608" ]
{"IPR029066": [8, 235], "IPR009006": [215, 359], "IPR000821": [1, 359], "IPR001608": [8, 219], "IPR011079": [234, 358], "IPR020622": [31, 41]}
- D-alanine--D-alanine ligase B - D-alanine--D-alanine ligase A - UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase - Alanine racemase, catabolic - D-amino acid dehydrogenase - D-amino acid dehydrogenase - D-amino acid dehydrogenase - Glutamate-pyruvate aminotransferase AlaA - Glutamate-pyruvate aminotransferase AlaA - Glutamate-pyruvate aminotransferase AlaA
- IPR000821: Alanine racemase (family) [1-359] - IPR011079: Alanine racemase, C-terminal (domain) [234-358] - IPR009006: Alanine racemase/group IV decarboxylase, C-terminal (homologous_superfamily) [215-359] - IPR029066: PLP-binding barrel (homologous_superfamily) [8-235] - IPR020622: Alanine racemase, pyridoxal-phosphate attachment site (binding_site) [31-41] - IPR001608: Alanine racemase, N-terminal (domain) [8-219]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016853 (isomerase activity), GO:0016854 (racemase and epimerase activity), GO:0016855 (racemase and epimerase activity, acting on amino acids and derivatives), GO:0036361 (racemase activity, acting on amino acids and derivatives), GO:0047661 (amino-acid racemase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0071704 (organic substance metabolic process), GO:0009056 (catabolic process), GO:0044238 (primary metabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:0044282 (small molecule catabolic process), GO:0006082 (organic acid metabolic process), GO:0044248 (cellular catabolic process), GO:0006520 (amino acid metabolic process), GO:1901575 (organic substance catabolic process), GO:0016054 (organic acid catabolic process), GO:1901565 (organonitrogen compound catabolic process), GO:0043436 (oxoacid metabolic process), GO:0009063 (amino acid catabolic process), GO:1901605 (alpha-amino acid metabolic process), GO:0019752 (carboxylic acid metabolic process), GO:0009078 (pyruvate family amino acid metabolic process), GO:1901606 (alpha-amino acid catabolic process), GO:0046395 (carboxylic acid catabolic process), GO:0009069 (serine family amino acid metabolic process), GO:0009071 (serine family amino acid catabolic process), GO:0046416 (D-amino acid metabolic process), GO:0006522 (alanine metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
Q59L12
Agglutinin-like protein 3
Cell surface adhesion protein which mediates both yeast-to- host tissue adherence and yeast aggregation. Plays an important role in the biofilm formation and pathogenesis of C.albicans infections. Necessary for C.albicans to bind to N-cadherin on endothelial cells and E-cadherin on oral epithelial cells and subsequent endocytosis by these cells. During disseminated infection, mediates initial trafficking to the brain and renal cortex and contributes to fungal persistence in the kidneys
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,155
Cell membrane; Lipid-anchor, GPI-anchor. Secreted, cell wall. Note=Covers the surface of the germ tube
MLQQYTLLLIYLSVATAKTITGVFNSFNSLTWSNAATYNYKGPGTPTWNAVLGWSLDGTSASPGDTFTLNMPCVFKFTTSQTSVDLTAHGVKYATCQFQAGEEFMTFSTLTCTVSNTLTPSIKALGTVTLPLAFNVGGTGSSVDLEDSKCFTAGTNTVTFNDGGKKISINVDFERSNVDPKGYLTDSRVIPSLNKVSTLFVAPQCANGYTSGTMGFANTYGDVQIDCSNIHVGITKGLNDWNYPVSSESFSYTKTCSSNGIFITYKNVPAGYRPFVDAYISATDVNSYTLSYANEYTCAGGYWQRAPFTLRWTGYRNSDAGSNGIVIVATTRTVTDSTTAVTTLPFDPNRDKTKTIEILKPIPTTTITTSYVGVTTSYSTKTAPIGETATVIVDIPYHTTTTVTSKWTGTITSTTTHTNPTDSIDTVIVQVPSPNPTVTTTEYWSQSFATTTTITGPPGNTDTVLIREPPNHTVTTTEYWSESYTTTSTFTAPPGGTDSVIIKEPPNPTVTTTEYWSESYTTTTTVTAPPGGTDTVIIREPPNHTVTTTEYWSQSYTTTTTVIAPPGGTDSVIIREPPNPTVTTTEYWSQSYATTTTITAPPGETDTVLIREPPNHTVTTTEYWSQSYATTTTITAPPGETDTVLIREPPNHTVTTTEYWSQSYTTTTTVIAPPGGTDSVIIKEPPNPTVTTTEYWSQSYATTTTITAPPGETDTVLIREPPNHTVTTTEYWSQSYATTTTITAPPGETDTVLIREPPNHTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNHTVTTTEYWSQSFATTTTIIAPPGETDTVLIREPPNPTVTTTEYWSQSYTTATTVTAPPGGTDTVIIYDTMSSSEISSFSRPHYTNHTTLWSTTWVIETKTITETSCEGDKGCSWVSVSTRIVTIPNNIETPMVTNTVDTTTTESTLQSPSGIFSESGVSVETESSTFTTAQTNPSVPTTESEVVFTTKGNNGNGPYESPSTNVKSSMDENSEFTTSTAASTSTDIENETIATTGSVEASSPIISSSADETTTVTTTAESTSVIEQQTNNNGGGNAPSATSTSSPSTTTTANSDSVITSTTSTNQSQSQSNSDTQQTTLSQQMTSSLVSLHMLTTFDGSGSVIQHSTWLCGLITLLSLFI
[ "GO:0000041", "GO:0006810", "GO:0006811", "GO:0006812", "GO:0006826", "GO:0006873", "GO:0006878", "GO:0006879", "GO:0006897", "GO:0007155", "GO:0008150", "GO:0009595", "GO:0009602", "GO:0009603", "GO:0009605", "GO:0009607", "GO:0009608", "GO:0009610", "GO:0009620", "GO:0009987"...
[ "GO:0000041", "GO:0006810", "GO:0006811", "GO:0006812", "GO:0006826", "GO:0006873", "GO:0006878", "GO:0006879", "GO:0006897", "GO:0007155", "GO:0008150", "GO:0009595", "GO:0009602", "GO:0009603", "GO:0009605", "GO:0009607", "GO:0009608", "GO:0009610", "GO:0009620", "GO:0009987"...
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0030984", "GO:0030985", "GO:0050839" ]
[ "GO:0005575", "GO:0005576", "GO:0005618", "GO:0009277", "GO:0009986", "GO:0030312", "GO:0030445", "GO:0030446", "GO:0031982", "GO:0043226", "GO:0043227", "GO:0043230", "GO:0065010", "GO:0071944", "GO:0110165", "GO:1903561" ]
AF-Q59L12-F1-model_v6.pdb
237561.Q59L12
[ "Q59NP5", "Q59Y31", "Q5A0E5", "G1UBC2", "Q5A8N2", "Q5ANJ4", "Q5AD07", "Q59ME1", "G1UB67", "Q59U34", "Q59TP1", "Q59PF9", "Q5ABE2", "Q59PG4", "Q9HFZ1", "Q5A8I8", "Q5ABW5", "Q59XB5", "Q5ACC9", "Q59TL7", "Q59XU5", "Q59WZ4", "Q5ALC8", "Q5AB65" ]
[ "IPR008966", "IPR043063", "IPR008440", "IPR033504", "IPR024672", "IPR011252" ]
{"IPR011252": [17, 177], "IPR008966": [24, 174], "IPR043063": [178, 329], "IPR033504": [1, 693], "IPR024672": [53, 298], "IPR008440": [365, 863]}
- Extent of cell elongation protein 1 - Hyphal wall protein 1 - Hyphally regulated cell wall protein 1 - Cell wall protein RBT1 - Enhanced filamentous growth protein 1 - Biofilm and cell wall regulator 1 - Transcriptional regulatory protein UME6 - Secreted aspartic protease 4 - Secreted aspartic protease 5 - Cell wall adhesin EAP1
- IPR008966: Adhesion domain superfamily (homologous_superfamily) [24-174] - IPR043063: Agglutinin-like protein, N-terminal, N2 subdomain (homologous_superfamily) [178-329] - IPR008440: Agglutinin-like protein repeat (repeat) [365-863] - IPR033504: Agglutinin-like protein (family) [1-693] - IPR024672: Agglutinin-like protein, N-terminal (domain) [53-298] - IPR011252: Fibrogen-binding domain 1 (homologous_superfamily) [17-177]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0033218 (amide binding), GO:0050840 (extracellular matrix binding), GO:0005515 (protein binding), GO:0042277 (peptide binding), GO:0001968 (fibronectin binding), GO:0043236 (laminin binding) Biological Process (BP): GO:0008150 (biological process), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0042592 (homeostatic process), GO:0040007 (growth), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0009987 (cellular process), GO:0009605 (response to external stimulus), GO:0009628 (response to abiotic stimulus), GO:0048584 (positive regulation of response to stimulus), GO:0007155 (cell adhesion), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:0035821 (modulation of process of another organism), GO:0044403 (biological process involved in symbiotic interaction), GO:0048878 (chemical homeostasis), GO:0019725 (cellular homeostasis), GO:0009607 (response to biotic stimulus), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0051707 (response to other organism), GO:0048522 (positive regulation of cellular process), GO:0050801 (monoatomic ion homeostasis), GO:0030448 (hyphal growth), GO:0043207 (response to external biotic stimulus), GO:0052173 (response to defenses of other organism), GO:0098609 (cell-cell adhesion), GO:0080134 (regulation of response to stress), GO:0030155 (regulation of cell adhesion), GO:0075136 (response to host), GO:0098771 (inorganic ion homeostasis), GO:0045785 (positive regulation of cell adhesion), GO:0090609 (single-species submerged biofilm formation), GO:0051701 (biological process involved in interaction with host), GO:0055082 (intracellular chemical homeostasis), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0098630 (aggregation of unicellular organisms), GO:0104004 (cellular response to environmental stimulus), GO:0071214 (cellular response to abiotic stimulus), GO:0044003 (modulation by symbiont of host process), GO:0009268 (response to pH), GO:0031349 (positive regulation of defense response), GO:0031589 (cell-substrate adhesion), GO:0031347 (regulation of defense response), GO:0052200 (response to host defenses), GO:0022409 (positive regulation of cell-cell adhesion), GO:0022407 (regulation of cell-cell adhesion), GO:0036176 (response to neutral pH), GO:0044000 (movement in host), GO:0043709 (cell adhesion involved in single-species biofilm formation), GO:0052031 (modulation by symbiont of host defense response), GO:0043708 (cell adhesion involved in biofilm formation), GO:0006873 (intracellular monoatomic ion homeostasis), GO:0044416 (induction by symbiont of host defense response), GO:0071467 (cellular response to pH), GO:0044406 (adhesion of symbiont to host), GO:0036177 (filamentous growth of a population of unicellular organisms in response to pH), GO:0055080 (monoatomic cation homeostasis), GO:0055070 (copper ion homeostasis), GO:0042710 (biofilm formation), GO:0030003 (intracellular monoatomic cation homeostasis), GO:0006878 (intracellular copper ion homeostasis), GO:0036178 (filamentous growth of a population of unicellular organisms in response to neutral pH), GO:0090605 (submerged biofilm formation), GO:0036244 (cellular response to neutral pH), GO:0044409 (entry into host) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0009986 (cell surface), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0005576 (extracellular region), GO:0005618 (cell wall), GO:0009277 (fungal-type cell wall), GO:0030446 (hyphal cell wall), GO:0030445 (yeast-form cell wall)
Q5A8T7
Agglutinin-like protein 5
Cell surface adhesion protein which mediates both yeast-to- host tissue adherence and yeast aggregation. Plays an important role in the pathogenesis of C.albicans infections. Forms amyloid structures, essential for cell-cell association and cell-substrate adhesion to polystyrene
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,347
Cell membrane; Lipid-anchor, GPI-anchor. Secreted, cell wall. Note=Identified as covalently-linked GPI-modified cell wall protein (GPI-CWP) in the outer cell wall layer
MIQQFTLLFLYLSFATAKAITGIFNSIDSLTWSNAGNYAFKGPGYPTWNAVLGWSLDGTSANPGDTFILNMPCVFKFTASQKSVDLTADGVKYATCQFYSGEEFTTFSSLKCTVNNNLRSSIKALGTVTLPIAFNVGGTGSSVDLEDSKCFTAGTNTVTFNDGSKKLSIAVNFEKSTVDQSGYLTTSRFMPSLNKIATLYVAPQCENGYTSGTMGFSTSYGDVAIDCSNVHIGISKGVNDWNHPVTSESFSYTKSCSSFGISITYQNVPAGYRPFIDAYISPSDNNQYQLSYKNDYTCVDDYWQHAPFTLKWTGYKNSDAGSNGIVIVATTRTVTDSTTAVTTLPFNPSVDKTKTIEILQPIPTTTITTSYVGVTTSYSTKTAPIGETATVIVDVPYHTTTTVTSEWTGTITTTTTRTNPTDSIDTVVVQVPLPNPTTTTTQFWSESFTSTTTITNSLKGTDSVIVREPHNPTVTTTEFWSESYATTETITNGPEGTDSVIVREPHNPTVTTTEFWSESYATTETVTNKPEGTDSVIIKEPHNPTVTTTEFWSESYATTETITTGPLGTDSIVIHDPLEESSSTTAIESSDSNISSSAQESSSSVEQSSSIVGLSSSSDIPLSSDMPSSSSTGLTSSESSTVSSYDSDSSSSSELSTFSSSESYSSSISDTTNFWDSSSSDLESTSITWSSSIDAQSSQSVQSVSNSISTSQETTSSSGEESNTSVTDILVSSDASSILNSDISSYYPSSTISLSDDFPHTIAGEPDSRSSSSIASTVEISSDLVSLTSDPTSSFDSSSSLNSDSSSSPFSDESDISASSSFSTLVAPSFSLSSSSSLSLTYPHYVNSTTYHASESESSSVASPSMASESANDDTHTLSESTDTTSSIGTDSSTVTFCRRDNGDGCIVTGMPSSSIDSEQTSDVTTTSSFVASSTPTSAEQSITDNPNIDSSQTSASSSTKSSVSVSDTVVNSISLSETSTLSSDDSTSSDTSISSTTNSDTGNINAGSSHTSTASIKESSIQKTGVMLSSSYLSTKLSSTSDITTELITTELITTELTTIEDNEPNTFTSTPSSHSEIFSSDNSVLSKQVDRESTIKTSPTTDVTTVSSLSVHSTEASTATLGENSFSNVASTPSNIATSLRSTSSSSNHATESSGTVKSEASAEAIPSPPTSTDNRLSYSTEEAKGITYANSGSTNNLITESQVAAPTDSTSVLIENPVVTSTFDDNSSAAVDQPSKTKSIEESIMNPDSTNETNNGFIATLSQAQVPNSLIHSESISTTMAKTTDASINGDSAASNSQPTTLIQQVATSSYNQPLITTYAGSSSATKHPSWLLKFISVALFFFL
[ "GO:0007155", "GO:0007160", "GO:0008150", "GO:0009987", "GO:0031589", "GO:0042710", "GO:0043708", "GO:0043709", "GO:0043710", "GO:0044010", "GO:0044399", "GO:0044403", "GO:0044406", "GO:0044409", "GO:0044419", "GO:0051701", "GO:0051703", "GO:0090605", "GO:0090609", "GO:0098609"...
[ "GO:0007155", "GO:0007160", "GO:0008150", "GO:0009987", "GO:0031589", "GO:0042710", "GO:0043708", "GO:0043709", "GO:0043710", "GO:0044010", "GO:0044399", "GO:0044403", "GO:0044406", "GO:0044409", "GO:0044419", "GO:0051701", "GO:0051703", "GO:0090605", "GO:0090609", "GO:0098609"...
[ "GO:0001968", "GO:0003674", "GO:0005488", "GO:0005515", "GO:0042277" ]
[ "GO:0005575", "GO:0005618", "GO:0009277", "GO:0030312", "GO:0071944", "GO:0110165" ]
AF-Q5A8T7-F1-model_v6.pdb
237561.Q5A8T7
null
[ "IPR008966", "IPR043063", "IPR008440", "IPR033504", "IPR024672", "IPR011252" ]
{"IPR011252": [17, 177], "IPR008966": [25, 174], "IPR043063": [178, 329], "IPR033504": [1, 535], "IPR024672": [53, 298], "IPR008440": [365, 577]}
- IPR008966: Adhesion domain superfamily (homologous_superfamily) [25-174] - IPR043063: Agglutinin-like protein, N-terminal, N2 subdomain (homologous_superfamily) [178-329] - IPR008440: Agglutinin-like protein repeat (repeat) [365-577] - IPR033504: Agglutinin-like protein (family) [1-535] - IPR024672: Agglutinin-like protein, N-terminal (domain) [53-298] - IPR011252: Fibrogen-binding domain 1 (homologous_superfamily) [17-177]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0033218 (amide binding), GO:0050840 (extracellular matrix binding), GO:0005515 (protein binding), GO:0042277 (peptide binding), GO:0001968 (fibronectin binding), GO:0043236 (laminin binding) Biological Process (BP): GO:0008150 (biological process), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0042592 (homeostatic process), GO:0040007 (growth), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0009987 (cellular process), GO:0009605 (response to external stimulus), GO:0009628 (response to abiotic stimulus), GO:0048584 (positive regulation of response to stimulus), GO:0007155 (cell adhesion), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:0035821 (modulation of process of another organism), GO:0044403 (biological process involved in symbiotic interaction), GO:0048878 (chemical homeostasis), GO:0019725 (cellular homeostasis), GO:0009607 (response to biotic stimulus), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0051707 (response to other organism), GO:0048522 (positive regulation of cellular process), GO:0050801 (monoatomic ion homeostasis), GO:0030448 (hyphal growth), GO:0043207 (response to external biotic stimulus), GO:0052173 (response to defenses of other organism), GO:0098609 (cell-cell adhesion), GO:0080134 (regulation of response to stress), GO:0030155 (regulation of cell adhesion), GO:0075136 (response to host), GO:0098771 (inorganic ion homeostasis), GO:0045785 (positive regulation of cell adhesion), GO:0090609 (single-species submerged biofilm formation), GO:0051701 (biological process involved in interaction with host), GO:0055082 (intracellular chemical homeostasis), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0098630 (aggregation of unicellular organisms), GO:0104004 (cellular response to environmental stimulus), GO:0071214 (cellular response to abiotic stimulus), GO:0044003 (modulation by symbiont of host process), GO:0009268 (response to pH), GO:0031349 (positive regulation of defense response), GO:0031589 (cell-substrate adhesion), GO:0031347 (regulation of defense response), GO:0052200 (response to host defenses), GO:0022409 (positive regulation of cell-cell adhesion), GO:0022407 (regulation of cell-cell adhesion), GO:0036176 (response to neutral pH), GO:0044000 (movement in host), GO:0043709 (cell adhesion involved in single-species biofilm formation), GO:0052031 (modulation by symbiont of host defense response), GO:0043708 (cell adhesion involved in biofilm formation), GO:0006873 (intracellular monoatomic ion homeostasis), GO:0044416 (induction by symbiont of host defense response), GO:0071467 (cellular response to pH), GO:0044406 (adhesion of symbiont to host), GO:0036177 (filamentous growth of a population of unicellular organisms in response to pH), GO:0055080 (monoatomic cation homeostasis), GO:0055070 (copper ion homeostasis), GO:0042710 (biofilm formation), GO:0030003 (intracellular monoatomic cation homeostasis), GO:0006878 (intracellular copper ion homeostasis), GO:0036178 (filamentous growth of a population of unicellular organisms in response to neutral pH), GO:0090605 (submerged biofilm formation), GO:0036244 (cellular response to neutral pH), GO:0044409 (entry into host) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0009986 (cell surface), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0005576 (extracellular region), GO:0005618 (cell wall), GO:0009277 (fungal-type cell wall), GO:0030446 (hyphal cell wall), GO:0030445 (yeast-form cell wall)
Q5A312
Agglutinin-like protein 7
Cell surface adhesion protein which mediates both yeast-to- host tissue adherence and yeast aggregation. Plays an important role in the pathogenesis of C.albicans infections
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,568
Cell membrane; Lipid-anchor, GPI-anchor. Secreted, cell wall. Note=Identified as covalently-linked GPI-modified cell wall protein (GPI-CWP) in the outer cell wall layer
MKKLYLLYLLASFTTVISKEVTGVFNQFNSLIWSYTYRARYEEISTLTAKAQLEWALDGTIASPGDTFTLVMPCVYKFMTYETSVQLTANSIAYATCDFDAGEDTKSFSSLKCTVTDELTEDTSVFGSVILPIAFNVGGSGSKSTITDSKCFSSGYNTVTFFDGNNQLSTTANFLPRRELAFGLVVSQRLSMSLDTMTNFVMSTPCFMGYQSGKLGFTSNDDDFEIDCSSIHVGITNEINDWSMPVSSVPFDHTIRCTSRALYIEFKTIPAGYRPFVDAIVQIPTTEPFFVKYTNEFACVNGIYTSIPFTSFFSQPILYDEALAIGADLVRTTSTVIGSITRTTTLPFISRLQKTKTILVLEPIPTTTVTTSHHGFDTWYYTKKATIGDTATVFIDVPQHTATTLTTYWQESSTATTTYFDDIDLVDTVIVKIPYPNPTIITTQFWSGKYLTTETHKEPPLGTDSVIIKEPHNPTVTTTEFWSESFATTETITNNPEGTDSVIIKEPHNPTVTTTKFWSESFATTETITTGPLGTDSIVIHDPLEESSSSTAIESSDSNISSSAQDSSSSVEQSFTSADETSSIVELSSSSDIPSSSIGLTSSESSTVSSYDSYSSSTSESSIASSYDSYSSSSIESSTLSSSDRYSSSISDTTSFWDSSSSDLESTSITWSSSIDAQSSHLVQSVSNSISTSQEISSSSSEESSTSATDALVSSDASSILSSDTSSYYPSSTISPSDDFPHTIAGESDSQSFSFITSTVEISSDSVSLTSDPASSFDSSSRLNSDSSSSPSTDQRDILTSSSFSTLIKSSESRESSSGTILSEESSDSIPTTFSTRYWSPSGMSSRHYTNSTETSVSDVVSSSVAGDETSESSVSVTSESSESVTSESVASESVTSESVTAVSDISDLYTTSEEVSTSDSNSGMSSPIPSSEQRSSIPIMSSSDESSESRESSIGTILSEESSDSIPTTFSTRYWSPSGMSSRHYTNSTETSVSDVVSSSVAGDETSESSVSVISESSESVTSESVASESVTAVSDISDLYTTSEVVSTSDSKIVPSTSVPSSEQRSSIPIMSSSDESSESRESSSGTILSEENSDSIPTTFSTRYVSVSLTVGELSALPSLPGKLSHLPSSLSETSIGMTKSANLSPQFFSTSVDSALSYWASGSSSADHQSSATCDVSESSVEGNLSAMALGMSNSDDGLSEDTRSSSVAGKEEIELTSTNSVGEITLISYSSSSPTTHDHGRVSKSMGAAPLSSLFSVSVHAPLVTGLSDSDTFPSENSNRSRSFKESTDNTISISRESLGNPYSSISSPSDYDVKSFTTSRELVSSESILPFSDVMDANDMPTSGSNLHSMVFSISVLGEKFNANIEKHKNTNGHYSSMVFTYQSAGLEESDQRIAVTNTKFDQNKIDTTIDSNTFVTSLPFATTLNDQIDQAVPIKIPASSTAGFVSDVLKPDYSKSVQAESVQTDSTTYSEMMSSKRNKNSGFGTSSLNLKPTITVVTKSIDTKVNTMKEGGVSKQVSTTVTEQYDTSTYTPASLLVSDNSGSVSKYSLWMMAFYMLFGLF
[ "GO:0007155", "GO:0008150", "GO:0009987", "GO:0031589", "GO:0042710", "GO:0043708", "GO:0043709", "GO:0043710", "GO:0044010", "GO:0044399", "GO:0044403", "GO:0044419", "GO:0051703", "GO:0090605", "GO:0090609", "GO:0098630", "GO:0098743" ]
[ "GO:0007155", "GO:0008150", "GO:0009987", "GO:0031589", "GO:0042710", "GO:0043708", "GO:0043709", "GO:0043710", "GO:0044010", "GO:0044399", "GO:0044403", "GO:0044419", "GO:0051703", "GO:0090605", "GO:0090609", "GO:0098630", "GO:0098743" ]
[]
[]
AF-Q5A312-F1-model_v6.pdb
237561.Q5A312
null
[ "IPR008966", "IPR043063", "IPR008440", "IPR033504", "IPR024672", "IPR011252" ]
{"IPR011252": [18, 176], "IPR008966": [49, 174], "IPR043063": [182, 326], "IPR033504": [3, 523], "IPR024672": [54, 299], "IPR008440": [403, 543]}
- IPR008966: Adhesion domain superfamily (homologous_superfamily) [49-174] - IPR043063: Agglutinin-like protein, N-terminal, N2 subdomain (homologous_superfamily) [182-326] - IPR008440: Agglutinin-like protein repeat (repeat) [403-543] - IPR033504: Agglutinin-like protein (family) [3-523] - IPR024672: Agglutinin-like protein, N-terminal (domain) [54-299] - IPR011252: Fibrogen-binding domain 1 (homologous_superfamily) [18-176]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0033218 (amide binding), GO:0050840 (extracellular matrix binding), GO:0005515 (protein binding), GO:0042277 (peptide binding), GO:0001968 (fibronectin binding), GO:0043236 (laminin binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0044403 (biological process involved in symbiotic interaction), GO:0007155 (cell adhesion), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:0098630 (aggregation of unicellular organisms), GO:0090609 (single-species submerged biofilm formation), GO:0031589 (cell-substrate adhesion), GO:0043709 (cell adhesion involved in single-species biofilm formation), GO:0042710 (biofilm formation), GO:0043708 (cell adhesion involved in biofilm formation), GO:0090605 (submerged biofilm formation) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0009986 (cell surface), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0005576 (extracellular region), GO:0005618 (cell wall), GO:0009277 (fungal-type cell wall), GO:0030446 (hyphal cell wall), GO:0030445 (yeast-form cell wall)
P15034
Xaa-Pro aminopeptidase
null
Escherichia coli (strain K12)
441
Cytoplasm
MSEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
[ "GO:0008150", "GO:0009987", "GO:0016043", "GO:0022607", "GO:0043933", "GO:0044085", "GO:0051259", "GO:0051260", "GO:0051262", "GO:0051289", "GO:0065003", "GO:0071840" ]
[ "GO:0008150", "GO:0009987", "GO:0016043", "GO:0022607", "GO:0043933", "GO:0044085", "GO:0051259", "GO:0051260", "GO:0051262", "GO:0051289", "GO:0065003", "GO:0071840" ]
[]
[]
AF-P15034-F1-model_v6.pdb
511145.b2908
[ "Q8XD28", "P15288", "Q2M9T4", "P78048", "Q2M649", "P04825", "Q2MBQ0", "Q2M9T5" ]
[ "IPR001131", "IPR052433", "IPR001714", "IPR029149", "IPR007865", "IPR036005", "IPR000994" ]
{"IPR029149": [2, 177], "IPR036005": [175, 441], "IPR052433": [4, 435], "IPR001714": [256, 385], "IPR007865": [4, 139], "IPR000994": [185, 414], "IPR001131": [351, 363]}
- 2-octaprenyl-6-methoxyphenol hydroxylase - Cytosol non-specific dipeptidase - UPF0149 protein YgfB - UPF0149 protein YgfB - UPF0149 protein YgfB - UPF0149 protein YgfB - 2-octaprenylphenol hydroxylase - Aminopeptidase N - GMP reductase - GMP reductase
- IPR001131: Peptidase M24B, X-Pro dipeptidase/aminopeptidase P, conserved site (conserved_site) [351-363] - IPR052433: Xaa-Pro dipeptidase-like (family) [4-435] - IPR001714: Peptidase M24, methionine aminopeptidase (family) [256-385] - IPR029149: Creatinase/Aminopeptidase P/Spt16, N-terminal (homologous_superfamily) [2-177] - IPR007865: Aminopeptidase P, N-terminal (domain) [4-139] - IPR036005: Creatinase/aminopeptidase-like (homologous_superfamily) [175-441] - IPR000994: Peptidase M24 (domain) [185-414]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0043167 (ion binding), GO:0140096 (catalytic activity, acting on a protein), GO:0005515 (protein binding), GO:0008233 (peptidase activity), GO:0043169 (cation binding), GO:0008237 (metallopeptidase activity), GO:0008238 (exopeptidase activity), GO:0046872 (metal ion binding), GO:0004177 (aminopeptidase activity), GO:0008235 (metalloexopeptidase activity), GO:0046914 (transition metal ion binding), GO:0030145 (manganese ion binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0009056 (catabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0043603 (amide metabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:0019538 (protein metabolic process), GO:1901575 (organic substance catabolic process), GO:0043170 (macromolecule metabolic process), GO:0044248 (cellular catabolic process), GO:0006518 (peptide metabolic process), GO:0006508 (proteolysis), GO:1901565 (organonitrogen compound catabolic process), GO:0043171 (peptide catabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0032991 (protein-containing complex), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
O74254
Glucoamylase 1
null
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
946
Secreted, cell wall. Membrane; Peripheral membrane protein
MKLLSKVFVTALGLTSIVNAAPTSSSSAEEAQKTVPVELSIGVKQLPNIHNDSAVDANAVAKGYSLVNVSLTARGLTGILKLKEATNIYGYDFEYLNLSVEYQSDTRLNVHIEPTDLTDVFVLPEELVVKPKLEGDAKTFNFENSDLVFEYDEEDFGFEVLRSSTREVLFSTKGNPLVFSNQFIQFNTTLPKGHSITGLGESIHGSLNEPGVVKTLYANDIADPIDGNIYGVHPVYYDQRYNTNTTHAVYWRTSAIQEVVVGETSLTWRALSGVIDLYFFSGPDPKDVIQQYVSEIGLPAMQPYWALGYHQCRWGYDTVESLETVVENFKKFDIPLETIWSDIDYMDGYKDFTNDPYRFPTDKFRKFLDDLHNNSQHYVPIFDAAIYVPNPNNATDNDYEPFHLGNESDVFLKNPDGSLYIGAVWPGYTVFPDFLANNTQEYWNKMFKDWYERIPFDGIWTDMNEVSSFCVGSCGTGRYFDNPVHPPFEVGYSGSDYPLGFDKSNASEWKSISEAAAATKTTTTTSSSTSTSIDGKNTLAPGKGNINYPPYAINNNQGDHDLATHAISPNATHADGTVEYDIHNIYGLIQERAIYEALLEIHPNKRPFIIGRSSFAGSGKYMGHWGGDNYADYYMMYFSIPQALSMGLSGIPFFGVDACGFNGNTDMELCSRWMQLASFFPFYRNHNVLGAIPQEPYVWEGVMNATKTSINVRYSLLPYYYTLLHESHVTGIPIMRAFNWQFPYSKELAGVDTQFFVGDALLVTPVLEPGVNHTKGVFPGENAVYYDFYTHKKQKFTAGKNETLAAPLGHIPLHIKGGNIIPTQEPGYTTTESRKNPFGLLVALDAEGTASGKLYLDDGESVDVEEALYVDFVASKNKLVASVFGEYEVRQPLANVTILGVDSEPKKVLFNNETVSHNYENGAVYLTDLEKFTKEGAFAEEFSIQW
[ "GO:0008150", "GO:0009987", "GO:0042710", "GO:0044010", "GO:0044011", "GO:0051703", "GO:0090605", "GO:0090609", "GO:0098630", "GO:0098743", "GO:0005575", "GO:0005576", "GO:0110165" ]
[ "GO:0008150", "GO:0009987", "GO:0042710", "GO:0044010", "GO:0044011", "GO:0051703", "GO:0090605", "GO:0090609", "GO:0098630", "GO:0098743" ]
[]
[ "GO:0005575", "GO:0005576", "GO:0110165" ]
AF-O74254-F1-model_v6.pdb
237561.O74254
[ "Q59TZ8", "A0A1D8PRS1", "Q5A6V6", "A0A1D8PJB5", "A0A1D8PD78", "A0A1D8PTY8", "Q59RR7", "Q5AJ73", "A0A1D8PHV3", "Q59RW5", "A0A1D8PEW1", "A0A1D8PUB9", "Q9URL8", "Q5AIA1", "A0A1D8PP39", "Q5AMT2" ]
[ "IPR030458", "IPR017853", "IPR030459", "IPR000322", "IPR048395", "IPR013780", "IPR011013" ]
{"IPR011013": [60, 285], "IPR017853": [286, 731], "IPR013780": [716, 946], "IPR000322": [299, 723], "IPR048395": [731, 821], "IPR030459": [655, 685], "IPR030458": [458, 465]}
- glucan 1,4-alpha-glucosidase - Glucan 1,3-beta-glucosidase BGL2 - Glucoamylase 1 - Glucan 1,3-beta-glucosidase - Hexokinase-2 - Alpha-glucosidase - beta-glucosidase - Glycosyl hydrolase family 13 catalytic domain-containing protein - beta-glucosidase - Phosphotransferase
- IPR030458: Glycosyl hydrolases family 31, active site (active_site) [458-465] - IPR017853: Glycoside hydrolase superfamily (homologous_superfamily) [286-731] - IPR030459: Glycosyl hydrolases family 31, conserved site (conserved_site) [655-685] - IPR000322: Glycoside hydrolase family 31, TIM barrel domain (domain) [299-723] - IPR048395: Glycosyl hydrolase family 31, C-terminal domain (domain) [731-821] - IPR013780: Glycosyl hydrolase, all-beta (homologous_superfamily) [716-946] - IPR011013: Galactose mutarotase-like domain superfamily (homologous_superfamily) [60-285]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0016798 (hydrolase activity, acting on glycosyl bonds), GO:0004553 (hydrolase activity, hydrolyzing O-glycosyl compounds), GO:0015926 (glucosidase activity), GO:0090599 (alpha-glucosidase activity), GO:0004558 (alpha-1,4-glucosidase activity) Biological Process (BP): GO:0008150 (biological process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0009987 (cellular process), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:0098630 (aggregation of unicellular organisms), GO:0090609 (single-species submerged biofilm formation), GO:0042710 (biofilm formation), GO:0044011 (single-species biofilm formation on inanimate substrate), GO:0090605 (submerged biofilm formation) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005576 (extracellular region)
Q59KZ1
Aminopeptidase 2
Metalloprotease that specifically hydrolyzes peptides with N- terminal alanine, arginine and leucine residues
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
924
Secreted, cell wall
MASNNTSQRSGFSSFFCRLKTYFCNHFLCLFVLSFFPLSFRRLCLLCHLCEKSNLWLSSDNSASVVKQEREVLPTNVKPLHYDLTIEPIFDNFTFKGEETIDFQVNEKTNFITLNSLEIEVQEAKIDGKSVTDISFDAGKQTVTFKFDDDLSTGSIAKLYIKFTGELNDKMAGFYRASYQEDGKTKYMATTQMEPTDCRRAFPSYDEPAAKSKFTISLIADKELVCLSNSSEKETVSLDGNKKKVTFQTTPLMSTYLVAFIVGDLRYISNDNYRVPIRVYSTPGTEHLGEYSANIAAQTLKFFDQQFGIDYPYDKLDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTKQRVTEVVMHELAHQWFGDLVTMEFWDGLWLNEGFATWMSWYACNSLYPDWKVWESYVSDSLQHALTLDALRASHPIEVPVKRADEINQIFDAISYSKGSSLLRMISKWLGEDVFVKGVSNYLKKHKWGNTKTSDLWEALSEASGEDVVKVMDIWTKNIGFPIVKVEEIGNGEIKVTQNRFLATGDVKESEDKTLYPVFLGLKTSEGVDESSVLETRSKTIKLPTSDDFFKINGDQSGIYRTAYEPARWTKLGKAGVEGKLSVEDRVGLVADAGSLASSGFIKTSSLLDLVKSWSKESNYVVWNEILTRIGSIKAALMFEDEATKKALEIFTRDLISEKLKETGWEFSADDSFADQQLKSSLFASAANAEDPEAVAFAKEAFAKFIAGDKKAIHPNLRASIFNTNAKYGDEKTFDELYNIYRNPSSVEEKIAALRSFGRFTKPEILDKVTGLLLQTDIVKQQDIYIPMQGLRAHKLGVEKLWTWLSENWDQIYILLPPGLSMLGSVVTLGTSGFTKEEQKKKVEEFFAQKDNKGYDQSLAQSLDIITAKSKWTDRDAKSIYEWLEANEYTK
[ "GO:0003674", "GO:0003824", "GO:0004177", "GO:0008233", "GO:0008235", "GO:0008236", "GO:0008237", "GO:0008238", "GO:0016787", "GO:0017171", "GO:0070006", "GO:0140096", "GO:0005575", "GO:0005576", "GO:0005618", "GO:0009277", "GO:0030312", "GO:0071944", "GO:0110165" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0004177", "GO:0008233", "GO:0008235", "GO:0008236", "GO:0008237", "GO:0008238", "GO:0016787", "GO:0017171", "GO:0070006", "GO:0140096" ]
[ "GO:0005575", "GO:0005576", "GO:0005618", "GO:0009277", "GO:0030312", "GO:0071944", "GO:0110165" ]
AF-Q59KZ1-F1-model_v6.pdb
237561.Q59KZ1
[ "Q5AI38" ]
[ "IPR034016", "IPR050344", "IPR027268", "IPR045357", "IPR024571", "IPR001930", "IPR014782", "IPR042097" ]
{"IPR042097": [58, 264], "IPR027268": [268, 513], "IPR050344": [61, 918], "IPR034016": [80, 510], "IPR001930": [199, 391], "IPR045357": [78, 257], "IPR014782": [291, 508], "IPR024571": [582, 900]}
- 14-3-3 protein homolog
- IPR034016: Aminopeptidase N-type (family) [80-510] - IPR050344: Peptidase M1 family aminopeptidases (family) [61-918] - IPR027268: Peptidase M4/M1, CTD superfamily (homologous_superfamily) [268-513] - IPR045357: Aminopeptidase N-like , N-terminal domain (domain) [78-257] - IPR024571: ERAP1-like C-terminal domain (domain) [582-900] - IPR001930: Peptidase M1, alanine aminopeptidase/leukotriene A4 hydrolase (family) [199-391] - IPR014782: Peptidase M1, membrane alanine aminopeptidase (domain) [291-508] - IPR042097: Aminopeptidase N-like , N-terminal domain superfamliy (homologous_superfamily) [58-264]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0140096 (catalytic activity, acting on a protein), GO:0016787 (hydrolase activity), GO:0008233 (peptidase activity), GO:0008237 (metallopeptidase activity), GO:0008238 (exopeptidase activity), GO:0004177 (aminopeptidase activity), GO:0008235 (metalloexopeptidase activity), GO:0070006 (metalloaminopeptidase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0009056 (catabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0043603 (amide metabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:0019538 (protein metabolic process), GO:1901575 (organic substance catabolic process), GO:0043170 (macromolecule metabolic process), GO:0044248 (cellular catabolic process), GO:0006518 (peptide metabolic process), GO:0006508 (proteolysis), GO:1901565 (organonitrogen compound catabolic process), GO:0043171 (peptide catabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0031012 (extracellular matrix), GO:0062039 (biofilm matrix), GO:0062040 (fungal biofilm matrix)
A0MTA1
DNA repair nuclease APEX1
Functions as an apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Has 3'-5' exoribonuclease activity on mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules during short-patch BER (By similarity). May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation (By similarity). Required for passage through the mid-blastula transition MBT. May also act as an endoribonuclease involved in the control of single-stranded RNA metabolism (By similarity). Has no redox activity. Binds DNA and RNA (By similarity)
Danio rerio (Zebrafish) (Brachydanio rerio)
310
Nucleus. Nucleus, nucleolus. Nucleus speckle. Endoplasmic reticulum. Cytoplasm. Mitochondrion
MPKRAKKNEEGVDGEADNGTAAAKKEKKGKEPEAPILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV
[ "GO:0003674", "GO:0003824", "GO:0003906", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0003906", "GO:0004518", "GO:0004519", "GO:0004520", "GO:0004536", "GO:0140097", "GO:0140640" ]
[]
AF-A0MTA1-F1-model_v6.pdb
7955.ENSDARP00000067373
[ "F1QXI2", "F8W5U2", "B0R0V1", "Q5RHR0", "F1Q570", "F1QMZ8", "A2BIQ2", "Q6GMM1", "F1R6S6", "B8JJK1", "A0A0R4IHR6", "Q6DRD3", "B0R135", "Q6NY87", "Q7ZWH1", "Q90440", "F1QLV3", "F1QK90", "F1QBP9", "A0A0R4ITV5", "F1Q865", "X1WBY3", "F1R092", "Q568J1", "E7FBZ9", "Q9PTP1"...
[ "IPR020848", "IPR036691", "IPR005135", "IPR020847", "IPR004808" ]
{"IPR036691": [30, 310], "IPR004808": [41, 310], "IPR005135": [59, 301], "IPR020848": [269, 280], "IPR020847": [82, 91]}
- Probable endonuclease 4 isoform X1 - Endonuclease III-like protein 1 - Flap endonuclease 1 - DNA polymerase beta - N-glycosylase/DNA lyase - DNA repair protein XRCC1 - Adenine DNA glycosylase - Proliferating cell nuclear antigen - DNA ligase - Poly [ADP-ribose] polymerase 1
- IPR020848: AP endonuclease 1, conserved site (conserved_site) [269-280] - IPR036691: Endonuclease/exonuclease/phosphatase superfamily (homologous_superfamily) [30-310] - IPR005135: Endonuclease/exonuclease/phosphatase (domain) [59-301] - IPR020847: AP endonuclease 1, binding site (binding_site) [82-91] - IPR004808: AP endonuclease 1 (family) [41-310]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0140640 (catalytic activity, acting on a nucleic acid), GO:0016787 (hydrolase activity), GO:0016788 (hydrolase activity, acting on ester bonds), GO:0140097 (catalytic activity, acting on DNA), GO:0004518 (nuclease activity), GO:0004536 (deoxyribonuclease activity), GO:0004520 (DNA endonuclease activity), GO:0004519 (endonuclease activity), GO:0016894 (endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 3'-phosphomonoesters), GO:0016889 (DNA endonuclease activity, producing 3'-phosphomonoesters) Biological Process (BP): GO:0008150 (biological process), GO:0042592 (homeostatic process), GO:0019725 (cellular homeostasis), GO:0045454 (cell redox homeostasis) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q59QC5
Clathrin-associated protein AP-3 complex component APS3
Part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane (By similarity). Involved in vacuolar trafficking and contributes to hyphal growth and pathogenesis
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
175
Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex
MIHSVLIFNNDGLPRLMKFYTKVDIPTQKLLLQQVHSLISTRSAQECSFITPPSLLEDLDDIKVIYRHYATLYFVFIVDDQESELGILDLIQVFVECLDKCFSNVCELDLVFGWQVLQTVLEEIVQGGMVIDTNINRIVAAVDEANSQKNVNSNGSTISASILSSLSRDRGFWGR
[ "GO:0006810", "GO:0006892", "GO:0006896", "GO:0007034", "GO:0008150", "GO:0009987", "GO:0016192", "GO:0046907", "GO:0048193", "GO:0051179", "GO:0051234", "GO:0051641", "GO:0051649" ]
[ "GO:0006810", "GO:0006892", "GO:0006896", "GO:0007034", "GO:0008150", "GO:0009987", "GO:0016192", "GO:0046907", "GO:0048193", "GO:0051179", "GO:0051234", "GO:0051641", "GO:0051649" ]
[]
[]
AF-Q59QC5-F1-model_v6.pdb
237561.Q59QC5
[ "Q5AJY4", "A0A1D8PLU9", "A0A1D8PF11", "Q59RK0", "A0A1D8PE70", "A0A1D8PSB0", "A0A1D8PJJ8", "Q5ANA1" ]
[ "IPR000804", "IPR022775", "IPR016635", "IPR011012" ]
{"IPR011012": [1, 143], "IPR016635": [1, 153], "IPR022775": [1, 147], "IPR000804": [64, 74]}
- AP-3 complex subunit delta - Clathrin/coatomer adaptor adaptin-like N-terminal domain-containing protein - AP-1 complex subunit gamma - MHD domain-containing protein - Large ribosomal subunit protein eL8A - Large ribosomal subunit protein eL8B - AP-2 complex subunit alpha - Apm1p
- IPR000804: Clathrin adaptor complex, small chain (conserved_site) [64-74] - IPR022775: AP complex, mu/sigma subunit (domain) [1-147] - IPR016635: Adaptor protein complex, sigma subunit (family) [1-153] - IPR011012: Longin-like domain superfamily (homologous_superfamily) [1-143]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0051179 (localization), GO:0051234 (establishment of localization), GO:0051641 (cellular localization), GO:0033036 (macromolecule localization), GO:0070727 (cellular macromolecule localization), GO:0051649 (establishment of localization in cell), GO:0046907 (intracellular transport), GO:0045184 (establishment of protein localization), GO:0006810 (transport), GO:0071702 (organic substance transport), GO:0006886 (intracellular protein transport), GO:0071705 (nitrogen compound transport), GO:0008104 (protein localization), GO:0015031 (protein transport) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q6PGD0
All-trans retinoic acid-induced differentiation factor
Promotes osteoblast cell differentiation and terminal mineralization. Plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway (By similarity). In osteoclasts, forms a transporter complex with ATRAID for nitrogen-containing-bisphophonates (N-BPs) required for releasing N-BP molecules that have trafficked to lysosomes through fluid-phase endocytosis into the cytosol
Mus musculus (Mouse)
223
Nucleus envelope. Cell membrane; Single-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Note=Colocalizes with NELL1 on the nuclear envelope and the perinuclear region
MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAAYCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS
[ "GO:0006810", "GO:0006855", "GO:0008150", "GO:0009987", "GO:0042908", "GO:0051179", "GO:0051234", "GO:0055085", "GO:0003674", "GO:0005215", "GO:0005488", "GO:0005515", "GO:0022857", "GO:0042910" ]
[ "GO:0006810", "GO:0006855", "GO:0008150", "GO:0009987", "GO:0042908", "GO:0051179", "GO:0051234", "GO:0055085" ]
[ "GO:0003674", "GO:0005215", "GO:0005488", "GO:0005515", "GO:0022857", "GO:0042910" ]
[]
AF-Q6PGD0-F1-model_v6.pdb
10090.ENSMUSP00000013766
null
[ "IPR000742", "IPR042350" ]
{"IPR042350": [8, 222], "IPR000742": [146, 187]}
- IPR000742: EGF-like domain (domain) [146-187] - IPR042350: All-trans retinoic acid-induced differentiation factor (family) [8-222]
Molecular Function (MF): GO:0003674 (molecular function), GO:0098772 (molecular function regulator activity), GO:0005488 (binding), GO:0030545 (signaling receptor regulator activity), GO:0140677 (molecular function activator activity), GO:0005515 (protein binding), GO:0005102 (signaling receptor binding), GO:0030546 (signaling receptor activator activity), GO:0048018 (receptor ligand activity), GO:0005179 (hormone activity) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0023052 (signaling), GO:0032501 (multicellular organismal process), GO:0050793 (regulation of developmental process), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0009653 (anatomical structure morphogenesis), GO:0051240 (positive regulation of multicellular organismal process), GO:0050794 (regulation of cellular process), GO:0048771 (tissue remodeling), GO:0051239 (regulation of multicellular organismal process), GO:0051094 (positive regulation of developmental process), GO:0048646 (anatomical structure formation involved in morphogenesis), GO:0007154 (cell communication), GO:0007165 (signal transduction), GO:0048522 (positive regulation of cellular process), GO:0001525 (angiogenesis), GO:0035295 (tube development), GO:1904018 (positive regulation of vasculature development), GO:2000026 (regulation of multicellular organismal development), GO:0042127 (regulation of cell population proliferation), GO:0001568 (blood vessel development), GO:0048731 (system development), GO:0048513 (animal organ development), GO:0022603 (regulation of anatomical structure morphogenesis), GO:0007166 (cell surface receptor signaling pathway), GO:1901343 (negative regulation of vasculature development), GO:0008284 (positive regulation of cell population proliferation), GO:0035239 (tube morphogenesis), GO:0048514 (blood vessel morphogenesis), GO:0001944 (vasculature development), GO:0072359 (circulatory system development), GO:1901342 (regulation of vasculature development), GO:0045766 (positive regulation of angiogenesis), GO:0045765 (regulation of angiogenesis), GO:0002040 (sprouting angiogenesis), GO:2000181 (negative regulation of blood vessel morphogenesis), GO:0016525 (negative regulation of angiogenesis), GO:0007169 (transmembrane receptor protein tyrosine kinase signaling pathway) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
P22274
ADP-ribosylation factor
GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
179
Golgi apparatus
MGLTISKLFASLLGRREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRYYFQNTQGIIFVVDSNDRDRINEAREELQSMLNEDELKDAVLLVLANKQDLPNAMNAAEITEKMGLHSIRNRPWFIQATCATTGDGLYEGLEWLSNQVGK
[ "GO:0000302", "GO:0006810", "GO:0006886", "GO:0006950", "GO:0006979", "GO:0008104", "GO:0008150", "GO:0009987", "GO:0015031", "GO:0033036", "GO:0033554", "GO:0034599", "GO:0034614", "GO:0042221", "GO:0045184", "GO:0046907", "GO:0050896", "GO:0051179", "GO:0051234", "GO:0051641"...
[ "GO:0000302", "GO:0006810", "GO:0006886", "GO:0006950", "GO:0006979", "GO:0008104", "GO:0008150", "GO:0009987", "GO:0015031", "GO:0033036", "GO:0033554", "GO:0034599", "GO:0034614", "GO:0042221", "GO:0045184", "GO:0046907", "GO:0050896", "GO:0051179", "GO:0051234", "GO:0051641"...
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005794", "GO:0012505", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-P22274-F1-model_v6.pdb
237561.P22274
[ "A0A1D8PMT6", "A0A1D8PJI6", "A0A1D8PTM6", "Q5AHW5", "Q5AMQ3", "A0A1D8PCP6", "A0A1D8PPS9", "A0A1D8PJB0", "Q96W97", "Q5AJY4", "A0A1D8PSB0", "Q5A7M1", "Q59KJ6", "Q5ANF9", "A0A1D8PND9", "A0A1D8PPV5", "A0A1D8PJ64", "A0A1D8PTI2", "Q5AMK5", "A0A1D8PIG1", "Q5AND9", "Q9UW24", "Q59...
[ "IPR027417", "IPR006689", "IPR024156", "IPR005225", "IPR045872" ]
{"IPR027417": [6, 179], "IPR024156": [1, 175], "IPR006689": [5, 177], "IPR045872": [18, 176], "IPR005225": [16, 160]}
- Fgr32p - Arf family guanine nucleotide exchange factor - Age3p - Coatomer subunit gamma - ADP-ribosylation factor GTPase-activating protein - Arf3p - Rga2p - AP-1 complex subunit gamma - Glycylpeptide N-tetradecanoyltransferase - ADP-ribosylation factor
- IPR027417: P-loop containing nucleoside triphosphate hydrolase (homologous_superfamily) [6-179] - IPR006689: Small GTPase superfamily, ARF/SAR type (family) [5-177] - IPR024156: Small GTPase superfamily, ARF type (family) [1-175] - IPR005225: Small GTP-binding domain (domain) [16-160] - IPR045872: ADP-ribosylation factor 1-5 (family) [18-176]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0036094 (small molecule binding), GO:1901363 (heterocyclic compound binding), GO:0043167 (ion binding), GO:0097159 (organic cyclic compound binding), GO:0097367 (carbohydrate derivative binding), GO:1901265 (nucleoside phosphate binding), GO:0043168 (anion binding), GO:0000166 (nucleotide binding), GO:0032553 (ribonucleotide binding), GO:0035639 (purine ribonucleoside triphosphate binding), GO:0032555 (purine ribonucleotide binding), GO:0017076 (purine nucleotide binding), GO:0005525 (GTP binding), GO:0019001 (guanyl nucleotide binding), GO:0032561 (guanyl ribonucleotide binding) Biological Process (BP): GO:0008150 (biological process), GO:0040007 (growth), GO:0030447 (filamentous growth) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0043226 (organelle), GO:0005576 (extracellular region), GO:0043227 (membrane-bounded organelle), GO:0043230 (extracellular organelle), GO:0065010 (extracellular membrane-bounded organelle), GO:0031982 (vesicle), GO:1903561 (extracellular vesicle)
P18335
Acetylornithine/succinyldiaminopimelate aminotransferase
Involved in both the arginine and lysine biosynthetic pathways
Escherichia coli (strain K12)
406
Cytoplasm
MAIEQTAITRATFDEVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHISNVFTNEPALRLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIINTPEVLEGIQAKRQRFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGRARDFLYAGAEAGVMVLNAGPDVMRFAPSLVVEDADIDEGMQRFAHAVAKVVGA
[ "GO:0006082", "GO:0006520", "GO:0006525", "GO:0006526", "GO:0006553", "GO:0008150", "GO:0008152", "GO:0008652", "GO:0009058", "GO:0009064", "GO:0009067", "GO:0009084", "GO:0009085", "GO:0009089", "GO:0009987", "GO:0016053", "GO:0019752", "GO:0033359", "GO:0042450", "GO:0043436"...
[ "GO:0006082", "GO:0006520", "GO:0006525", "GO:0006526", "GO:0006553", "GO:0008150", "GO:0008152", "GO:0008652", "GO:0009058", "GO:0009064", "GO:0009067", "GO:0009084", "GO:0009085", "GO:0009089", "GO:0009987", "GO:0016053", "GO:0019752", "GO:0033359", "GO:0042450", "GO:0043436"...
[]
[]
AF-P18335-F1-model_v6.pdb
511145.b3359
[ "Q2MBJ2", "P0A9D8", "Q2M8Q4", "Q2MCE9", "Q2MA19", "Q2M8Q3", "P76949", "Q2M939", "P24176", "Q2M835", "Q2M8Q2", "Q2M744", "Q2M655", "Q47060", "Q2MAP3" ]
[ "IPR015424", "IPR004636", "IPR050103", "IPR015422", "IPR015421", "IPR005814", "IPR049704", "IPR017652" ]
{"IPR015424": [20, 401], "IPR015422": [30, 393], "IPR015421": [60, 305], "IPR017652": [8, 404], "IPR050103": [13, 403], "IPR004636": [16, 403], "IPR005814": [21, 402], "IPR049704": [223, 260]}
- N-acetyl-gamma-glutamyl-phosphate reductase - Acetylglutamate kinase - Amino-acid acetyltransferase - Argininosuccinate lyase - Acetylornithine deacetylase - 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase - Succinyl-diaminopimelate desuccinylase - Succinyl-diaminopimelate desuccinylase - Argininosuccinate synthase - Ornithine carbamoyltransferase subunit I
- IPR015424: Pyridoxal phosphate-dependent transferase (homologous_superfamily) [20-401] - IPR004636: Acetylornithine/Succinylornithine transaminase family (family) [16-403] - IPR050103: Class-III Pyridoxal-phosphate-dependent Aminotransferase (family) [13-403] - IPR015422: Pyridoxal phosphate-dependent transferase, small domain (homologous_superfamily) [30-393] - IPR015421: Pyridoxal phosphate-dependent transferase, major domain (homologous_superfamily) [60-305] - IPR005814: Aminotransferase class-III (family) [21-402] - IPR049704: Aminotransferases class-III pyridoxal-phosphate attachment site (conserved_site) [223-260] - IPR017652: Acetyl/Succinylornithine transaminase family, bacteria (family) [8-404]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0036094 (small molecule binding), GO:0043167 (ion binding), GO:0097159 (organic cyclic compound binding), GO:0016740 (transferase activity), GO:1901363 (heterocyclic compound binding), GO:0043168 (anion binding), GO:0019842 (vitamin binding), GO:0016769 (transferase activity, transferring nitrogenous groups), GO:0070279 (vitamin B6 binding), GO:0008483 (transaminase activity), GO:0030170 (pyridoxal phosphate binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0071704 (organic substance metabolic process), GO:0009056 (catabolic process), GO:0044238 (primary metabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:0044282 (small molecule catabolic process), GO:0006082 (organic acid metabolic process), GO:0044248 (cellular catabolic process), GO:0006520 (amino acid metabolic process), GO:1901575 (organic substance catabolic process), GO:0016054 (organic acid catabolic process), GO:1901565 (organonitrogen compound catabolic process), GO:0043436 (oxoacid metabolic process), GO:0009063 (amino acid catabolic process), GO:1901605 (alpha-amino acid metabolic process), GO:0019752 (carboxylic acid metabolic process), GO:0009065 (glutamine family amino acid catabolic process), GO:1901606 (alpha-amino acid catabolic process), GO:0009064 (glutamine family amino acid metabolic process), GO:0046395 (carboxylic acid catabolic process), GO:0006591 (ornithine metabolic process), GO:0006527 (arginine catabolic process), GO:0006525 (arginine metabolic process), GO:0043648 (dicarboxylic acid metabolic process), GO:0006105 (succinate metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
Q9VL63
Arginine and glutamate-rich protein 1
Post-transcriptional regulator of gene expression; modulates splicing and premature cleavage at cryptic polyadenylation sites of its own pre-mRNA through binding and regulation of the U1-snRNP complex
Drosophila melanogaster (Fruit fly)
290
Nucleus. Nucleus speckle. Note=Phase separation and localization to nuclear speckle-like structures is enhanced by binding to sisRNA
MGSRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRHRSDRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRFKKLDEQNQMQVERLAEMERQRRAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKAEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQRLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLKPGAL
[ "GO:0003674", "GO:0003676", "GO:0003723", "GO:0005488", "GO:0036002", "GO:0043021", "GO:0044877", "GO:0070990", "GO:1990446", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
[]
[ "GO:0003674", "GO:0003676", "GO:0003723", "GO:0005488", "GO:0036002", "GO:0043021", "GO:0044877", "GO:0070990", "GO:1990446" ]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q9VL63-F1-model_v6.pdb
7227.FBpp0079491
[ "Q9VM56", "A0A0B4KF69", "Q86B99" ]
[ "IPR033371" ]
{"IPR033371": [3, 286]}
- U1 small nuclear ribonucleoprotein 70 kDa - Uncharacterized protein, isoform B - non-specific serine/threonine protein kinase
- IPR033371: Arginine and glutamate-rich protein 1 (family) [3-286]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0050789 (regulation of biological process), GO:0022414 (reproductive process), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0000003 (reproduction), GO:0032501 (multicellular organismal process), GO:0019953 (sexual reproduction), GO:0048869 (cellular developmental process), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0022412 (cellular process involved in reproduction in multicellular organism), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0071840 (cellular component organization or biogenesis), GO:0032504 (multicellular organism reproduction), GO:0003006 (developmental process involved in reproduction), GO:0048609 (multicellular organismal reproductive process), GO:0007276 (gamete generation), GO:0007281 (germ cell development), GO:0044085 (cellular component biogenesis), GO:0048468 (cell development), GO:0030154 (cell differentiation), GO:0048731 (system development), GO:0048513 (animal organ development), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0016043 (cellular component organization), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0007283 (spermatogenesis), GO:0022008 (neurogenesis), GO:0007399 (nervous system development), GO:0007292 (female gamete generation), GO:0051246 (regulation of protein metabolic process), GO:0048880 (sensory system development), GO:0007423 (sensory organ development), GO:0048477 (oogenesis), GO:0090596 (sensory organ morphogenesis), GO:0043933 (protein-containing complex organization), GO:0006996 (organelle organization), GO:0048232 (male gamete generation), GO:0030182 (neuron differentiation), GO:0010468 (regulation of gene expression), GO:0022607 (cellular component assembly), GO:0070925 (organelle assembly), GO:0042461 (photoreceptor cell development), GO:0001654 (eye development), GO:0098916 (anterograde trans-synaptic signaling), GO:0048699 (generation of neurons), GO:0065003 (protein-containing complex assembly), GO:0046530 (photoreceptor cell differentiation), GO:0150063 (visual system development), GO:0046785 (microtubule polymerization), GO:0048749 (compound eye development), GO:0001745 (compound eye morphogenesis), GO:0140694 (non-membrane-bounded organelle assembly), GO:0001754 (eye photoreceptor cell differentiation), GO:0042462 (eye photoreceptor cell development), GO:0042051 (compound eye photoreceptor development), GO:0001751 (compound eye photoreceptor cell differentiation) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0031974 (membrane-enclosed lumen), GO:0005654 (nucleoplasm), GO:0043229 (intracellular organelle), GO:0043233 (organelle lumen), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0070013 (intracellular organelle lumen), GO:0031981 (nuclear lumen), GO:0005634 (nucleus)
Q5AME2
Pentafunctional AROM polypeptide
The AROM polypeptide catalyzes 5 consecutive enzymatic reactions in prechorismate polyaromatic amino acid biosynthesis
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,551
Cytoplasm
MSIEKVPILGKETIHVGYGIADHIVREVIANLASSTYVIVTDTNMARTPQYSKLTDDFKTNLSEKRPESRLLTYCVSPGENNKNRATKAAVEDFLLQQGCTRDTVILAVGGGVIGDMIGFVAATFMRGVRVVQVPTTLLAMVDSSVGGKTAIDTPLGKNFIGAFHQPEYVFCDVSFLETLPARQFINGMAEVVKTAAIWNEEEFTRLENFSKKFLSVVTSKKPDLQSIKAELVKTVLESVRVKAGVVSSDEKEAGLRNLLNFGHTIGHAIEAVLTPEALHGECVSIGMIKEAELSRYLGILPPVAVARLSKCLVAYGLPVSIDDKEFLKKVGPKRHYVEIDILLKKMAIDKKNDGSKIRCVLLEKIGKCYQLKAHQVSKQDLSFVLTDEVLVHPFTNPPKENIIVPPGSKSISNRALILAALGNGTVRVKNLLHSDDTKHMLDAVASLKGAEISTEDNGETIVVKGNGGNLVTSGEELYLGNAGTASRFLTTVASLVGKSQASDDVILTGNARMQERPIGPLVDALGSNGSEIEYLNKQGSLPLKISAGNGLKGGRIELAATISSQYVSSILMCAPYAKEPVTLALVGGKPISQLYIDMTCAMMKSFGIEVTKSTTEEYTYHIPKGTYKNPSEYVIESDASSATYPLAFAAMTGTSCTIPNIGSSSLQGDAKFAVDVLKPMGCKVEQTTTSTTVTGPPRGHLKPLPHVDMEPMTDAFLTASVVAAVAKGGSSTSITGIANQRVKECNRIEAMVTELAKFGVPANELPDGIEIHGIDIEDLKTPEISKRGVSSYDDHRVAMSFSLLAGLCKEPVLILERSTTGKTWPGWWDILHSKFKIELDGYEPPFNTDKHVDKSSDKSIIVIGMRGTGKSTLSEWLASFLGFKMLDMDKYLEEKLGTGIKSLIKAKGWEYFRQEEAIVAKECFTKFSKGYVLSTGGGIVEGEDARQQLKSYADNGGIVLHLHRDLDETVTFLAADTTRPAYSSEVQEVWLRREKWYHECSNYHFYSSHCSTEDEFNHLRRSFVNYIKLITGAERPVVPAGRSAAVVLTSPDLNEVVGDLESITIGADAVELRVDLFKDTSAEFVAAQIAVIRKHADLPIIYTVRTVSQGGKFPDENVDELKSLLLLGIRLGVAYVDLQLTAPNELIEEISSKKGFTRVIGTYQDINGELKWNNVEWKNKYNQGVSMNADIVRLVGKANSIQDNLDLENFKKQNTLKPLIAFNLGSQGKLSQVLNGTFTPISHKLLPNDEEFLTIGELNQTYFDIGGFTAKKFWVIGSPIEHSRSPNLHNAGYKALNLPYQFGRFEATDVDVVYDNLINKPDFGGLAITMPLKLDIMKFATKLSDAAETIGAVNTLIPIEGGYFGDNTDWVGISNSFIRAGVPPKSSSNGLVVGAGGTSRAAIYALHQMGCAKIYLVNRTAAKLEELVKSFPKDYNLEIVETEQQADKASKVSLAVSCIPADKPLDGEVLKKIERILSNGSEQSAGFKPTLLEASYKPRVTPIMKLTEEQYKWKVIPGVEMLVNQGDRQFKLHTGFTAPYEIIHRAVVEE
[ "GO:0006082", "GO:0006520", "GO:0006810", "GO:0008150", "GO:0008152", "GO:0009058", "GO:0009072", "GO:0009073", "GO:0009410", "GO:0009987", "GO:0015711", "GO:0015801", "GO:0015849", "GO:0016053", "GO:0019752", "GO:0042221", "GO:0043436", "GO:0044238", "GO:0044281", "GO:0044283"...
[ "GO:0006082", "GO:0006520", "GO:0006810", "GO:0008150", "GO:0008152", "GO:0009058", "GO:0009072", "GO:0009073", "GO:0009410", "GO:0009987", "GO:0015711", "GO:0015801", "GO:0015849", "GO:0016053", "GO:0019752", "GO:0042221", "GO:0043436", "GO:0044238", "GO:0044281", "GO:0044283"...
[]
[]
AF-Q5AME2-F1-model_v6.pdb
237561.Q5AME2
[ "A0A1D8PMB8", "A0A1D8PFC8", "A0A1D8PRN2", "A0A1D8PGI8", "A0A1D8PJH8", "Q5A750", "A0A1D8PMR2", "Q5AMS9", "A0A1D8PL79", "Q5AMG5", "Q9P940", "A0A1D8PKY7", "Q5APD8", "A0A1D8PMB0", "A0A1D8PG20", "Q5A4M2", "Q59TS4", "Q5AB75", "Q59LX7", "A0A1D8PEG2", "A0A1D8PMH6", "Q5AMP2", "Q5A...
[ "IPR006264", "IPR013792", "IPR010110", "IPR008289", "IPR001381", "IPR016037", "IPR036291", "IPR036968", "IPR041121", "IPR013708", "IPR023193", "IPR000623", "IPR056179", "IPR027417", "IPR031322", "IPR013785", "IPR046346", "IPR030960", "IPR006151", "IPR001986" ]
{"IPR013792": [399, 834], "IPR036968": [405, 829], "IPR027417": [848, 1028], "IPR013785": [1029, 1267], "IPR046346": [1267, 1369], "IPR036291": [1370, 1549], "IPR008289": [1, 1551], "IPR016037": [13, 381], "IPR006264": [398, 838], "IPR000623": [858, 1025], "IPR031322": [867, 1019], "IPR001381": [1044, 1263], "IPR030960": [75, 186], "IPR056179": [188, 352], "IPR001986": [404, 832], "IPR010110": [1269, 1548], "IPR013708": [1276, 1357], "IPR006151": [1388, 1466], "IPR041121": [1519, 1548], "IPR023193": [478, 760]}
- Chorismate synthase - Catabolic 3-dehydroquinase - Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited - Phospho-2-dehydro-3-deoxyheptonate aldolase - Multifunctional tryptophan biosynthesis protein - Tryptophan synthase - Chorismate mutase - Anthranilate phosphoribosyltransferase - prephenate dehydratase - Histidine biosynthesis trifunctional protein
- IPR006264: 3-phosphoshikimate 1-carboxyvinyltransferase (family) [398-838] - IPR013792: RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/beta (homologous_superfamily) [399-834] - IPR010110: Shikimate dehydrogenase, AroM-type (domain) [1269-1548] - IPR008289: Pentafunctional AroM protein (family) [1-1551] - IPR001381: 3-dehydroquinate dehydratase type I (family) [1044-1263] - IPR016037: 3-dehydroquinate synthase AroB (family) [13-381] - IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [1370-1549] - IPR036968: Enolpyruvate transferase domain superfamily (homologous_superfamily) [405-829] - IPR041121: SDH, C-terminal (domain) [1519-1548] - IPR013708: Shikimate dehydrogenase substrate binding, N-terminal (domain) [1276-1357] - IPR023193: 3-phosphoshikimate 1-carboxyvinyltransferase, conserved site (conserved_site) [478-760] - IPR000623: Shikimate kinase/Threonine synthase-like 1 (family) [858-1025] - IPR056179: 3-dehydroquinate synthase, C-terminal domain (domain) [188-352] - IPR027417: P-loop containing nucleoside triphosphate hydrolase (homologous_superfamily) [848-1028] - IPR031322: Shikimate kinase/gluconokinase (family) [867-1019] - IPR013785: Aldolase-type TIM barrel (homologous_superfamily) [1029-1267] - IPR046346: Aminoacid dehydrogenase-like, N-terminal domain superfamily (homologous_superfamily) [1267-1369] - IPR030960: 3-dehydroquinate synthase, N-terminal domain (domain) [75-186] - IPR006151: Quinate/shikimate 5-dehydrogenase/glutamyl-tRNA reductase (domain) [1388-1466] - IPR001986: Enolpyruvate transferase domain (domain) [404-832]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016765 (transferase activity, transferring alkyl or aryl (other than methyl) groups) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0044249 (cellular biosynthetic process), GO:0006520 (amino acid metabolic process), GO:1901576 (organic substance biosynthetic process), GO:1901564 (organonitrogen compound metabolic process), GO:0044283 (small molecule biosynthetic process), GO:0006082 (organic acid metabolic process), GO:1901566 (organonitrogen compound biosynthetic process), GO:0008652 (amino acid biosynthetic process), GO:0016053 (organic acid biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:1901605 (alpha-amino acid metabolic process), GO:0019752 (carboxylic acid metabolic process), GO:0046394 (carboxylic acid biosynthetic process), GO:1901607 (alpha-amino acid biosynthetic process), GO:0009066 (aspartate family amino acid metabolic process), GO:0009067 (aspartate family amino acid biosynthetic process), GO:0006553 (lysine metabolic process), GO:0009085 (lysine biosynthetic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005622 (intracellular anatomical structure)
Q86WX3
Active regulator of SIRT1
Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre- rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre- ribosomal RNA by the RNA exosome. Acts as a chaperone that specifically mediates the integration of RPS19 in state post-A1. Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity
{ECO:0000303|PubMed:34516797};
136
Nucleus, nucleolus
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
[ "GO:0008150", "GO:0009987", "GO:0022613", "GO:0042254", "GO:0042274", "GO:0044085", "GO:0071840" ]
[ "GO:0008150", "GO:0009987", "GO:0022613", "GO:0042254", "GO:0042274", "GO:0044085", "GO:0071840" ]
[]
[]
AF-Q86WX3-F1-model_v6.pdb
9606.ENSP00000333948
[ "Q96A77", "P0CW22", "Q5BJI0", "P55769", "Q9Y3H5", "Q9Y2P8", "Q9BV24", "Q9NT55", "Q9NYH9", "Q6IPY4", "Q6IPH1", "Q9NRX1", "Q9BVZ0", "Q96BN0", "Q9NQ05", "Q8IZ30", "P62857", "Q9NZX3", "Q6IB08", "Q9NQZ2", "Q9BWK6", "Q86XJ9", "Q9NW23", "Q9UPI6", "Q9NWT8", "Q86WX9", "Q8N...
[ "IPR023262" ]
{"IPR023262": [1, 136]}
- NAD-dependent protein deacetylase sirtuin-1 - Small ribosomal subunit protein eS19 - Small ribosomal subunit protein eS1 - Small ribosomal subunit protein uS12 - WD repeat-containing protein 46 - Ribosomal RNA small subunit methyltransferase NEP1 - rRNA 2'-O-methyltransferase fibrillarin - U3 small nucleolar ribonucleoprotein protein MPP10 - U3 small nucleolar ribonucleoprotein protein IMP3 - Ribosomal RNA-processing protein 7 homolog A
- IPR023262: Active regulator of SIRT1 (family) [1-136]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0008380 (RNA splicing), GO:0006397 (mRNA processing), GO:0016071 (mRNA metabolic process), GO:0000398 (mRNA splicing, via spliceosome), GO:0000375 (RNA splicing, via transesterification reactions), GO:0000377 (RNA splicing, via transesterification reactions with bulged adenosine as nucleophile) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q5AC48
Actin-related protein 4
Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity)
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
468
Nucleus
MATASTTTVYGGDEINAIVLDPGSYTTRIGYAGDDFPKVITSSYYGQVKNDKKKIFGESINVPRANYDIKPILKESIIVDWDAAIEQYQYYFDQQLKVVGPEQPILITEPIWTETSYRQQLVETFFENFEFSGIYLAKSPTCVSFQQGRSNCLVVDLGHDSVSVTPVIDGICLLKSSMKTNYGGKFLSNEIQDYLIDTKKVVMEPSFKIKSKIPTTYPDPPKYELKNNNTIPTSSSSSLSQSFLEFQNEKIYHNFKEILEVPEKNSSSGTTTTTTTTNKDSSRLFELPTGQSIVIDRFKIAESIFDPTIYKFTNSKLSFPPNNGEISITQANEYRPLKRVRKNDDEEEDSNQSTPKPEVNIRGISQLISHTLSNIDIDLRASLANNIIVTGGVSLISQLTERLYLELSNNNPGLKIRLHAVGNSTERINQAWIGGSVLASLGTFHQMWVTKEEYNEVGVDRILNQRFR
[ "GO:0003674", "GO:0003824", "GO:0004402", "GO:0008080", "GO:0010485", "GO:0016407", "GO:0016410", "GO:0016740", "GO:0016746", "GO:0016747", "GO:0034212", "GO:0061733", "GO:0140096", "GO:0140186", "GO:0140993", "GO:0000123", "GO:0000785", "GO:0005575", "GO:0005622", "GO:0005694"...
[]
[ "GO:0003674", "GO:0003824", "GO:0004402", "GO:0008080", "GO:0010485", "GO:0016407", "GO:0016410", "GO:0016740", "GO:0016746", "GO:0016747", "GO:0034212", "GO:0061733", "GO:0140096", "GO:0140186", "GO:0140993" ]
[ "GO:0000123", "GO:0000785", "GO:0005575", "GO:0005622", "GO:0005694", "GO:0031248", "GO:0032991", "GO:0035267", "GO:0043189", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0110165", "GO:0140535", "GO:1902493", "GO:1902494", "GO:1902562", "GO:1990234" ]
AF-Q5AC48-F1-model_v6.pdb
237561.Q5AC48
[ "A0A1D8PS09", "A0A1D8PH73", "Q5GM21", "Q5ADM7", "A0A1D8PG88", "A0A1D8PKH5", "A0A1D8PIP3", "A0A1D8PGK4", "Q5ADQ0", "Q59QC2", "A0A1D8PEB6", "A0A1D8PPL1", "A0A1D8PML5", "A0A1D8PJ67", "Q5A6Q7", "Q5A190", "Q59QT2", "A0A1D8PIC9", "Q5AAJ7", "A0A1D8PG45", "A0A1D8PJG4", "Q59VN2", ...
[ "IPR004001", "IPR043129", "IPR004000" ]
{"IPR043129": [13, 465], "IPR004000": [12, 468], "IPR004001": [448, 456]}
- Actin - Arp8p - SWR1-complex protein 4 - Histone acetyltransferase - Helicase SWR1 - Enhancer of polycomb-like protein 1 - RuvB-like helicase 1 - RuvB-like helicase 2 - Chromatin-remodeling ATPase INO80 - Snf5p
- IPR004001: Actin, conserved site (conserved_site) [448-456] - IPR043129: ATPase, nucleotide binding domain (homologous_superfamily) [13-465] - IPR004000: Actin family (family) [12-468]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0140096 (catalytic activity, acting on a protein), GO:0016740 (transferase activity), GO:0016746 (acyltransferase activity), GO:0061733 (peptide-lysine-N-acetyltransferase activity), GO:0004402 (histone acetyltransferase activity), GO:0016747 (acyltransferase activity, transferring groups other than amino-acyl groups), GO:0016407 (acetyltransferase activity), GO:0010485 (histone H4 acetyltransferase activity), GO:0016410 (N-acyltransferase activity), GO:0008080 (N-acetyltransferase activity), GO:0034212 (peptide N-acetyltransferase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0071840 (cellular component organization or biogenesis), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0046483 (heterocycle metabolic process), GO:0016043 (cellular component organization), GO:0044249 (cellular biosynthetic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:0044260 (cellular macromolecule metabolic process), GO:0043170 (macromolecule metabolic process), GO:0009059 (macromolecule biosynthetic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0090304 (nucleic acid metabolic process), GO:0019438 (aromatic compound biosynthetic process), GO:0018130 (heterocycle biosynthetic process), GO:0006259 (DNA metabolic process), GO:0044271 (cellular nitrogen compound biosynthetic process), GO:0006325 (chromatin organization), GO:0044271 (cellular nitrogen compound biosynthetic process), GO:0043933 (protein-containing complex organization), GO:0006996 (organelle organization), GO:0034654 (nucleobase-containing compound biosynthetic process), GO:0006338 (chromatin remodeling), GO:0016070 (RNA metabolic process), GO:0006997 (nucleus organization), GO:0065003 (protein-containing complex assembly), GO:0071824 (protein-DNA complex subunit organization), GO:0032774 (RNA biosynthetic process), GO:0097659 (nucleic acid-templated transcription), GO:0051276 (chromosome organization), GO:0032200 (telomere organization), GO:0034728 (nucleosome organization), GO:0006351 (DNA-templated transcription), GO:0006354 (DNA-templated transcription elongation), GO:0006337 (nucleosome disassembly), GO:0006368 (transcription elongation by RNA polymerase II), GO:0006366 (transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0000785 (chromatin), GO:1902494 (catalytic complex), GO:0140513 (nuclear protein-containing complex), GO:0070603 (SWI/SNF superfamily-type complex), GO:0043229 (intracellular organelle), GO:1904949 (ATPase complex), GO:0043227 (membrane-bounded organelle), GO:0043228 (non-membrane-bounded organelle), GO:0016586 (RSC-type complex), GO:0043231 (intracellular membrane-bounded organelle), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0005694 (chromosome), GO:0005634 (nucleus)
O43150
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration
Homo sapiens (Human)
1,006
Cytoplasm. Golgi apparatus, Golgi stack membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Note=Colocalizes with F-actin and ARF6 in phagocytic cups
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPSTTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTNPLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKSTPLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-O43150-F1-model_v6.pdb
9606.ENSP00000281419
[ "Q6PID4", "Q5HYA4", "Q9NRJ5", "Q9ULH1", "P84085", "Q6FGZ2", "Q9NXK2", "Q9NYR0" ]
[ "IPR036028", "IPR011993", "IPR001452", "IPR037278", "IPR038508", "IPR001849", "IPR002110", "IPR036770", "IPR043593", "IPR037844", "IPR001164", "IPR027267", "IPR004148", "IPR035677" ]
{"IPR027267": [28, 328], "IPR011993": [300, 414], "IPR038508": [415, 547], "IPR037278": [420, 538], "IPR036770": [542, 693], "IPR036028": [929, 1004], "IPR043593": [1, 1006], "IPR004148": [33, 266], "IPR037844": [297, 403], "IPR001849": [305, 399], "IPR001164": [421, 543], "IPR001452": [944, 1006], "IPR035677": [948, 1003], "IPR002110": [584, 683]}
- ADP-ribosylation factor 6 - Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 - Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 - Protein-tyrosine kinase 2-beta - Paxillin - ADP-ribosylation factor 5 - Poly(A) polymerase beta - SH3 domain-containing kinase-binding protein 1
- IPR036028: SH3-like domain superfamily (homologous_superfamily) [929-1004] - IPR011993: PH-like domain superfamily (homologous_superfamily) [300-414] - IPR001452: SH3 domain (domain) [944-1006] - IPR037278: ARFGAP/RecO-like zinc finger (homologous_superfamily) [420-538] - IPR038508: ArfGAP domain superfamily (homologous_superfamily) [415-547] - IPR001849: Pleckstrin homology domain (domain) [305-399] - IPR002110: Ankyrin repeat (repeat) [584-683] - IPR036770: Ankyrin repeat-containing domain superfamily (homologous_superfamily) [542-693] - IPR043593: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein (family) [1-1006] - IPR037844: ASAP, PH domain (domain) [297-403] - IPR001164: Arf GTPase activating protein (domain) [421-543] - IPR027267: AH/BAR domain superfamily (homologous_superfamily) [28-328] - IPR004148: BAR domain (domain) [33-266] - IPR035677: ASAP2, SH3 domain (domain) [948-1003]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0071840 (cellular component organization or biogenesis), GO:0016043 (cellular component organization), GO:0044085 (cellular component biogenesis), GO:0006996 (organelle organization), GO:0030030 (cell projection organization), GO:0022607 (cellular component assembly), GO:0044782 (cilium organization), GO:0070925 (organelle assembly), GO:0030031 (cell projection assembly), GO:0120036 (plasma membrane bounded cell projection organization), GO:0060271 (cilium assembly), GO:0120031 (plasma membrane bounded cell projection assembly) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
Q59LV8
Activator of stress genes protein 1
Transcription factor necessary to sustain growth on non- fermentative carbon sources such as sodium acetate, acetic acid, or ethanol. Plays a role in hyphal formation
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
990
Nucleus
MPKREIEDTQSPYSSTGLVSTGESPKTSTSTPTSSTNNRAATTTTNNTSTTSTSLLKSNSNLQPIAMTPSVSSTSLAINKPKSQENKRRRVTRACDTCRQKKVKCDGKQPCIHCTVYSYKCSYDQPNIRNKKNSGIPIPSQPSPAILQVAAQAAVAFGSNNNSSNQQSLQSLQQQQQHVVHQHQHQPLPADEPIPKTNLIIFQQIINALLPKLQLNGFDPNLQFDLNKFQKVVQYVMSKSQTFTLNLNEITELMQDPDSQIPPPPPASSSSSHHRRTLSVGSFDDSSNSAVSSPREVGLHLPSKEVALNLIYTTWNKACVLFRFYHRPSLLEEVDLLYSLDPMNYGDRQQKFLPFLYSILACGSLFSKTPYTMGTPSENEKNLEDDGFKYFLEARKLIDISNVGDINSIQTVVMMIIYLQCSARLSTCYSYIGIALRSALKEGLHRNLTLFQNSKKKLDPIEEDTRKRLFYTIYKMDIYINSLLGLPRSLNEDEFDQLLPVELDDENVTRTEYLFDKQQGRLSSSGCANQHTKLMFILSHIIKKMYPIKVKPEEAENSSNVNYSRDRIHAKVTELEVELKNWLDNLPQELKPIDPSSTTKDVIDEVPEKFRLANYYLHLAFLNCQIILYRPFIHFISDSMDGSSSDPRSLIRGRNCIKVARMVVKLANKMIDHKLLLGTYWFSMYTIFFSIACLIYYFHFANYNNNGQGFNYAGILFDDDLNIDMIKKDIEIGKKVLDNLKNSSNSSLRIYNILNTMFEQLNRRTASRSRQVTATTNSTTTTANTNSNSNSNSQPTTLPANFQNVNVKNTFENFDNMNHFVKKERERERESLSQLFDNTSMAKFESSSEIPKNVANIQRVATPLEENNKEIGEVSGGNLTSNYMPGVFDKLDTQIFGKILPPYMLEKNETMNYNSNNNNSNNVNNNFNNNNNAGEVNNNSNGVAYNNNAANWPLNNAEDGLNLEDLFGTLGNNGNGGTSSSNGLEYLDPF
[ "GO:0006355", "GO:0006357", "GO:0008150", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010570", "GO:0010604", "GO:0019219", "GO:0019222", "GO:0030447", "GO:0040007", "GO:0040008", "GO:0044182", "GO:0045893", "GO:0045944", "GO:0048518"...
[ "GO:0006355", "GO:0006357", "GO:0008150", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010570", "GO:0010604", "GO:0019219", "GO:0019222", "GO:0030447", "GO:0040007", "GO:0040008", "GO:0044182", "GO:0045893", "GO:0045944", "GO:0048518"...
[]
[]
AF-Q59LV8-F1-model_v6.pdb
237561.Q59LV8
[ "Q5APC5" ]
[ "IPR001138", "IPR036864", "IPR007219", "IPR051711" ]
{"IPR036864": [84, 191], "IPR051711": [1, 892], "IPR001138": [89, 132], "IPR007219": [314, 583]}
- SURF1-like protein
- IPR001138: Zn(2)Cys(6) fungal-type DNA-binding domain (domain) [89-132] - IPR036864: Zn(2)-C6 fungal-type DNA-binding domain superfamily (homologous_superfamily) [84-191] - IPR007219: Xylanolytic transcriptional activator, regulatory domain (domain) [314-583] - IPR051711: Stress Response Regulator (family) [1-892]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0097159 (organic cyclic compound binding), GO:0003700 (DNA-binding transcription factor activity), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0009605 (response to external stimulus), GO:0019222 (regulation of metabolic process), GO:0009607 (response to biotic stimulus), GO:0044010 (single-species biofilm formation), GO:0050794 (regulation of cellular process), GO:0098743 (cell aggregation), GO:0030447 (filamentous growth), GO:0048522 (positive regulation of cellular process), GO:0009991 (response to extracellular stimulus), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0098630 (aggregation of unicellular organisms), GO:0036180 (filamentous growth of a population of unicellular organisms in response to biotic stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0030155 (regulation of cell adhesion), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0045785 (positive regulation of cell adhesion), GO:0090609 (single-species submerged biofilm formation), GO:0080090 (regulation of primary metabolic process), GO:0010811 (positive regulation of cell-substrate adhesion), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0010810 (regulation of cell-substrate adhesion), GO:0031667 (response to nutrient levels), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0042710 (biofilm formation), GO:0051252 (regulation of RNA metabolic process), GO:0044011 (single-species biofilm formation on inanimate substrate), GO:0010468 (regulation of gene expression), GO:1900187 (regulation of cell adhesion involved in single-species biofilm formation), GO:0090605 (submerged biofilm formation), GO:2001141 (regulation of RNA biosynthetic process), GO:1900189 (positive regulation of cell adhesion involved in single-species biofilm formation), GO:0006355 (regulation of DNA-templated transcription), GO:0006357 (regulation of transcription by RNA polymerase II), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q708S7
Acid-sensing ion channel 1A
Forms voltage-independent, pH-gated trimeric sodium channels that act as postsynaptic excitatory receptors in the nervous system, playing a crucial role in regulating synaptic plasticity, learning, and memory. Upon extracellular pH drop this channel elicits transient, fast activating, and completely desensitizing inward currents. Displays high selectivity for sodium ions but can also permit the permeation of other cations (By similarity)
Danio rerio (Zebrafish) (Brachydanio rerio)
501
Cell membrane; Multi-pass membrane protein. Postsynaptic cell membrane. Cell projection, dendrite
MKTSVMDLKVEPMDIDFDQPPPLQVFAHTSTLHGISHIFSYEKITAKCCLWVVFFLSSLTFLMYVCIDRIQFYLEYPHVTKLDEITTPVMVFPAVTICNLNSIRFSRITRNDLYHAGELLALLNSRHEVREAHLVEESVMEVLKSKTDFRSFKPRHFNMWEFYNRTGHDIKDMLLSCQFRGSPCRPEDFSVVFTRYGKCYTFNSGETGPPRVSVKGGMGNGLEIMLDIQQDEYLPVWGESDESSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPSSDYFRAYSISACRTDCETRYLVENCNCRMVHMPGDAPYCTPVLYKECAHPALDFLVETDSDYCSCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEKYITENVMVLDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVMKYRLCRCSNKKHHNNNNNTDHNAVFSLDDVNCHVSKFH
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-Q708S7-F1-model_v6.pdb
7955.ENSDARP00000011782
null
[ "IPR001873", "IPR020903", "IPR004724" ]
{"IPR001873": [24, 469], "IPR004724": [136, 480], "IPR020903": [307, 327]}
- IPR001873: Epithelial sodium channel (family) [24-469] - IPR020903: Epithelial sodium channel, conserved site (conserved_site) [307-327] - IPR004724: Epithelial sodium channel, chordates (family) [136-480]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005215 (transporter activity), GO:0022857 (transmembrane transporter activity), GO:1901702 (salt transmembrane transporter activity), GO:0015075 (monoatomic ion transmembrane transporter activity), GO:0022803 (passive transmembrane transporter activity), GO:0015318 (inorganic molecular entity transmembrane transporter activity), GO:0005216 (monoatomic ion channel activity), GO:0022890 (inorganic cation transmembrane transporter activity), GO:0015267 (channel activity), GO:0008324 (monoatomic cation transmembrane transporter activity), GO:0015081 (sodium ion transmembrane transporter activity), GO:0005261 (monoatomic cation channel activity), GO:0005272 (sodium channel activity), GO:0022839 (monoatomic ion gated channel activity), GO:0022836 (gated channel activity), GO:0046873 (metal ion transmembrane transporter activity), GO:0015280 (ligand-gated sodium channel activity), GO:0099094 (ligand-gated monoatomic cation channel activity), GO:0022834 (ligand-gated channel activity), GO:0015276 (ligand-gated monoatomic ion channel activity) Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0009719 (response to endogenous stimulus), GO:0042221 (response to chemical), GO:0010033 (response to organic substance), GO:0009725 (response to hormone), GO:0048545 (response to steroid hormone), GO:0033993 (response to lipid), GO:0014070 (response to organic cyclic compound) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q708S8
Acid-sensing ion channel 1B
Forms voltage-independent, pH-gated trimeric sodium channels that act as postsynaptic excitatory receptors in the nervous system, playing a crucial role in regulating synaptic plasticity, learning, and memory. Upon extracellular pH drop this channel elicits transient, fast activating, and completely desensitizing inward currents. Displays high selectivity for sodium ions but can also permit the permeation of other cations (By similarity)
Danio rerio (Zebrafish) (Brachydanio rerio)
557
Cell membrane; Multi-pass membrane protein. Postsynaptic cell membrane. Cell projection, dendrite
MVRITCTISFSTDDEPVGRSRQGSFDDHYKRVVWSKDGEQGKYQEEGDDPDAYDGPEDEEAPDISLATFFGGCSLHGANHVFVEDKKFSIRQGLWALVFLLAISMFLLQVVDRVIYYLQYDYVTLLDERNAKNMTFPAITLCNYNTFRRSQLSYSDLLFMGPLLGYEDNMAPGIPLAPEPDRQGSRFSLAEFFNRTRHRMDDMLLECNFAGKECGAEHWREIFTRYGKCYTFNSGQDGRPLLITTKGGMGNGLEIMLDIQQDEYLPVWGETDETTFEAGIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKATPIDSDFFNTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNMTRYGKELSFVRIPSKASAKYLAKKYNKTEQYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEVIKFKLCRCAKKKHQRSNNNERGAVLSLDDVKRHAPCDNLRTPSTYPANMLPHHPGQGNFEDFTC
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-Q708S8-F1-model_v6.pdb
null
null
[ "IPR001873", "IPR020903", "IPR004724" ]
{"IPR001873": [67, 498], "IPR004724": [191, 514], "IPR020903": [338, 358]}
- IPR001873: Epithelial sodium channel (family) [67-498] - IPR020903: Epithelial sodium channel, conserved site (conserved_site) [338-358] - IPR004724: Epithelial sodium channel, chordates (family) [191-514]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005215 (transporter activity), GO:0022857 (transmembrane transporter activity), GO:1901702 (salt transmembrane transporter activity), GO:0015075 (monoatomic ion transmembrane transporter activity), GO:0022803 (passive transmembrane transporter activity), GO:0015318 (inorganic molecular entity transmembrane transporter activity), GO:0005216 (monoatomic ion channel activity), GO:0022890 (inorganic cation transmembrane transporter activity), GO:0015267 (channel activity), GO:0008324 (monoatomic cation transmembrane transporter activity), GO:0015081 (sodium ion transmembrane transporter activity), GO:0005261 (monoatomic cation channel activity), GO:0005272 (sodium channel activity), GO:0022839 (monoatomic ion gated channel activity), GO:0022836 (gated channel activity), GO:0046873 (metal ion transmembrane transporter activity), GO:0015280 (ligand-gated sodium channel activity), GO:0099094 (ligand-gated monoatomic cation channel activity), GO:0022834 (ligand-gated channel activity), GO:0015276 (ligand-gated monoatomic ion channel activity) Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0009719 (response to endogenous stimulus), GO:0042221 (response to chemical), GO:0010033 (response to organic substance), GO:0009725 (response to hormone), GO:0048545 (response to steroid hormone), GO:0033993 (response to lipid), GO:0014070 (response to organic cyclic compound) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q708S6
Acid-sensing ion channel 1C
Forms voltage-independent, pH-gated trimeric sodium channels that act as postsynaptic excitatory receptors in the nervous system, playing a crucial role in regulating synaptic plasticity, learning, and memory. Upon extracellular pH drop this channel elicits transient, fast activating, and completely desensitizing inward currents. Displays high selectivity for sodium ions but can also permit the permeation of other cations (By similarity)
Danio rerio (Zebrafish) (Brachydanio rerio)
529
Cell membrane; Multi-pass membrane protein. Postsynaptic cell membrane. Cell projection, dendrite
MTAMKGDSEDSIESMRPSNLQVFANNSTLHGMSHIFAYGHMTFRRFLWTLSFMGSLGLLMYVCMDRVYYYFEFPHVTKLDEVAAPNLTFPAVTFCNLNEFRFSKITKNDLYHVGELLALLNENYQIANPHLADPEVLTLLKEKASFNGFKPKQFNMTDFYNRTGHDINEMLLQCSFRGEECFPLNFTTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLLYLPPPWGDCRSAPMDSEYFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPEQYKDCADPALDFLVEKDNDYCVCDTPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYITDNILVLDIFFEALNYEKIEQKKAYEVAGLLGDIGGQMGLFIGASVLTILEIFDYLYEVLKDKILGSVLRKRRPHRSASDNLVIVSLHDFKISSVFLLASYMCFVCYIVLLNAACVYLPFVVGSNSGK
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-Q708S6-F1-model_v6.pdb
7955.ENSDARP00000130223
[ "F1QZB9" ]
[ "IPR001873", "IPR020903", "IPR004724" ]
{"IPR001873": [20, 461], "IPR004724": [140, 475], "IPR020903": [305, 325]}
- Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
- IPR001873: Epithelial sodium channel (family) [20-461] - IPR020903: Epithelial sodium channel, conserved site (conserved_site) [305-325] - IPR004724: Epithelial sodium channel, chordates (family) [140-475]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005215 (transporter activity), GO:0022857 (transmembrane transporter activity), GO:1901702 (salt transmembrane transporter activity), GO:0015075 (monoatomic ion transmembrane transporter activity), GO:0022803 (passive transmembrane transporter activity), GO:0015318 (inorganic molecular entity transmembrane transporter activity), GO:0005216 (monoatomic ion channel activity), GO:0022890 (inorganic cation transmembrane transporter activity), GO:0015267 (channel activity), GO:0008324 (monoatomic cation transmembrane transporter activity), GO:0015081 (sodium ion transmembrane transporter activity), GO:0005261 (monoatomic cation channel activity), GO:0005272 (sodium channel activity), GO:0022839 (monoatomic ion gated channel activity), GO:0022836 (gated channel activity), GO:0046873 (metal ion transmembrane transporter activity), GO:0015280 (ligand-gated sodium channel activity), GO:0099094 (ligand-gated monoatomic cation channel activity), GO:0022834 (ligand-gated channel activity), GO:0015276 (ligand-gated monoatomic ion channel activity) Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0009719 (response to endogenous stimulus), GO:0042221 (response to chemical), GO:0010033 (response to organic substance), GO:0009725 (response to hormone), GO:0048545 (response to steroid hormone), GO:0033993 (response to lipid), GO:0014070 (response to organic cyclic compound) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q708S4
Acid-sensing ion channel 4-A
Could form pH-gated trimeric sodium channels and function as a postsynaptic excitatory receptors in the nervous system
Danio rerio (Zebrafish) (Brachydanio rerio)
539
Cell membrane; Multi-pass membrane protein
MPIEFVCKIKFAEEDEKQKGNQDGDKESLIEESCSPPTKDLAGFASASSLHGINHIFVSGRLGVRQTLWALAFLVSLALFLYQAAKCAISYLEHPHVTALNEEATPEMVFPAVTICNINRFRFSALTDADIYHLANLTGLPPKNKDGHKPTDLEYPAPDMQDIFNRTGHQLEEMLKSCNFSGQNCSAEDFTVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIMLDIQQDDYLPIWKETNETSLEAGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSTSEQMIPGYDTYSISACRLRCETLEVLRECKCRMVHMPGDANICTPSDIKCVDKALALLQKSSGDTCFCETPCNLTRYGKELSMVKIPSKGSARYLSRKYDKSEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYVYEVIKHRLERLLRPQRDDKKQTQQQQQASTVATVNLEEMKAKDSSEMSRSHSEGAYANTILPNHHHHHRTHHRVSEDFAC
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-Q708S4-F1-model_v6.pdb
7955.ENSDARP00000035525
null
[ "IPR001873", "IPR020903" ]
{"IPR001873": [42, 465], "IPR020903": [308, 328]}
- IPR001873: Epithelial sodium channel (family) [42-465] - IPR020903: Epithelial sodium channel, conserved site (conserved_site) [308-328]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005215 (transporter activity), GO:0022857 (transmembrane transporter activity), GO:1901702 (salt transmembrane transporter activity), GO:0015075 (monoatomic ion transmembrane transporter activity), GO:0022803 (passive transmembrane transporter activity), GO:0015318 (inorganic molecular entity transmembrane transporter activity), GO:0005216 (monoatomic ion channel activity), GO:0022890 (inorganic cation transmembrane transporter activity), GO:0015267 (channel activity), GO:0008324 (monoatomic cation transmembrane transporter activity), GO:0015081 (sodium ion transmembrane transporter activity), GO:0005261 (monoatomic cation channel activity), GO:0005272 (sodium channel activity), GO:0022839 (monoatomic ion gated channel activity), GO:0022836 (gated channel activity), GO:0046873 (metal ion transmembrane transporter activity), GO:0015280 (ligand-gated sodium channel activity), GO:0099094 (ligand-gated monoatomic cation channel activity), GO:0022834 (ligand-gated channel activity), GO:0015276 (ligand-gated monoatomic ion channel activity) Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0009719 (response to endogenous stimulus), GO:0042221 (response to chemical), GO:0010033 (response to organic substance), GO:0009725 (response to hormone), GO:0048545 (response to steroid hormone), GO:0033993 (response to lipid), GO:0014070 (response to organic cyclic compound) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q708S3
Acid-sensing ion channel 4-B
Does not exhibit measurable stand-alone pH-gated sodium channel activity but may form pH-gated heterotrimeric sodium channels
Danio rerio (Zebrafish) (Brachydanio rerio)
558
Cell membrane; Multi-pass membrane protein
MPIEFVCKIKFAEGEEAKGASTEGGGTGMLDEGLRRQKEGMADLASFASSSSLHGLARALGTSERLGFRQTLWGLALLVSLGLFLYQATWSAATYLERPHLAALREETRRELTFPAITLCNVNRFRFSALTDADIYHLANLTGLPPKSRKGHRPSELQYPPPNMLDIFQRTGHQLEDMLKSCNFSGQNCSSEDFSVVYTRYGKCYTFNGNKTSPKRVRQGGTGNGLEMMLDIQQDEYLPIWRETNETTLEAGIRVQIHSQNEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRASSEPVIPGYDTYSVSACRLHCESTQVQRECNCRMVHMPGDADICAPSKIKCVDKALASLQKSTGDSCPCETPCNLTRYGKELSMVKIPSRGSARYLSRKYQKSEEYIRDNFLILDIFFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVAKNKIKQLLKPKKSQKQTNQRNLIQEQIQRTKNLREQNLKAQLTAGAIATVRFEEVKVKAANDVAQPHSAHPTSVLPNHHNAQQAVQQDFAC
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-Q708S3-F1-model_v6.pdb
7955.ENSDARP00000095487
[ "A3KPJ8" ]
[ "IPR001873", "IPR020903" ]
{"IPR001873": [40, 467], "IPR020903": [312, 332]}
- IPR001873: Epithelial sodium channel (family) [40-467] - IPR020903: Epithelial sodium channel, conserved site (conserved_site) [312-332]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005215 (transporter activity), GO:0022857 (transmembrane transporter activity), GO:0015075 (monoatomic ion transmembrane transporter activity), GO:0022803 (passive transmembrane transporter activity), GO:0005216 (monoatomic ion channel activity), GO:0015267 (channel activity), GO:0008324 (monoatomic cation transmembrane transporter activity), GO:0005261 (monoatomic cation channel activity) Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0009719 (response to endogenous stimulus), GO:0042221 (response to chemical), GO:0010033 (response to organic substance), GO:0009725 (response to hormone), GO:0048545 (response to steroid hormone), GO:0033993 (response to lipid), GO:0014070 (response to organic cyclic compound) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q5AMH1
DASH complex subunit ASK1
Component of the DASH complex that connects microtubules with kinetochores and couples microtubule depolymerisation to chromosome movement; it is involved in retrieving kinetochores to the spindle poles before their re-orientation on the spindle in early mitosis and allows microtubule depolymerization to pull chromosomes apart and resist detachment during anaphase (By similarity). Kinetochores, consisting of a centromere-associated inner segment and a microtubule- contacting outer segment, play a crucial role in chromosome segregation by mediating the physical connection between centromeric DNA and microtubules (By similarity). Kinetochores also serve as an input point for the spindle assembly checkpoint, which delays anaphase until all chromosomes have bioriented on the mitotic spindle
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
594
Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Nucleus
MKRYSIAPTSSRRKSAIDATLPESNLPARQILEQLDQDTTFVLQEIDKNISRANTVINDKIKPMIQEYAFQSWKVWENTGFWKHFFEQSANVELDSYVEPINEVNPQNNFLLLNEIEKNKQKGRYEDSRGSNKVNQANNDENNDIDNDEKEEPEIAFKKPNLRRLVADGNTPTWSTEHTKPSMKSIQLSPPKRMQTTNFTGGLARENTKLTDSITLEPPALSAETRAVTSSPHSRHYQNQHQRLQSRDSPIKIHTIRQSLDTYHRVSISPKKLKTPIRSTRTSRIESILNSSPILPEPPVLQSEIGSETPKYMSSSSPMKKQQQQQRESLNFQSDNDQQQGLQRFPNTPKYSRLSGSSVNSLLSNKSNLSDDEDDHINPPPQLDSDNHGVVIDNSDTNNNNGDSSDDLAALPVPELNTIDFKDKNSNNNNKRSIQSTPRSSEKKRRSINTKNTNNNNTSAAATAVVVDDDDDRENVFLDHSYKKTPDNQQSNNSTRFFSTGGSNNDNHTETQDNSKSFSQIYDEAISKIRGKKTTSQSNDQNGDEDGDVVMSLDMTVTKDLTGEPTKDLSKDLTENSTTDLGPFRERWKKLTRK
[ "GO:0008150", "GO:0030447", "GO:0040007" ]
[ "GO:0008150", "GO:0030447", "GO:0040007" ]
[]
[]
AF-Q5AMH1-F1-model_v6.pdb
237561.Q5AMH1
[ "A0A1D8PM85", "A0A1D8PMD4", "Q5A6Q0", "Q59PZ2", "Q59VC6", "Q59ZG8", "Q59P88", "A0A1D8PFP9", "Q5APC8", "A0A1D8PTL5", "Q59QH6" ]
[ "IPR013964" ]
{"IPR013964": [1, 569]}
- Tubulin gamma chain - Spindle pole body component - DASH complex subunit DAD3 - DASH complex subunit DAD2 - DASH complex subunit DAM1 - DASH complex subunit SPC34 - DASH complex subunit SPC19 - DASH complex subunit DAD1 - DASH complex subunit DUO1 - Actin-related protein 5
- IPR013964: DASH complex subunit Ask1 (family) [1-569]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0005515 (protein binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding), GO:0003690 (double-stranded DNA binding), GO:0043565 (sequence-specific DNA binding), GO:1990837 (sequence-specific double-stranded DNA binding), GO:0019237 (centromeric DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0022402 (cell cycle process), GO:0007049 (cell cycle), GO:0007059 (chromosome segregation) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0098687 (chromosomal region), GO:0099080 (supramolecular complex), GO:0000940 (outer kinetochore), GO:0140513 (nuclear protein-containing complex), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0000775 (chromosome, centromeric region), GO:0000776 (kinetochore), GO:0043228 (non-membrane-bounded organelle), GO:0000779 (condensed chromosome, centromeric region), GO:0043231 (intracellular membrane-bounded organelle), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0005694 (chromosome), GO:0005634 (nucleus), GO:0000793 (condensed chromosome)
A0A8I3NQW8
PAT complex subunit Asterix
Component of the multi-pass translocon (MPT) complex that mediates insertion of multi-pass membrane proteins into the lipid bilayer of membranes. The MPT complex takes over after the SEC61 complex: following membrane insertion of the first few transmembrane segments of proteins by the SEC61 complex, the MPT complex occludes the lateral gate of the SEC61 complex to promote insertion of subsequent transmembrane regions. Within the MPT complex, the PAT subcomplex sequesters any highly polar regions in the transmembrane domains away from the non-polar membrane environment until they can be buried in the interior of the fully assembled protein. Within the PAT subcomplex, WDR83OS/Asterix binds to and redirects the substrate to a location behind the SEC61 complex
homolog;
106
Endoplasmic reticulum membrane; Multi-pass membrane protein
MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW
[ "GO:0006996", "GO:0007029", "GO:0008104", "GO:0008150", "GO:0009987", "GO:0010256", "GO:0016043", "GO:0033036", "GO:0033365", "GO:0045048", "GO:0045184", "GO:0051179", "GO:0051205", "GO:0051234", "GO:0051641", "GO:0051668", "GO:0061024", "GO:0071840", "GO:0090150", "GO:0160063"...
[ "GO:0006996", "GO:0007029", "GO:0008104", "GO:0008150", "GO:0009987", "GO:0010256", "GO:0016043", "GO:0033036", "GO:0033365", "GO:0045048", "GO:0045184", "GO:0051179", "GO:0051205", "GO:0051234", "GO:0051641", "GO:0051668", "GO:0061024", "GO:0071840", "GO:0090150", "GO:0160063"...
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005783", "GO:0005789", "GO:0005829", "GO:0012505", "GO:0016020", "GO:0031090", "GO:0031984", "GO:0032991", "GO:0042175", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0072379", "GO:0098827", "GO:0110165", "GO:0160064"...
AF-A0A8I3NQW8-F1-model_v6.pdb
null
null
[ "IPR005351" ]
{"IPR005351": [2, 106]}
- IPR005351: PAT complex subunit Asterix (family) [2-106]
Molecular Function (MF): GO:0003674 (molecular function), GO:0044183 (protein folding chaperone) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0051179 (localization), GO:0051234 (establishment of localization), GO:0051641 (cellular localization), GO:0071840 (cellular component organization or biogenesis), GO:0033036 (macromolecule localization), GO:0070727 (cellular macromolecule localization), GO:0016043 (cellular component organization), GO:0051668 (localization within membrane), GO:0045184 (establishment of protein localization), GO:0008104 (protein localization), GO:0006996 (organelle organization), GO:0010256 (endomembrane system organization), GO:0090150 (establishment of protein localization to membrane), GO:0061024 (membrane organization), GO:0072657 (protein localization to membrane), GO:0051205 (protein insertion into membrane), GO:0033365 (protein localization to organelle), GO:0007029 (endoplasmic reticulum organization), GO:0045048 (protein insertion into ER membrane) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:0110165 (cellular anatomical entity), GO:0140535 (intracellular protein-containing complex), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0031984 (organelle subcompartment), GO:0042175 (nuclear outer membrane-endoplasmic reticulum membrane network), GO:0101031 (chaperone complex), GO:0031090 (organelle membrane), GO:0005783 (endoplasmic reticulum), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0098827 (endoplasmic reticulum subcompartment), GO:0043231 (intracellular membrane-bounded organelle), GO:0005789 (endoplasmic reticulum membrane)
Q5AAU5
Cell wall acid trehalase ATC1
Cell wall acid trehalase that catalyzes hydrolysis of the disaccharide trehalose and required for growth on trehalose as carbon source. Plays a role in dimorphic conversion and virulence
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,078
Secreted, cell wall
MAANSSFFLADNCAPHNQSFIQFCIHAASKKKGRIALMCLANLFLLFSFHLLYARFCSGFPYVVPSTARSTNQIFHTNLEQLVNSPENKQIFSQLKFSDQAFYDPHDNVVGTTEFPVFNQYQRQPYVANGYIGSRIPNLGQGFTYDQLTNSSTANDDDLLNGWPLFNKRYSGAFVAGFYDLQKNTTGTNFAELLENGYESVIAAVPQWTALSLSVEILGKKYTLDPSLEHEAIGDITNYVQNMSLSDGIVTTQFTWLNTFDVKYEILAHRENINLGLVNMQVYNPGNESVQVIVSDVLDFNSSQRCQLNQISHDKNGIYVTFHPQGLSYIDGAIYSTLSANGQITREQTNETVFQNVELTIEPHSCVQVAKYVGIATTDLDPDSFKTADDVLKFARKVSQNKKHGDATQLVNSHRSAWSKIIQDAPLVTFPSDSLLNLGARASIFHLLANTRPNAEGVTGALGVSGLSSDSYGGMVFWDTDLWMLNGILPFAPDHIKSFINYRVHLHQQAIDNVPRGYQGAVYPWTSGRFGNCTGTGPCLDYEYHINMAVAMASWQLYISGAADDTFLESVAYPIINDAASFLAEYVVHYNDTLGKYTTKNLTDPDEFANHVDNGAYTNTGIVLVMRWAQIAGSILGKQVPKIYHDIETAMFLPTAENTQNITLEYSGMNSSVGIKQADVIMMTYPLENELIDQDQAYINMEFYSMKQVGYGPAMTFPIFSIVASNLAFTGCASQSYLHKAIQPFLRGPFAQFAEQNNDDYLTNGGTHPAFPFLTAHGGFLQAILQGLTGMRFDYTFENNKLQRLLKLDPIALPCLGEGVRFDSIKYDNHTLSMAINETHFTIKNKGKTTPNARNYVTILLAERNAMHGKYTINDEDEQSFPLFETSESFPDSISECNKAGFFNITEGAYGDVSISINDGDNTTSWQAKYNDTTGKVLVDLKSFRNISSGTFIWGDKPPKRVKVSKYSGSSFTAVTDFFAQVDFGNELFNEYKYANPEGKLHNQSDVFEEVYSGDVKISAPFDPEEYFQVWVPTRHNITEVAVNLQTRFLLIEVDEIHNTEAIDGDYGGAKLAEVVFY
[ "GO:0005975", "GO:0005984", "GO:0005991", "GO:0005993", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009311", "GO:0009313", "GO:0009987", "GO:0016052", "GO:0044238", "GO:0046352", "GO:0003674", "GO:0003824", "GO:0004553", "GO:0004555", "GO:0015927", "GO:0016787", "GO:0016798"...
[ "GO:0005975", "GO:0005984", "GO:0005991", "GO:0005993", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009311", "GO:0009313", "GO:0009987", "GO:0016052", "GO:0044238", "GO:0046352" ]
[ "GO:0003674", "GO:0003824", "GO:0004553", "GO:0004555", "GO:0015927", "GO:0016787", "GO:0016798" ]
[ "GO:0005575", "GO:0005576", "GO:0005618", "GO:0009277", "GO:0030312", "GO:0031982", "GO:0043226", "GO:0043227", "GO:0043230", "GO:0065010", "GO:0071944", "GO:0110165", "GO:1903561" ]
AF-Q5AAU5-F1-model_v6.pdb
237561.Q5AAU5
[ "Q92410", "A0A1D8PRR3" ]
[ "IPR037018", "IPR005196", "IPR012341", "IPR008928", "IPR005195", "IPR011013" ]
{"IPR037018": [109, 379], "IPR011013": [166, 378], "IPR008928": [388, 844], "IPR012341": [437, 771], "IPR005196": [119, 379], "IPR005195": [442, 633]}
- Trehalase - Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
- IPR037018: Glycoside hydrolase family 65, N-terminal domain (homologous_superfamily) [109-379] - IPR005196: Glycoside hydrolase, family 65, N-terminal (domain) [119-379] - IPR012341: Six-hairpin glycosidase-like superfamily (homologous_superfamily) [437-771] - IPR008928: Six-hairpin glycosidase superfamily (homologous_superfamily) [388-844] - IPR005195: Glycoside hydrolase, family 65, central catalytic (domain) [442-633] - IPR011013: Galactose mutarotase-like domain superfamily (homologous_superfamily) [166-378]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0016798 (hydrolase activity, acting on glycosyl bonds), GO:0004553 (hydrolase activity, hydrolyzing O-glycosyl compounds), GO:0015927 (trehalase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0009056 (catabolic process), GO:0044238 (primary metabolic process), GO:0005975 (carbohydrate metabolic process), GO:1901575 (organic substance catabolic process), GO:0044248 (cellular catabolic process), GO:0044262 (cellular carbohydrate metabolic process), GO:0044275 (cellular carbohydrate catabolic process), GO:0009311 (oligosaccharide metabolic process), GO:0016052 (carbohydrate catabolic process), GO:0005984 (disaccharide metabolic process), GO:0005991 (trehalose metabolic process), GO:0046352 (disaccharide catabolic process), GO:0009313 (oligosaccharide catabolic process), GO:0005993 (trehalose catabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0005576 (extracellular region), GO:0031012 (extracellular matrix), GO:0062039 (biofilm matrix), GO:0062040 (fungal biofilm matrix)
Q86CR6
Ubiquitin-like protein atg12
Ubiquitin-like protein involved in autophagy vesicles formation. Required for atg8 association to the vesicle membranes. Conjugated to atg5 through a ubiquitin-like conjugating system involving also atg7 as an E1-like activating enzyme is essential for its function (By similarity)
Dictyostelium discoideum (Social amoeba)
124
Cytoplasm
MEEEEKNNNEVASPTEQNTESTTEQQPQLPVKITSESKIIVYFKNAGGAQPLKQKKFKIQANVSFQNVIDKLRGQLKLKSNESLFLFINQVFQPSPDEILGELYKCFSHNDQLIINYSLQMAWG
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0032991", "GO:0034274", "GO:0110165", "GO:1902494", "GO:1990234" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0032991", "GO:0034274", "GO:0110165", "GO:1902494", "GO:1990234" ]
AF-Q86CR6-F1-model_v6.pdb
44689.Q86CR6
[ "Q54G11", "Q54QM7", "Q86CR8", "Q86CS0", "Q86CS1", "Q54SX2", "Q86CR9", "Q54NL4", "Q86CR7", "Q54NA2", "Q86CR5", "Q54J54", "Q86K79", "Q54HA2", "Q55EL2", "Q55CE3", "Q553S4", "Q54Q21", "Q54S77", "Q54DY0", "Q54JI9", "Q86CS2" ]
[ "IPR007242", "IPR029071" ]
{"IPR029071": [16, 124], "IPR007242": [31, 124]}
- Autophagy protein 5 - Ubiquitin-like modifier-activating enzyme atg7 - Autophagy-related protein 3 - Protein tipD - Ubiquitin-like-conjugating enzyme ATG10 - Autophagy-related protein 18 - Autophagy-related protein 8 - Serine/threonine-protein kinase atg1 - Probable serine/threonine-protein kinase vps15 - Autophagy-related protein 9
- IPR007242: Ubiquitin-like protein Atg12 (family) [31-124] - IPR029071: Ubiquitin-like domain superfamily (homologous_superfamily) [16-124]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0051179 (localization), GO:0050896 (response to stimulus), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0009605 (response to external stimulus), GO:0048856 (anatomical structure development), GO:0044237 (cellular metabolic process), GO:0009607 (response to biotic stimulus), GO:0006807 (nitrogen compound metabolic process), GO:0051234 (establishment of localization), GO:0099120 (socially cooperative development), GO:0071840 (cellular component organization or biogenesis), GO:0061919 (process utilizing autophagic mechanism), GO:0071704 (organic substance metabolic process), GO:0009056 (catabolic process), GO:0051707 (response to other organism), GO:0044238 (primary metabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:0006914 (autophagy), GO:0043207 (response to external biotic stimulus), GO:0044248 (cellular catabolic process), GO:0009617 (response to bacterium), GO:0006810 (transport), GO:0019538 (protein metabolic process), GO:0016043 (cellular component organization), GO:1901575 (organic substance catabolic process), GO:0044260 (cellular macromolecule metabolic process), GO:0043170 (macromolecule metabolic process), GO:0030587 (sorocarp development), GO:0016236 (macroautophagy), GO:0009057 (macromolecule catabolic process), GO:1901565 (organonitrogen compound catabolic process), GO:0006508 (proteolysis), GO:0044265 (cellular macromolecule catabolic process), GO:0030163 (protein catabolic process), GO:0016192 (vesicle-mediated transport), GO:0043933 (protein-containing complex organization), GO:0022411 (cellular component disassembly), GO:0097352 (autophagosome maturation), GO:0006909 (phagocytosis), GO:0006897 (endocytosis), GO:0032984 (protein-containing complex disassembly), GO:0043632 (modification-dependent macromolecule catabolic process), GO:0010498 (proteasomal protein catabolic process), GO:0051603 (proteolysis involved in protein catabolic process), GO:0006907 (pinocytosis), GO:0019941 (modification-dependent protein catabolic process), GO:0043161 (proteasome-mediated ubiquitin-dependent protein catabolic process), GO:0006511 (ubiquitin-dependent protein catabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0032991 (protein-containing complex), GO:1902494 (catalytic complex), GO:0005622 (intracellular anatomical structure), GO:0005737 (cytoplasm), GO:0016020 (membrane), GO:0000407 (phagophore assembly site)
Q5A1Z5
Autophagy-related protein 13
Plays a key role in autophagy. Activates the atg1 kinase in a nutritional condition dependent manner through the TOR pathway, leading to autophagy (By similarity). Also involved in cytoplasm to vacuole transport (Cvt) and more specifically in Cvt vesicle formation (By similarity). Seems to play a role in the switching machinery regulating the conversion between the Cvt pathway and autophagy (By similarity). Finally, plays an important role in biofilm formation and resistance to antifungal compounds such as fluconazole, itraconazole, terbinafine and caspofungin
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
761
Cytoplasm. Preautophagosomal structure
MLSDFKQQQQQKHHSHNPPNSHDDTQTKLQVAKLTQVIQKFFTKAAQIILESRAYPETSTPSLYPTKEESSKINKWFNLYMTNIPDSCKDDLKLWKGVDLTTIPPMIIETYIDLRSLPADQTLVLMDDEKHPWTVAKSRGKKQEVVLERWLIEFEPNTTDATVMVEELPLSYKQAIVLFRSIYGFTRLMPAFKVKKNLQNKLPLGNKILDGNQPISSKGRIGLSKPIINTRTNESHMTQKYFQPVHTSLGTLKISVAYRMDSEFCLHENEELLSSHFHKRDEEETKKKVSSSVSPLSSGTSLKETSTSPRKSQPPIRIQPFKVGSMSTSPPVQSPSISQPGTAPIQNQPSVPSSSLERRVSITSNKSTSNASLAAFLRNARSSTPSANNIPIINANPISGTSVPRSFSSSTGHEDSIFVNPDSASNTPRFASSFGSRASRRYSSTSIRQQTPQSDLMGQTNSVDAALSGIDADDDISDFVRMIDSKSDLRLGGGGGGGNSSVHNMSINESSYHGDALNKFQSLRSQYQQLSDSVSASLILQSRHSSRKSSLNSPAGSFDSHHHQHQQQQQQQQNQQQSQSPHTNTTSSIHSHAHSYSHSRMKDARPRSEDHQQTKFSAARRSSNISPTTAVPSSIGTPSSISSRIPHVTTIISSSDVSSTGGNRTKSAATTAIVSGMATSPSIYDYRSPRYQNVFDDDDEDDNDEEEGDREGNQLHEGRNSTESSQNQSKRIMKHIKKDEEDSEDDEDLLFTMSDMNSRNF
[ "GO:0006914", "GO:0006950", "GO:0006974", "GO:0006995", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009267", "GO:0009987", "GO:0031667", "GO:0031669", "GO:0033554", "GO:0042594", "GO:0042710", "GO:0043562", "GO:0044010", "GO:0050896", "GO:0051703", "GO:0051716", "GO:0061919"...
[ "GO:0006914", "GO:0006950", "GO:0006974", "GO:0006995", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009267", "GO:0009987", "GO:0031667", "GO:0031669", "GO:0033554", "GO:0042594", "GO:0042710", "GO:0043562", "GO:0044010", "GO:0050896", "GO:0051703", "GO:0051716", "GO:0061919"...
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005773", "GO:0005776", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-Q5A1Z5-F1-model_v6.pdb
237561.Q5A1Z5
[ "Q59V90", "Q5ANC9", "Q5ABQ7", "Q59X11", "P0C075", "Q5A4N0", "Q5A649", "Q5A2C3", "Q5AD78", "Q5AMN3", "A0A1D8PFB7", "Q5ACZ2", "Q59MN0", "Q59Q11", "Q5AI71", "A0A1D8PJF0", "A0A1D8PHX3", "A0A1D8PLM0", "A0A1D8PJ80" ]
[ "IPR040182", "IPR036570", "IPR018731" ]
{"IPR036570": [31, 267], "IPR040182": [27, 758], "IPR018731": [38, 264]}
- Serine/threonine-protein kinase ATG1 - Autophagy-related protein 17 - Autophagy-related protein 101 - Autophagy-related protein 11 - Autophagy-related protein 9 - Putative lipase ATG15 - Serine/threonine-protein kinase TOR - Ubiquitin-binding TORC1 subunit - Vacuolar protein 8 - Target of rapamycin complex subunit LST8
- IPR040182: Autophagy-related protein 13 (family) [27-758] - IPR036570: HORMA domain superfamily (homologous_superfamily) [31-267] - IPR018731: Autophagy-related protein 13, N-terminal (domain) [38-264]
Molecular Function (MF): GO:0003674 (molecular function), GO:0098772 (molecular function regulator activity), GO:0030234 (enzyme regulator activity), GO:0140677 (molecular function activator activity), GO:0019207 (kinase regulator activity), GO:0008047 (enzyme activator activity), GO:0019209 (kinase activator activity), GO:0019887 (protein kinase regulator activity), GO:0030295 (protein kinase activator activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0051179 (localization), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0040007 (growth), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0009987 (cellular process), GO:0009605 (response to external stimulus), GO:0051641 (cellular localization), GO:0042221 (response to chemical), GO:0048584 (positive regulation of response to stimulus), GO:0019222 (regulation of metabolic process), GO:0071840 (cellular component organization or biogenesis), GO:0009056 (catabolic process), GO:0033036 (macromolecule localization), GO:0044237 (cellular metabolic process), GO:0009607 (response to biotic stimulus), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0009893 (positive regulation of metabolic process), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0065009 (regulation of molecular function), GO:0006950 (response to stress), GO:0061919 (process utilizing autophagic mechanism), GO:0051707 (response to other organism), GO:0048522 (positive regulation of cellular process), GO:0050790 (regulation of catalytic activity), GO:0044093 (positive regulation of molecular function), GO:0044085 (cellular component biogenesis), GO:0043207 (response to external biotic stimulus), GO:0044248 (cellular catabolic process), GO:0010570 (regulation of filamentous growth), GO:0009966 (regulation of signal transduction), GO:0032101 (regulation of response to external stimulus), GO:0045184 (establishment of protein localization), GO:0006914 (autophagy), GO:0009894 (regulation of catabolic process), GO:0009991 (response to extracellular stimulus), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0042594 (response to starvation), GO:0031325 (positive regulation of cellular metabolic process), GO:0033554 (cellular response to stress), GO:0070727 (cellular macromolecule localization), GO:0031323 (regulation of cellular metabolic process), GO:0016043 (cellular component organization), GO:0031668 (cellular response to extracellular stimulus), GO:0080090 (regulation of primary metabolic process), GO:0071496 (cellular response to external stimulus), GO:0009896 (positive regulation of catabolic process), GO:0071705 (nitrogen compound transport), GO:0010562 (positive regulation of phosphorus metabolic process), GO:0044804 (autophagy of nucleus), GO:0009267 (cellular response to starvation), GO:0072594 (establishment of protein localization to organelle), GO:0010506 (regulation of autophagy), GO:0000422 (autophagy of mitochondrion), GO:0071702 (organic substance transport), GO:0031331 (positive regulation of cellular catabolic process), GO:1900428 (regulation of filamentous growth of a population of unicellular organisms), GO:0044743 (protein transmembrane import into intracellular organelle), GO:0022607 (cellular component assembly), GO:0016236 (macroautophagy), GO:0010508 (positive regulation of autophagy), GO:0031667 (response to nutrient levels), GO:0008104 (protein localization), GO:0043085 (positive regulation of catalytic activity), GO:0031329 (regulation of cellular catabolic process), GO:0006996 (organelle organization), GO:0031669 (cellular response to nutrient levels), GO:0022411 (cellular component disassembly), GO:0051174 (regulation of phosphorus metabolic process), GO:0070925 (organelle assembly), GO:0007005 (mitochondrion organization), GO:0033365 (protein localization to organelle), GO:0072666 (establishment of protein localization to vacuole), GO:0031399 (regulation of protein modification process), GO:0034497 (protein localization to phagophore assembly site), GO:1905037 (autophagosome organization), GO:0016050 (vesicle organization), GO:0045937 (positive regulation of phosphate metabolic process), GO:1903008 (organelle disassembly), GO:0019220 (regulation of phosphate metabolic process), GO:0043549 (regulation of kinase activity), GO:0006605 (protein targeting), GO:0007033 (vacuole organization), GO:0034727 (piecemeal microautophagy of the nucleus), GO:0006623 (protein targeting to vacuole), GO:0016239 (positive regulation of macroautophagy), GO:0042325 (regulation of phosphorylation), GO:0001932 (regulation of protein phosphorylation), GO:0033674 (positive regulation of kinase activity), GO:0061726 (mitochondrion disassembly), GO:0045859 (regulation of protein kinase activity), GO:0000045 (autophagosome assembly), GO:0042327 (positive regulation of phosphorylation), GO:0072665 (protein localization to vacuole), GO:0045860 (positive regulation of protein kinase activity), GO:0032147 (activation of protein kinase activity) Cellular Component (CC): GO:0005575 (cellular component), GO:0032991 (protein-containing complex), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0016020 (membrane), GO:1902494 (catalytic complex), GO:0019898 (extrinsic component of membrane), GO:0005737 (cytoplasm), GO:0098796 (membrane protein complex), GO:0000407 (phagophore assembly site), GO:0031090 (organelle membrane), GO:0005773 (vacuole), GO:1990234 (transferase complex), GO:0043229 (intracellular organelle), GO:1990316 (Atg1/ULK1 kinase complex), GO:0043227 (membrane-bounded organelle), GO:0035032 (phosphatidylinositol 3-kinase complex, class III), GO:0043231 (intracellular membrane-bounded organelle), GO:0005774 (vacuolar membrane), GO:0098588 (bounding membrane of organelle), GO:0061695 (transferase complex, transferring phosphorus-containing groups), GO:1902911 (protein kinase complex), GO:1902554 (serine/threonine protein kinase complex)
Q5A950
Sterol 3-beta-glucosyltransferase
Sterol glycosyltransferase responsible for the glycosylation of ergosterol to form ergosterol-glucoside
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,512
Cytoplasm. Membrane; Peripheral membrane protein
MSFYKKVTRGLATPLQGSINLFSGSPNVSGDEGTDADNENPEHRTTYHSLSGRVNHDDDDEDVAKLEDIVGFFTGLLNTTTVCAGLGSLNNLKKHYLDEFIKKSALNPLRPQNYGPETSSKLNNNSIEELLNNGDTSLEKVRKMSLYDFDEHTSDSEEEDSADKEEESIAENLKPGKSGKARNHPRDSRTTATLITTQITRTKTATTATPTPTPTSSVDTDVTDVTEPIGKVTTKIPEEQLQGLNPLQKSVVKNLDPHHVREGVLIKVKNSETPLKNDRQELLEKIQLRLKIADKLQRVFDLSDEDTFCGNYSAWLIKDVLLQGHVYLTKDALLYFAFLPKRFSLENSSEVLDEDNSSSIVYSGNLGLKSAKYGEVVLNTVLQHRYWAVLRAETLSIYSSSTNLYFPVLVIDIKKCLYTEIIDKEKLNREAISPVNRGTYSPNGGLSGTATPRASTLENTASELNSMLSGDSYSPTEDNVETTASTVWFKLVTKKKTYKFSCDSSFSARQWCNNITKLIFQHNNANSNGEVLIKIPISKIAEYNKRALFSEEEEEDRTLDVTMNDIPLNVTIKYLGDNDNERKRDKLKRKYKGEEPTIEEVHFLFPKSGVEFFETFDKLVNPVVSDNDNQSSKSSITSTNFSEKAISTLSKSPNHLVQTVLDFNKPVDDDISAFKKFGTTITSPTRIFKATITSPEMTSIDETSLRDSFDSDRLHLPRDMSERALKNLEVSFVTSLKKLEDASKRYEKPHMEHSQTNLASILSDPSEVKKESKTAISKSIKALYSVGTHWSATPNHYFELGKYYVNKVQDRDSSQRNFQSHFSTNSKLLASYYGHLLRTVPVYGKIYVSETDVCFRSLLPGVSTKMVLPMTDIEEVRASRGSRLTYHGLRLIVRGSEELDLEFGSSKSRDDFQKVVLSVLERLHSKEGFRPEPYQWGSNFEVELYKTRMEYSDSENREIQQYDNSIDIKFAEKKIEMARVRMFEDRLMAASGLDVPIILEDSPFFKTELRPSTSYNITLLTIGSRGDVQPYIALGKGLVKEGHNVTIATHAEFGDWIKTFGLGFKEIAGDPAELMSFMVTHNSMSVGFLKNAQQKFRSWISKLLTTSWEACQGSDILIESPSAMSGIHIAEALGIPYFRAFTMPWTRTRAYPHAFFVPEQKKGGSYNYLTHVLFENIFWKGISGQVNKWRVEELDLPKTNLYRLQQTRVPFLYNVSPAILPPSVDFPDWIKVTGYWFLDEGSGDYKPPEELVQFMKKASRDKKKIVYIGFGSIVVKDAKSLTKAVVSAVRRADVRCILNKGWSDRLDNKDKNEIEIELPPEIYNSGTIPHDWLFPRIDAAVHHGGSGTTGATMRAGIPTIIKPFFGDQFFYATRIEDLGAGIALKKLTAKTLGDALVKATHDLKIIDKAKRVSQQIKHEHGVLSAIESIYSELEYSRNLILIKDIHNQNYKRHHPVPSGVQTPAYDTDSDDYDDDEDDDESDKDDEEEEEENSYDGYDGNGVNNSPSQNSSN
[ "GO:0003674", "GO:0003824", "GO:0008194", "GO:0016740", "GO:0016757", "GO:0016758", "GO:0016906", "GO:0035251", "GO:0046527" ]
[]
[ "GO:0003674", "GO:0003824", "GO:0008194", "GO:0016740", "GO:0016757", "GO:0016758", "GO:0016906", "GO:0035251", "GO:0046527" ]
[]
AF-Q5A950-F1-model_v6.pdb
237561.Q5A950
[ "Q5AMN3", "Q5ADK6" ]
[ "IPR004182", "IPR004276", "IPR011993", "IPR001849", "IPR050426", "IPR002213", "IPR048065", "IPR010610" ]
{"IPR011993": [351, 922], "IPR050426": [821, 1462], "IPR002213": [1015, 1429], "IPR004182": [294, 924], "IPR001849": [359, 522], "IPR048065": [825, 917], "IPR004276": [1017, 1152], "IPR010610": [1308, 1414]}
- Sorting nexin-4 - Autophagy-related protein 11
- IPR004182: GRAM domain (domain) [294-924] - IPR004276: Glycosyltransferase family 28, N-terminal domain (domain) [1017-1152] - IPR011993: PH-like domain superfamily (homologous_superfamily) [351-922] - IPR001849: Pleckstrin homology domain (domain) [359-522] - IPR050426: Glycosyltransferase 28 (family) [821-1462] - IPR002213: UDP-glucuronosyl/UDP-glucosyltransferase (family) [1015-1429] - IPR048065: Autophagy-related protein 26, PH-GRAM domain 2 (domain) [825-917] - IPR010610: Erythromycin biosynthesis protein CIII-like, C-terminal domain (domain) [1308-1414]
Molecular Function (MF): GO:0003674 (molecular function), GO:0060090 (molecular adaptor activity), GO:0030674 (protein-macromolecule adaptor activity), GO:0043495 (protein-membrane adaptor activity) Biological Process (BP): GO:0008150 (biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0050896 (response to stimulus), GO:0009605 (response to external stimulus), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0006950 (response to stress), GO:0009607 (response to biotic stimulus), GO:0007154 (cell communication), GO:0009991 (response to extracellular stimulus), GO:0031668 (cellular response to extracellular stimulus), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0036180 (filamentous growth of a population of unicellular organisms in response to biotic stimulus), GO:0042594 (response to starvation), GO:0071496 (cellular response to external stimulus), GO:0033554 (cellular response to stress), GO:0036170 (filamentous growth of a population of unicellular organisms in response to starvation), GO:0009267 (cellular response to starvation), GO:0031669 (cellular response to nutrient levels), GO:0031667 (response to nutrient levels) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q59LR2
Serine/threonine-protein kinase MEC1
Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]- Q. Recruited to DNA lesions in order to initiate the DNA repair by homologous recombination. Phosphorylates histone H2A to form H2AS128ph (gamma-H2A) at sites of DNA damage, also involved in the regulation of DNA damage response mechanism. Required for cell growth and meiotic recombination (By similarity)
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
2,325
Nucleus. Note=Localizes to nuclear DNA repair foci in response to DNA double strand breaks
MTSNQSISTTELLQFLTDIETNIDDHETDFRKLLLYLLRFTNEKLIVIAQEENKTPTELQLLSKLIDTIELVLSKKTPLLSTLLTIEDVNIIHTTGSGSLVYEVPLHEWCISFALSHIPNFVSHTAGLNQLKRLVFLIVNLVSTQLHSFKVIKSTRIHLLKTLDDNLNFCLQNLLSANTFLFKSKLTTAVNLFSIVHDYDISQKLSLNLNNYQLKFESCSRKIWFILNEISLVSELDNLNLLDCLKSVFILDQSSALVLNVSVGWNQIGFLLSCIVEYLQQDFRTLDSNTNNFEFVNLNRSISLSLLNVYIVCFDKDLLENFMSFSNIKGILSKLIYDDSIPSVIRKTLNIVQYTYQLMSNPDGDDIKLYSTSVYNDYVWTPFVDSELESLRARLLDLQGNHEDSRKEELLSFSIDETHKLAKSTNSLNYTDEKAWIRTVKKLIGIDKNVLEDETTLYTLVTALSHYPCILKGDYDYTINECTKCGFGPLTKNNYSSIDPNRFPLNYSTEATTLQDIIQQFLIPKLETQQDPLLCCNTLLLIFNFYASFSPMADMQDHNILDFLLRLLATNDNRDVRMLVARILPLYLIQSKDDKLLDETFKYIFQKVTSIDFSSQHRLHFGESTIRAVVELATVSTGERLCAIYFKLVDWLGEQNEQHSNYVYCGILNLASAKSLPPHKLLSPYLPSVAEIIIKKPQVFERIIKVSMVTKNYFLNRTKEYTVPRILEYYKDPTLLTQIANAAGLEVGKLLANCLPRILATYLTKESVNERYIMKVLSSVCPDYKMIHTEELFTRIGDITWYILLEIQMDEFGNIRNLANITRALECVCKNVSLRKNGSELTKNNSINDLIEDQVLLLVQKFSDVTHSSRGAKPYLELKNSFYAIEFLIKGHIDAITSALGQLSTCLQATLEEPNFHVLSLRCWNELIKKVPPSHLISLIDIIISIILQKFESFGSEAKSIAIEILRKIYEEIKDKYNRYSLYFLSLPFLSYMEDYQMVKEFRNMKSPSRAMIFSEFTRRLQTSNMYVVKHALFDLSNYFEKYQINCQKDLFKDPGLTPAITSLVRTILDTAAKFKNKDTTVSTACAKALAIIGALDSNKFQFKTVKSLIIISSDFEDIEENSTFLVDLIENHLLKIFWASNDPHKQLFAAYVMQSFLAVMGLDERVLNTKDNRVWNKFTDVAKSTLTPFLKSKYAAPKPKLDNLKFPFFKLGMKYETWLVDVTLFLLKRASIDNGKGNQKAKTRKLIFQSYAVLIQREHDIPLCEHLLRYVALSHVINEGVPEDLHKEFLHILKMDSKSTSPDRAEQLKLCYQTIFSVLDYFNQWVSNMRVVTSNSGSELTSSDIRHKMDAVAKFSSFPQDLLTTRSAECDAYERTIMYLENCYRDSQSEKSFKLSNLNGAATLQDMYAHIDDYDALNGTLKMFSTNNLNEKLTTFQYSDSWSLAHESFEALGSTKNSVSNNTKLLQSLNEHGLYNEVLSTLSARTDSNDLKSIPLDWSLMGLHAAVYKGDSKQLEKWLQVINSIGKPHDMETMINYELAKALSFLFQSRIDMFKGSMDKLYNIIGCSLVPSVSSNFTRNITLMNQLHAIYDVSLIVLSKDSEDTLDLRIGNVDQDFDTQRNILTLHNVANTVMKNPAMISKNLLRESSLARKYNRLDISTRSIVQAMSLEDDQANIEFAELQWAQGKQSEAIKCLFDILKDNKFHDDKSKAKVQLQYANWLDESNHLSAHQIITEYNKAFHLNMVDEKCNFDIGKYYNKLMESSNDESGEYEHLTVRNYIRAVSVGTTYIFEALPKVLTIWLDFADKSNKSNAAENRLKQIIDDLYNAIANVPNYSWYTVLTQILSRIVHEHEPSFKVLKRIVQNVTLEYPKHCVWYIFSHARSSDKVRKRRVRELLNQVCTQDGNDTLPKSTMAAGNLFAKLIKIAELKIPKTNRKRQMSLLQDFEVDLSEPIDDLVIPIQSNLQIQIPSHLNSKHKGFSRSSSISFDGFDDNVNIFFSLQMPRQLTVRGSDGNAYRLMVKSDDTRKDAKVVEFTTMVNRILSTSTEARKRGLQIANYSVVPLSDHFGIIEFVMNVQTMKGVISEQRKRQGIPINERKVFMHIDSLQKAKKKDSKQLDKLVAGFRAIMDRCPPVLHTWFVEQFSDPSAWYMARNAFTRSSAVMSMVGYIMGLGDRHCENILIFKNTGAVLHIDFDCLFEKGTTLPTPEIVPFRLTQNMVDAMGITGVDGIYRITCEVTGTLLRENEQILMNILETLIYDPLIDWRNHNPREDLSKVRKKIRGLINEDEGLPMNIHGQVDVLIQEATSLERLSQMYAGWAAYM
[ "GO:0000045", "GO:0006914", "GO:0006950", "GO:0006974", "GO:0006996", "GO:0007033", "GO:0007154", "GO:0007165", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009894", "GO:0009987", "GO:0010506", "GO:0016043", "GO:0016236", "GO:0019222", "GO:0022607", "GO:0023052", "GO:0030447"...
[ "GO:0000045", "GO:0006914", "GO:0006950", "GO:0006974", "GO:0006996", "GO:0007033", "GO:0007154", "GO:0007165", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009894", "GO:0009987", "GO:0010506", "GO:0016043", "GO:0016236", "GO:0019222", "GO:0022607", "GO:0023052", "GO:0030447"...
[]
[]
AF-Q59LR2-F1-model_v6.pdb
237561.Q59LR2
[ "Q59NG5", "A0A1D8PDY7", "A0A1D8PFE6", "A0A1D8PS48", "Q59Z33", "A0A1D8PHD2", "A0A1D8PJD1", "Q59NG2", "A0A1D8PQI3", "A0A1D8PF46", "A0A1D8PPB3", "A0A1D8PNH8", "A0A1D8PRA7", "Q5A0A0", "A0A1D8PI62", "A0A1D8PCN8", "A0A1D8PU93", "Q59WC8", "A0A1D8PKX2", "Q5A6K8", "Q5ABE2", "Q5A4N5"...
[ "IPR056802", "IPR050517", "IPR012993", "IPR016024", "IPR003152", "IPR011009", "IPR014009", "IPR057564", "IPR036940", "IPR003151", "IPR000403", "IPR018936", "IPR058681" ]
{"IPR016024": [277, 1102], "IPR011009": [1969, 2321], "IPR036940": [2129, 2322], "IPR050517": [99, 2324], "IPR058681": [24, 731], "IPR012993": [847, 953], "IPR056802": [1204, 1437], "IPR014009": [1363, 1886], "IPR003151": [1605, 1801], "IPR057564": [1822, 1917], "IPR000403": [1993, 2324], "IPR003152": [2293, 2325], "IPR018936": [2162, 2182]}
- Serine/threonine-protein kinase RAD53 - Serine/threonine-protein kinase TEL1 - DNA damage checkpoint protein LCD1 - Checkpoint protein - Chromatin-binding protein - Checkpoint protein RAD24 - non-specific serine/threonine protein kinase - Cyclin-dependent kinase 1 - DNA repair protein rad9 - Serine/threonine protein kinase
- IPR056802: Serine/threonine-protein kinase ATR-like, M-HEAT region (domain) [1204-1437] - IPR050517: DNA Damage Response and Repair Kinase (family) [99-2324] - IPR012993: UME domain (domain) [847-953] - IPR016024: Armadillo-type fold (homologous_superfamily) [277-1102] - IPR003152: FATC domain (domain) [2293-2325] - IPR011009: Protein kinase-like domain superfamily (homologous_superfamily) [1969-2321] - IPR014009: PIK-related kinase, FAT domain (domain) [1363-1886] - IPR057564: Serine/threonine-protein kinase ATR-like, HEAT repeats (domain) [1822-1917] - IPR036940: Phosphatidylinositol 3-/4-kinase, catalytic domain superfamily (homologous_superfamily) [2129-2322] - IPR003151: PIK-related kinase, FAT (domain) [1605-1801] - IPR000403: Phosphatidylinositol 3-/4-kinase, catalytic domain (domain) [1993-2324] - IPR018936: Phosphatidylinositol 3-/4-kinase, conserved site (conserved_site) [2162-2182] - IPR058681: Serine/threonine-protein kinase MEC1, HEAT repeats (domain) [24-731]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0140096 (catalytic activity, acting on a protein), GO:0004672 (protein kinase activity), GO:0016772 (transferase activity, transferring phosphorus-containing groups), GO:0016773 (phosphotransferase activity, alcohol group as acceptor), GO:0035173 (histone kinase activity), GO:0016301 (kinase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0023052 (signaling), GO:0048519 (negative regulation of biological process), GO:0044237 (cellular metabolic process), GO:0042221 (response to chemical), GO:0006807 (nitrogen compound metabolic process), GO:0050794 (regulation of cellular process), GO:0051716 (cellular response to stimulus), GO:0006950 (response to stress), GO:0071704 (organic substance metabolic process), GO:0048523 (negative regulation of cellular process), GO:0007154 (cell communication), GO:0007165 (signal transduction), GO:0044238 (primary metabolic process), GO:0051726 (regulation of cell cycle), GO:1901360 (organic cyclic compound metabolic process), GO:0035556 (intracellular signal transduction), GO:0006139 (nucleobase-containing compound metabolic process), GO:0006979 (response to oxidative stress), GO:0046483 (heterocycle metabolic process), GO:0070887 (cellular response to chemical stimulus), GO:0033554 (cellular response to stress), GO:0045786 (negative regulation of cell cycle), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:0010948 (negative regulation of cell cycle process), GO:0044260 (cellular macromolecule metabolic process), GO:0010564 (regulation of cell cycle process), GO:0043170 (macromolecule metabolic process), GO:0034599 (cellular response to oxidative stress), GO:0000075 (cell cycle checkpoint signaling), GO:0090304 (nucleic acid metabolic process), GO:0006974 (cellular response to DNA damage stimulus), GO:0062197 (cellular response to chemical stress), GO:1901987 (regulation of cell cycle phase transition), GO:0006259 (DNA metabolic process), GO:1901988 (negative regulation of cell cycle phase transition), GO:0031570 (DNA integrity checkpoint signaling), GO:0006281 (DNA repair), GO:0000077 (DNA damage checkpoint signaling), GO:0000076 (DNA replication checkpoint signaling) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0031974 (membrane-enclosed lumen), GO:0043233 (organelle lumen), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043228 (non-membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0070013 (intracellular organelle lumen), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0031981 (nuclear lumen), GO:0005730 (nucleolus), GO:0005694 (chromosome), GO:0005634 (nucleus), GO:0000228 (nuclear chromosome), GO:0000793 (condensed chromosome), GO:0000794 (condensed nuclear chromosome)
Q5W7F4
A disintegrin and metalloproteinase with thrombospondin motifs 1
Involved in larval molting and metamorphosis. May degrade extracellular matrix (ECM) and basement membrane (BM) during the development of organs to allow degeneration and remodeling of tissues
Bombyx mori (Silk moth)
1,007
Secreted, extracellular space, extracellular matrix
MPCCLWAALSLLLAVVGAGAWTPPRQPLLLTPRHRRHAQETHHLRLLGWDLKLKENKAIRSPYYKECQFFTGRVLHEEGSAVTVTECDGQLYGLLQVGGEEFVLQPTRTQEKHVLRRRDVTHSERSAEYNLTGDTVIDLDLDFDEDDDLLPTSHVHPRHSDHSDKEYFHDMHLFRRPASGVKGLWLELAIVADNTMLKFHGRERVKHYILALMNIVSAIFNDPSLGSNITLVINKLFLYEDKDIILKYGNIKKSLEAINKWNYRHLMKLPEGSTGWDATIWLTRSQLGGPSGFAPVGGVCTKTRSAAIDRDEGLTSAFVIAHELAHLLGLTHDGEGNCQSEALRGSVMAPTVLATLHNFAWSSCSKEQFHAKSKKWWCLHERSTDEGVELGGAKELSNYVFTMDEQCRTEFGEGFSVCRSVKVRSACSRLWCAHRAMPHVCRSKRAPPLEGTPCGQNQWCVDRVCEPMPGHSKETKVENKHTPEWGDWEEWSACNADCGYGLRTRTRKCKYRGFVSESACEGAGSQVATCWAGSSCAATRDIRSDLCHRQQSRLIPYLHANESNHCEISCVDYAGGSPTNFGALPDGTPCSYLRPFDVCFQGTCVKGQCNSSDTTCNWCPDGYCNNNTNTYTRLLGNGWTRMTMVPHEARQLSIHIATPIPLHIALRERKRDKPILELSKHSKKFDISSLQDNYLKYDPSVPQNLQIVEMDSNILDLKESFRYEGEAITAGTLLRWNQTDTDIYITSESRLQTDLMIMAIPVNPTLEDAVSVDASVNYSTPTGRTRPLEYRWSIERGPCSASCGGGVRLITAQCHRDQKCPPPRYESCNTHSCEFVWASDDWEECSSTCGSNGVQERQLFCVPSNASMLSRREFIKHSVSPVMCSSSKPPHRQPCNRIPCPVYWREQPWTPCSASCGRGVSRRPLTCPASDELLCGPKPRERRRRCRLRRCPSALRVAVQCPERDHAHYCELFTLEQLHRNCEVPPFRKYCCNACRDADRRQHRRYG
[ "GO:0002164", "GO:0002165", "GO:0002168", "GO:0007275", "GO:0007552", "GO:0008150", "GO:0009791", "GO:0022404", "GO:0032501", "GO:0032502", "GO:0035074", "GO:0035209", "GO:0042303", "GO:0048856" ]
[ "GO:0002164", "GO:0002165", "GO:0002168", "GO:0007275", "GO:0007552", "GO:0008150", "GO:0009791", "GO:0022404", "GO:0032501", "GO:0032502", "GO:0035074", "GO:0035209", "GO:0042303", "GO:0048856" ]
[]
[]
AF-Q5W7F4-F1-model_v6.pdb
null
null
[ "IPR024079", "IPR000884", "IPR041645", "IPR001590", "IPR036383", "IPR006586", "IPR050439" ]
{"IPR024079": [183, 393], "IPR036383": [461, 959], "IPR050439": [208, 964], "IPR001590": [184, 380], "IPR041645": [400, 465], "IPR006586": [402, 468], "IPR000884": [482, 952]}
- IPR024079: Metallopeptidase, catalytic domain superfamily (homologous_superfamily) [183-393] - IPR000884: Thrombospondin type-1 (TSP1) repeat (repeat) [482-952] - IPR041645: ADAMTS, cysteine-rich domain 2 (domain) [400-465] - IPR001590: Peptidase M12B, ADAM/reprolysin (domain) [184-380] - IPR036383: Thrombospondin type-1 repeat superfamily (homologous_superfamily) [461-959] - IPR006586: ADAM, cysteine-rich domain (domain) [402-468] - IPR050439: ADAMTS and ADAMTS-like (family) [208-964]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0048519 (negative regulation of biological process), GO:0050793 (regulation of developmental process), GO:0023056 (positive regulation of signaling), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0048584 (positive regulation of response to stimulus), GO:0006807 (nitrogen compound metabolic process), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0023051 (regulation of signaling), GO:0051241 (negative regulation of multicellular organismal process), GO:0051239 (regulation of multicellular organismal process), GO:0071704 (organic substance metabolic process), GO:0051093 (negative regulation of developmental process), GO:0048523 (negative regulation of cellular process), GO:0048585 (negative regulation of response to stimulus), GO:0044238 (primary metabolic process), GO:0048522 (positive regulation of cellular process), GO:0090287 (regulation of cellular response to growth factor stimulus), GO:0009967 (positive regulation of signal transduction), GO:0009968 (negative regulation of signal transduction), GO:0010648 (negative regulation of cell communication), GO:2000026 (regulation of multicellular organismal development), GO:1901564 (organonitrogen compound metabolic process), GO:0010646 (regulation of cell communication), GO:0019538 (protein metabolic process), GO:0009966 (regulation of signal transduction), GO:0010647 (positive regulation of cell communication), GO:0090288 (negative regulation of cellular response to growth factor stimulus), GO:1901343 (negative regulation of vasculature development), GO:0043170 (macromolecule metabolic process), GO:0006508 (proteolysis), GO:0090101 (negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway), GO:0090100 (positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway), GO:0090092 (regulation of transmembrane receptor protein serine/threonine kinase signaling pathway), GO:0051604 (protein maturation), GO:0030510 (regulation of BMP signaling pathway), GO:1903844 (regulation of cellular response to transforming growth factor beta stimulus), GO:0010467 (gene expression), GO:0032925 (regulation of activin receptor signaling pathway), GO:0008610 (lipid biosynthetic process), GO:1902547 (regulation of cellular response to vascular endothelial growth factor stimulus), GO:1900746 (regulation of vascular endothelial growth factor signaling pathway), GO:0016525 (negative regulation of angiogenesis), GO:0016485 (protein processing) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005576 (extracellular region)
Q5W7F3
A disintegrin and metalloproteinase with thrombospondin motifs like
Involved in larval molting and metamorphosis. May degrade extracellular matrix (ECM) and basement membrane (BM) during the development of organs to allow degeneration and remodeling of tissues
Bombyx mori (Silk moth)
693
Secreted, extracellular space, extracellular matrix
MESSVATHWLSAFVILCSFITTQSLNNKIHEHMTIDELRNVFHVEHHSRVPEYHLVQLTHHLARRNIPTSHPANSNSADSGKTPHLKTEKVTKGGYKAPSLLNDEMFVEAKKRIEDVDIMGDPNSTVSVDFKVQSSEFGDSESLSDKEHSAESQEDGVHKIDLEAFGRQLKLVLKKQEGLIKKDGLKVWKALKNETQPHGVDYEEMITEDDEEFGDLYQDEENGAALLIRRHPKHGKLVVEGSIGHDLVIRPIPDTMTSPAQDDEMFMDPSSMADMVSIDTGLPIMKRKKEEQDRLQEALNGAQHVIIKRDPAEVDHMSDYAFMEPDHIGKRYRRKRSAEAHNRQKREAPYVIYPEILVIVDYDGYRLHGGDNVQIKRYFVSFWNGVDLRYKLLKGPRIRISIAGIIISRGRDATPYLERNRVGRDAIDSAAALTDMGKYLFRERRLPVYDIAVAITKLDMCRRQYANDACNRGTAGFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLGGPGAEKCRWEDGFIMSDLRHTEKGFRWSPCSVQSFHHFLNGDTATCLYNSPHEDDSLPRVLPGRLLTLDAQCRKDRGTSACFKDERVCAQLFCFDAGSGYCVAYRPAAEGSPCGDGQYCINGQCITEHENIIPDYSQHTPSYVRPETSPFYANITSSRH
[ "GO:0002164", "GO:0002165", "GO:0002168", "GO:0007275", "GO:0007552", "GO:0008150", "GO:0009791", "GO:0022404", "GO:0032501", "GO:0032502", "GO:0035074", "GO:0035209", "GO:0042303", "GO:0048856" ]
[ "GO:0002164", "GO:0002165", "GO:0002168", "GO:0007275", "GO:0007552", "GO:0008150", "GO:0009791", "GO:0022404", "GO:0032501", "GO:0032502", "GO:0035074", "GO:0035209", "GO:0042303", "GO:0048856" ]
[]
[]
AF-Q5W7F3-F1-model_v6.pdb
null
null
[ "IPR024079", "IPR001590", "IPR034030", "IPR041645" ]
{"IPR024079": [352, 585], "IPR001590": [353, 585], "IPR034030": [353, 581], "IPR041645": [596, 659]}
- IPR024079: Metallopeptidase, catalytic domain superfamily (homologous_superfamily) [352-585] - IPR001590: Peptidase M12B, ADAM/reprolysin (domain) [353-585] - IPR034030: Salivary gland reprolysin domain (domain) [353-581] - IPR041645: ADAMTS, cysteine-rich domain 2 (domain) [596-659]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0140096 (catalytic activity, acting on a protein), GO:0016787 (hydrolase activity), GO:0008233 (peptidase activity), GO:0004175 (endopeptidase activity), GO:0008237 (metallopeptidase activity), GO:0004222 (metalloendopeptidase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0032502 (developmental process), GO:0032501 (multicellular organismal process), GO:0023056 (positive regulation of signaling), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0048584 (positive regulation of response to stimulus), GO:0006807 (nitrogen compound metabolic process), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0023051 (regulation of signaling), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0048522 (positive regulation of cellular process), GO:0009967 (positive regulation of signal transduction), GO:1901564 (organonitrogen compound metabolic process), GO:0010646 (regulation of cell communication), GO:0019538 (protein metabolic process), GO:0009966 (regulation of signal transduction), GO:0010647 (positive regulation of cell communication), GO:0043170 (macromolecule metabolic process), GO:0036211 (protein modification process), GO:0043412 (macromolecule modification), GO:0006508 (proteolysis), GO:0030111 (regulation of Wnt signaling pathway), GO:0030177 (positive regulation of Wnt signaling pathway), GO:0070646 (protein modification by small protein removal), GO:0070647 (protein modification by small protein conjugation or removal), GO:0060828 (regulation of canonical Wnt signaling pathway), GO:0090263 (positive regulation of canonical Wnt signaling pathway), GO:0016579 (protein deubiquitination) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005576 (extracellular region), GO:0005615 (extracellular space)
C1P605
Uncharacterized protein AzuC
null
Escherichia coli (strain K12)
28
Cell inner membrane; Peripheral membrane protein
MKLRKILKSMFNNYCKTFKDVPPGNMFR
[ "GO:0003674", "GO:0008047", "GO:0030234", "GO:0098772", "GO:0140677" ]
[]
[ "GO:0003674", "GO:0008047", "GO:0030234", "GO:0098772", "GO:0140677" ]
[]
AF-C1P605-F1-model_v6.pdb
511145.b4663
[ "Q47234", "C1P5Z8" ]
[ "IPR049862" ]
{"IPR049862": [2, 27]}
- Aerobic glycerol-3-phosphate dehydrogenase - Uncharacterized membrane protein YkgR
- IPR049862: Stress response protein AzuC (family) [2-27]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0050896 (response to stimulus), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0051716 (cellular response to stimulus), GO:0009628 (response to abiotic stimulus), GO:0006950 (response to stress), GO:0042221 (response to chemical), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:1901700 (response to oxygen-containing compound), GO:0009268 (response to pH), GO:0010035 (response to inorganic substance), GO:0098630 (aggregation of unicellular organisms), GO:0090609 (single-species submerged biofilm formation), GO:0104004 (cellular response to environmental stimulus), GO:0006979 (response to oxidative stress), GO:0010033 (response to organic substance), GO:0070887 (cellular response to chemical stimulus), GO:0033554 (cellular response to stress), GO:0071214 (cellular response to abiotic stimulus), GO:0034599 (cellular response to oxidative stress), GO:0042710 (biofilm formation), GO:0010447 (response to acidic pH), GO:0042542 (response to hydrogen peroxide), GO:0044011 (single-species biofilm formation on inanimate substrate), GO:1901701 (cellular response to oxygen-containing compound), GO:0000302 (response to reactive oxygen species), GO:0062197 (cellular response to chemical stress), GO:0071467 (cellular response to pH), GO:0071468 (cellular response to acidic pH), GO:0034614 (cellular response to reactive oxygen species), GO:0070301 (cellular response to hydrogen peroxide), GO:0090605 (submerged biofilm formation) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
Q1RM09
Brain acid soluble protein 1 homolog
null
Danio rerio (Zebrafish) (Brachydanio rerio)
197
Cell membrane; Lipid-anchor
MGGKLSKKKKGYNVNDEKAKEKDAKTEGASAEESEAPKENKEDAAAATETTNDTAAAAKEATPTADSNSTAPKEEEKSAAPPKKEEPAANANANAPKASDAKTSEAAKAEPAKSPDAPPVKAEEKSAPSAAPANEKEPAKEAAKDPAPAVAAASESKPDAESKKTEAPPTKESAPAEPITTETSPAPNKEQAVAVQD
[ "GO:0008150", "GO:0022603", "GO:0045765", "GO:0045766", "GO:0048518", "GO:0050789", "GO:0050793", "GO:0051094", "GO:0051239", "GO:0051240", "GO:0065007", "GO:1901342", "GO:1904018", "GO:2000026" ]
[ "GO:0008150", "GO:0022603", "GO:0045765", "GO:0045766", "GO:0048518", "GO:0050789", "GO:0050793", "GO:0051094", "GO:0051239", "GO:0051240", "GO:0065007", "GO:1901342", "GO:1904018", "GO:2000026" ]
[]
[]
AF-Q1RM09-F1-model_v6.pdb
7955.ENSDARP00000069875
[ "Q6DG93", "A0A140LG11" ]
[ "IPR008408" ]
{"IPR008408": [1, 197]}
- Calphotin
- IPR008408: Brain acid soluble protein 1 (family) [1-197]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0032502 (developmental process), GO:0032501 (multicellular organismal process), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0003407 (neural retina development), GO:0060041 (retina development in camera-type eye), GO:0048731 (system development), GO:0048513 (animal organ development), GO:0048880 (sensory system development), GO:0007423 (sensory organ development), GO:0001654 (eye development), GO:0150063 (visual system development), GO:0043010 (camera-type eye development) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0000785 (chromatin), GO:0043229 (intracellular organelle), GO:0043228 (non-membrane-bounded organelle), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0005694 (chromosome)
Q59U10
Biofilm and cell wall regulator 1
Transcription factor which acts as a master regulator of biofilm formation. Biofilms play an important role in pathogenesis and produce many infections such as oropharyngeal candidiasis or vulvovaginal candidiasis. Controls the expression of genes that govern cell-surface properties such as ALS1, ALS3, HWP1 and HYR1. Down-stream component of the hyphal regulatory network that couples expression of cell-surface genes to hyphal differentiation
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
740
Nucleus
MSGTSQVLQNDSHQSQHASMAYNQRQPMMYPPPPQQQPLHSQNSLPPLPPIPAPSLPPISNNISNGNTNELNNNNQQQQQHGQPPLPPPPINANQQYYAVPPLRAPPPLNTLSSVVNSLPTLTPTLTNATHSTMSSNSSAESSASSSSNSITKPKSKRSSKGRVFQCTGYPGCNMSFTRSEHLARHKRKHTGERPFTCPYCSKNFSRLDNLRQHKQTVHAYETYLTKDNRDSKLLIERSKSKKKLKQQEKKAQQQAQLQAQAQAQAQAQVHMQQHQQNGYNFQPPYPQFHNQYYANNQYQGPQPPPPPAPQQQVPGQQQPQPQQGMPAGYLDPYRQYPPNTTFDPMALPPPPKINAHPQKPLPPLPHQMGGGQEQPSDNVSQQGLKIPDHAFTPKRRPEPLALQHSTHSNENISNEGNINANTNTNMNTVTSSITSDAVYPPPPRSATSAASLTPNLASPLSPLFHQSFSQTTLKSTPDPRGSTITNSSISIKSPMSQHFSILSGNSNYSNNTTNSLPSVSNLPHPNWGSTNGTTGSNGTSGGSYQQNSFHQRQSSVVSDFSIFSNSDNRKDIKSNWLKGVLNDDNNNNNNNNNEQQQQQLQDPKLASPAPTLPPVSSITGGGTSNGNDSMMVDNMENKNDVSQSNVIIDSNNNNGDKMVNKLNFQSIELHDNNNNNTPSIKSTHSTETIQTTMVVVNKSDPPPLSTPTTNTNTNTNSTATTNATGYVSKKPTINNLISQ
[ "GO:0002831", "GO:0002833", "GO:0006355", "GO:0006357", "GO:0007155", "GO:0008150", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010570", "GO:0010604", "GO:0010810", "GO:0010811", "GO:0019219", "GO:0019222", "GO:0030155"...
[ "GO:0002831", "GO:0002833", "GO:0006355", "GO:0006357", "GO:0007155", "GO:0008150", "GO:0009889", "GO:0009891", "GO:0009893", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010557", "GO:0010570", "GO:0010604", "GO:0010810", "GO:0010811", "GO:0019219", "GO:0019222", "GO:0030155"...
[ "GO:0001216", "GO:0003674", "GO:0003676", "GO:0003677", "GO:0003700", "GO:0005488", "GO:0043565", "GO:0140110" ]
[ "GO:0000785", "GO:0005575", "GO:0005622", "GO:0005694", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0110165" ]
AF-Q59U10-F1-model_v6.pdb
237561.Q59U10
[ "Q59TL7", "Q59LY1", "Q5AB65", "Q59WZ4", "A0A1D8PFP2", "Q59S18", "Q874L3", "Q59XB5", "Q7Z883", "Q5ANJ4", "Q59RR0", "Q59ME1", "Q5A8T4", "Q5ACU9" ]
[ "IPR013087", "IPR051059", "IPR036236" ]
{"IPR036236": [170, 216], "IPR051059": [141, 524], "IPR013087": [165, 224]}
- Transcription activator TEC1 - Enhanced filamentous growth protein 1 - Biofilm regulator 1 - Agglutinin-like protein 3 - Agglutinin-like protein 1 - Hyphal wall protein 1 - Transcription factor ROB1 - Transcription factor NDT80 - Transcriptional repressor TUP1 - Transcriptional repressor TUP1
- IPR013087: Zinc finger C2H2-type (domain) [165-224] - IPR051059: Transcription factor verF-like (family) [141-524] - IPR036236: Zinc finger C2H2 superfamily (homologous_superfamily) [170-216]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003700 (DNA-binding transcription factor activity), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding), GO:0003690 (double-stranded DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0009628 (response to abiotic stimulus), GO:0042221 (response to chemical), GO:0019222 (regulation of metabolic process), GO:0044010 (single-species biofilm formation), GO:0050794 (regulation of cellular process), GO:0098743 (cell aggregation), GO:0051716 (cellular response to stimulus), GO:0006950 (response to stress), GO:0048522 (positive regulation of cellular process), GO:1900190 (regulation of single-species biofilm formation), GO:0009266 (response to temperature stimulus), GO:0098630 (aggregation of unicellular organisms), GO:0010035 (response to inorganic substance), GO:0104004 (cellular response to environmental stimulus), GO:0070887 (cellular response to chemical stimulus), GO:0033554 (cellular response to stress), GO:0071214 (cellular response to abiotic stimulus), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0030155 (regulation of cell adhesion), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0009268 (response to pH), GO:0045785 (positive regulation of cell adhesion), GO:0090609 (single-species submerged biofilm formation), GO:0080090 (regulation of primary metabolic process), GO:0009409 (response to cold), GO:0010038 (response to metal ion), GO:0070417 (cellular response to cold), GO:0010811 (positive regulation of cell-substrate adhesion), GO:1900231 (regulation of single-species biofilm formation on inanimate substrate), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0071241 (cellular response to inorganic substance), GO:0010810 (regulation of cell-substrate adhesion), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0042710 (biofilm formation), GO:0010447 (response to acidic pH), GO:0051252 (regulation of RNA metabolic process), GO:0044011 (single-species biofilm formation on inanimate substrate), GO:0010468 (regulation of gene expression), GO:0071467 (cellular response to pH), GO:0071248 (cellular response to metal ion), GO:1900187 (regulation of cell adhesion involved in single-species biofilm formation), GO:0090605 (submerged biofilm formation), GO:0046688 (response to copper ion), GO:0071468 (cellular response to acidic pH), GO:2001141 (regulation of RNA biosynthetic process), GO:1900189 (positive regulation of cell adhesion involved in single-species biofilm formation), GO:0006355 (regulation of DNA-templated transcription), GO:0006357 (regulation of transcription by RNA polymerase II), GO:0071280 (cellular response to copper ion), GO:1903506 (regulation of nucleic acid-templated transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
P0A6E9
ATP-dependent dethiobiotin synthetase BioD 2
Catalyzes a mechanistically unusual reaction, the ATP- dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8- diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring
Escherichia coli (strain K12)
231
Cytoplasm
MLKRFFITGTDTSVGKTVVSRALLQALASQGKTVAGYKPVAKGSKETPEGLRNKDALVLQSVSTIELPYEAVNPIALSEEESSVAHSCPINYTLISNGLANLTEKVDHVVVEGTGGWRSLMNDLRPLSEWVVQEQLPVLMVVGIQEGCINHALLTAQAIANDGLPLIGWVANRINPGLAHYAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIRLAMLRSVLAVDRVTV
[ "GO:0006082", "GO:0006766", "GO:0006768", "GO:0006790", "GO:0008150", "GO:0008152", "GO:0009058", "GO:0009102", "GO:0009110", "GO:0009987", "GO:0016053", "GO:0019752", "GO:0032787", "GO:0042364", "GO:0043436", "GO:0043603", "GO:0043604", "GO:0044272", "GO:0044281", "GO:0044283"...
[ "GO:0006082", "GO:0006766", "GO:0006768", "GO:0006790", "GO:0008150", "GO:0008152", "GO:0009058", "GO:0009102", "GO:0009110", "GO:0009987", "GO:0016053", "GO:0019752", "GO:0032787", "GO:0042364", "GO:0043436", "GO:0043603", "GO:0043604", "GO:0044272", "GO:0044281", "GO:0044283"...
[ "GO:0003674", "GO:0003824", "GO:0004141", "GO:0005488", "GO:0005515", "GO:0016874", "GO:0016879", "GO:0016882", "GO:0042802", "GO:0042803", "GO:0046983" ]
[]
AF-P0A6E9-F1-model_v6.pdb
511145.b1593
[ "Q2M777", "Q2MBJ1", "Q2MBJ5", "Q2MBJ3", "Q2MBJ2", "Q2MBJ4" ]
[ "IPR004472", "IPR027417" ]
{"IPR027417": [1, 220], "IPR004472": [1, 220]}
- Biotin synthase - Adenosylmethionine-8-amino-7-oxononanoate aminotransferase - 8-amino-7-oxononanoate synthase - ATP-dependent dethiobiotin synthetase BioD 1 - Malonyl-[acyl-carrier protein] O-methyltransferase - Pimeloyl-[acyl-carrier protein] methyl ester esterase
- IPR004472: Dethiobiotin synthase BioD (family) [1-220] - IPR027417: P-loop containing nucleoside triphosphate hydrolase (homologous_superfamily) [1-220]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0036094 (small molecule binding), GO:0016874 (ligase activity), GO:1901363 (heterocyclic compound binding), GO:0043167 (ion binding), GO:0097159 (organic cyclic compound binding), GO:0097367 (carbohydrate derivative binding), GO:1901265 (nucleoside phosphate binding), GO:0043168 (anion binding), GO:0000166 (nucleotide binding), GO:0043169 (cation binding), GO:0032553 (ribonucleotide binding), GO:0016879 (ligase activity, forming carbon-nitrogen bonds), GO:0035639 (purine ribonucleoside triphosphate binding), GO:0032555 (purine ribonucleotide binding), GO:0046872 (metal ion binding), GO:0017076 (purine nucleotide binding), GO:0005524 (ATP binding), GO:0000287 (magnesium ion binding), GO:0032559 (adenyl ribonucleotide binding), GO:0030554 (adenyl nucleotide binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0044281 (small molecule metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0071704 (organic substance metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:1901576 (organic substance biosynthetic process), GO:0044283 (small molecule biosynthetic process), GO:0046483 (heterocycle metabolic process), GO:0006082 (organic acid metabolic process), GO:0044249 (cellular biosynthetic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:0043603 (amide metabolic process), GO:0006766 (vitamin metabolic process), GO:0006790 (sulfur compound metabolic process), GO:1901566 (organonitrogen compound biosynthetic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0006767 (water-soluble vitamin metabolic process), GO:0009110 (vitamin biosynthetic process), GO:0044272 (sulfur compound biosynthetic process), GO:0016053 (organic acid biosynthetic process), GO:0043436 (oxoacid metabolic process), GO:0018130 (heterocycle biosynthetic process), GO:0043604 (amide biosynthetic process), GO:0044271 (cellular nitrogen compound biosynthetic process), GO:0006768 (biotin metabolic process), GO:0019752 (carboxylic acid metabolic process), GO:0042364 (water-soluble vitamin biosynthetic process), GO:0046394 (carboxylic acid biosynthetic process), GO:0009102 (biotin biosynthetic process), GO:0072330 (monocarboxylic acid biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure)
Q9LFL7
Inactive serine/threonine-protein kinase BKN1
Collaboratively with BKN2/SZE2, involved in compatible pollen-stigma interactions
Arabidopsis thaliana (Mouse-ear cress)
331
Cell membrane; Lipid-anchor; Cytoplasmic side. Nucleus. Note=Partial observation into the nucleus
MGNCLKHFKQQLPSIAPKPLIIPPIFSARKRESESLQIRGLKKATKKFRQDRVVECEDYSVRKFYKGYIDETTFAPSRAGTGIAVSVMECDSSRSLQDWMAVVRSLGQLSHQNLVNFLGYCCEDNKPFFLVFEYSHKGSLDSHIFGKEEEALPWEIRVKIAIGTAQGLAFLHSIKNSPLNRELRMHNIMLDEQYNAKLFYLEPTKRSLVDEGLKRGRFTYLSPEWGSLGILDMTTDVYIFGMILLELLMGSKDRKKIKEEQGLVDYWTSSFLPDNYKIEEIIDPRLGSDYSANAATQMGTLINRCTAHNTKKRPLMQQVLDGLNHIAEIKD
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005886", "GO:0016020", "GO:0071944", "GO:0110165" ]
AF-Q9LFL7-F1-model_v6.pdb
3702.Q9LFL7
[ "Q1G378", "Q9LHM1", "F4JLP8" ]
[ "IPR001245", "IPR000719", "IPR011009", "IPR050823" ]
{"IPR011009": [77, 324], "IPR050823": [35, 326], "IPR000719": [58, 328], "IPR001245": [66, 321]}
- Leucine-rich repeat (LRR) family protein - RNA-binding (RRM/RBD/RNP motifs) family protein - non-specific serine/threonine protein kinase
- IPR001245: Serine-threonine/tyrosine-protein kinase, catalytic domain (domain) [66-321] - IPR000719: Protein kinase domain (domain) [58-328] - IPR011009: Protein kinase-like domain superfamily (homologous_superfamily) [77-324] - IPR050823: Plant Serine/Threonine-Protein Kinase (family) [35-326]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0000003 (reproduction), GO:0032501 (multicellular organismal process), GO:0022414 (reproductive process), GO:0009875 (pollen-pistil interaction), GO:0009856 (pollination), GO:0044706 (multi-multicellular organism process), GO:0007154 (cell communication) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0009536 (plastid), GO:0043231 (intracellular membrane-bounded organelle)
P22004
Bone morphogenetic protein 6
Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes including cartilage and bone formation. Also plays an important role in the regulation of HAMP/hepcidin expression and iron metabolism by acting as a ligand for hemojuvelin/HJV. Also acts to promote expression of HAMP, potentially via the interaction with its receptor BMPR1A/ALK3. Initiates the canonical BMP signaling cascade by associating with type I receptor ACVR1 and type II receptor ACVR2B. In turn, ACVR1 propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target. Can also signal through non-canonical pathway such as TAZ-Hippo signaling cascade to modulate VEGF signaling by regulating VEGFR2 expression
Homo sapiens (Human)
513
Secreted
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
[ "GO:0005575", "GO:0005576", "GO:0005615", "GO:0032991", "GO:0110165", "GO:0150005" ]
[]
[]
[ "GO:0005575", "GO:0005576", "GO:0005615", "GO:0032991", "GO:0110165", "GO:0150005" ]
AF-P22004-F1-model_v6.pdb
9606.ENSP00000283147
[ "Q5TBA1", "Q9BQB4", "Q8NEN8", "Q9UQA1", "Q8IXV8", "Q9H772", "Q8WVJ5", "Q92859", "Q9UCU4", "Q04771", "Q13485", "P21810", "Q8N936", "Q5TCK6", "P12643", "Q13253", "P78366", "Q92474", "Q9BY68", "Q4VAV0", "Q8TF36", "Q9UM80", "Q9UP52", "Q9P0Z5", "Q647K2", "Q96L68", "Q9H...
[ "IPR017948", "IPR001111", "IPR029034", "IPR015615", "IPR001839" ]
{"IPR029034": [400, 513], "IPR015615": [32, 513], "IPR001111": [63, 362], "IPR001839": [394, 513], "IPR017948": [430, 445]}
- Bone morphogenetic protein receptor type-1A - Activin receptor type-1 - Bone morphogenetic protein receptor type-1B - Activin receptor type-2A - Bone morphogenetic protein receptor type-2 - Hemojuvelin - Activin receptor type-2B - Noggin - Chordin - Bone morphogenetic protein 4
- IPR017948: Transforming growth factor beta, conserved site (conserved_site) [430-445] - IPR001111: TGF-beta, propeptide (domain) [63-362] - IPR029034: Cystine-knot cytokine (homologous_superfamily) [400-513] - IPR015615: Transforming growth factor-beta-related (family) [32-513] - IPR001839: Transforming growth factor-beta, C-terminal (domain) [394-513]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding), GO:0005102 (signaling receptor binding), GO:0033612 (receptor serine/threonine kinase binding), GO:0070696 (transmembrane receptor protein serine/threonine kinase binding) Biological Process (BP): GO:0008150 (biological process), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0032501 (multicellular organismal process), GO:0065007 (biological regulation), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0048519 (negative regulation of biological process), GO:0048869 (cellular developmental process), GO:0048856 (anatomical structure development), GO:0023056 (positive regulation of signaling), GO:0007275 (multicellular organism development), GO:0009892 (negative regulation of metabolic process), GO:0050793 (regulation of developmental process), GO:0065008 (regulation of biological quality), GO:0050794 (regulation of cellular process), GO:0023051 (regulation of signaling), GO:0051094 (positive regulation of developmental process), GO:0048523 (negative regulation of cellular process), GO:0048522 (positive regulation of cellular process), GO:0045597 (positive regulation of cell differentiation), GO:0051172 (negative regulation of nitrogen compound metabolic process), GO:1903530 (regulation of secretion by cell), GO:0051049 (regulation of transport), GO:0060548 (negative regulation of cell death), GO:0030154 (cell differentiation), GO:0048731 (system development), GO:0048513 (animal organ development), GO:0031018 (endocrine pancreas development), GO:0060255 (regulation of macromolecule metabolic process), GO:0010817 (regulation of hormone levels), GO:0031324 (negative regulation of cellular metabolic process), GO:0046883 (regulation of hormone secretion), GO:0045165 (cell fate commitment), GO:0010941 (regulation of cell death), GO:0009888 (tissue development), GO:0010646 (regulation of cell communication), GO:0010605 (negative regulation of macromolecule metabolic process), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0045595 (regulation of cell differentiation), GO:0031323 (regulation of cellular metabolic process), GO:0009890 (negative regulation of biosynthetic process), GO:0010647 (positive regulation of cell communication), GO:0080090 (regulation of primary metabolic process), GO:0035270 (endocrine system development), GO:0045664 (regulation of neuron differentiation), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0043069 (negative regulation of programmed cell death), GO:0043067 (regulation of programmed cell death), GO:0009914 (hormone transport), GO:0010468 (regulation of gene expression), GO:0030855 (epithelial cell differentiation), GO:0003309 (type B pancreatic cell differentiation), GO:0022008 (neurogenesis), GO:0003309 (type B pancreatic cell differentiation), GO:0007399 (nervous system development), GO:0090087 (regulation of peptide transport), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0051046 (regulation of secretion), GO:0010558 (negative regulation of macromolecule biosynthetic process), GO:0031327 (negative regulation of cellular biosynthetic process), GO:0051252 (regulation of RNA metabolic process), GO:0060429 (epithelium development), GO:0051253 (negative regulation of RNA metabolic process), GO:0045934 (negative regulation of nucleobase-containing compound metabolic process), GO:0030182 (neuron differentiation), GO:0031016 (pancreas development), GO:0042981 (regulation of apoptotic process), GO:0002066 (columnar/cuboidal epithelial cell development), GO:0043066 (negative regulation of apoptotic process), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0002065 (columnar/cuboidal epithelial cell differentiation), GO:0002791 (regulation of peptide secretion), GO:0048699 (generation of neurons), GO:1902679 (negative regulation of RNA biosynthetic process), GO:0006357 (regulation of transcription by RNA polymerase II), GO:0045892 (negative regulation of DNA-templated transcription), GO:1903507 (negative regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription), GO:0002067 (glandular epithelial cell differentiation), GO:0035883 (enteroendocrine cell differentiation), GO:0000122 (negative regulation of transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle)
Q14692
Ribosome biogenesis protein BMS1 homolog
GTPase required for the synthesis of 40S ribosomal subunits and for processing of pre-ribosomal RNA (pre-rRNA) at sites A0, A1, and A2. Controls access of pre-rRNA intermediates to RCL1 during ribosome biogenesis by binding RCL1 in a GTP-dependent manner, and delivering it to pre-ribosomes. GTP-binding and/or GTP hydrolysis may induce conformational rearrangements within the BMS1-RCL1 complex allowing the interaction of RCL1 with its RNA substrate. Required for RCL1 import into the nucleus
Homo sapiens (Human)
1,282
Nucleus, nucleolus
MEAKDQKKHRKKNSGPKAAKKKKRLLQDLQLGDEEDARKRNPKAFAVQSAVRMARSFHRTQDLKTKKHHIPVVDRTPLEPPPIVVVVMGPPKVGKSTLIQCLIRNFTRQKLTEIRGPVTIVSGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMETFEFLNICQVHGFPKIMGVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYPGAKLFYLSGMVHGEYQNQEIHNLGRFITVMKFRPLTWQTSHPYILADRMEDLTNPEDIRTNIKCDRKVSLYGYLRGAHLKNKSQIHMPGVGDFAVSDISFLPDPCALPEQQKKRCLNEKEKLVYAPLSGVGGVLYDKDAVYVDLGGSHVFQDEVGPTHELVQSLISTHSTIDAKMASSRVTLFSDSKPLGSEDIDNQGLMMPKEEKQMDLNTGRMRRKAIFGDEDESGDSDDEEDDEMSEDDGLENGSSDEEAEEEENAEMTDQYMAVKGIKRRKLELEEDSEMDLPAFADSDDDLERSSAEEGEAEEADESSEEEDCTAGEKGISGSKAAGEGSKAGLSPANCQSDRVNLEKSLLMKKAALPTFDSGHCTAEEVFASEDESEESSSLSAEEEDSENEEAIRKKLSKPSQVSSGQKLGPQNFIDETSDIENLLKEEEDYKEENNDSKETSGALKWKEDLSRKAAEAFLRQQQAAPNLRKLIYGTVTEDNEEEDDDTLEELGGLFRVNQPDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELYGDFEDLETGDVHKGKSGPNTQNEDIEKEVKEEIDPDEEESAKKKHLDKKRKLKEMFDAEYDEGESTYFDDLKGEMQKQAQLNRAEFEDQDDEARVQYEGFRPGMYVRIEIENVPCEFVQNFDPHYPIILGGLGNSEGNVGYVQMRLKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIEDHNGRQRLLKYTPQHMHCGAAFWGPITPQGTGFLAIQSVSGIMPDFRIAATGVVLDLDKSIKIVKKLKLTGFPYKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEGAFRASFEDKLLMSDIVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTGQLRLAHGVRLKANKDSLYKPILRQKKHFNSLHIPKALQKALPFKNKPKTQAKAGKVPKDRRRPAVIREPHERKILALLDALSTVHSQKMKKAKEQRHLHNKEHFRAKQKEEEEKLKRQKDLRKKLFRIQGQKERRNQKSSLKGAEGQLQ
[ "GO:0008150", "GO:0009987", "GO:0022613", "GO:0042254", "GO:0042274", "GO:0044085", "GO:0071840" ]
[ "GO:0008150", "GO:0009987", "GO:0022613", "GO:0042254", "GO:0042274", "GO:0044085", "GO:0071840" ]
[]
[]
AF-Q14692-F1-model_v6.pdb
9606.ENSP00000363642
[ "Q8N6Z7", "Q9H9F8", "Q9UIX2", "Q9BRZ1", "Q6IRL7", "Q96E99", "Q9Y4C7", "Q8NDL5", "Q9UNQ2", "Q9Y505", "Q9BYG3", "Q9NQT4", "Q96NM6", "Q9NW23", "Q9BWK6", "Q9UPI6", "Q6IQ15", "Q9Y482", "Q9Y221", "Q96BN0", "Q96L80", "Q9NXF1", "Q9NZX3", "Q9NST5", "P62857", "Q9NQ05", "Q96...
[ "IPR012948", "IPR030387", "IPR027417", "IPR039761", "IPR037875", "IPR007034" ]
{"IPR027417": [78, 245], "IPR039761": [591, 1256], "IPR037875": [44, 273], "IPR030387": [80, 245], "IPR012948": [231, 317], "IPR007034": [812, 1105]}
- U3 small nucleolar RNA-associated protein 15 homolog - WD repeat-containing protein 75 - HEAT repeat-containing protein 1 - U3 small nucleolar RNA-associated protein 4 homolog - Nucleolar protein 56 - U3 small nucleolar RNA-associated protein 6 homolog - KRR1 small subunit processome component homolog - WD repeat-containing protein 46 - Bystin - Nucleolar protein 58
- IPR012948: AARP2CN (domain) [231-317] - IPR030387: Bms1/Tsr1-type G domain (domain) [80-245] - IPR027417: P-loop containing nucleoside triphosphate hydrolase (homologous_superfamily) [78-245] - IPR039761: Ribosome biogenesis protein Bms1/Tsr1 (family) [591-1256] - IPR037875: Ribosome biogenesis protein Bms1, N-terminal (domain) [44-273] - IPR007034: Ribosome biogenesis protein BMS1/TSR1, C-terminal (domain) [812-1105]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003723 (RNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0071840 (cellular component organization or biogenesis), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0044085 (cellular component biogenesis), GO:1901576 (organic substance biosynthetic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0046483 (heterocycle metabolic process), GO:0044249 (cellular biosynthetic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0009059 (macromolecule biosynthetic process), GO:1901362 (organic cyclic compound biosynthetic process), GO:0090304 (nucleic acid metabolic process), GO:0019438 (aromatic compound biosynthetic process), GO:0018130 (heterocycle biosynthetic process), GO:0022613 (ribonucleoprotein complex biogenesis), GO:0044271 (cellular nitrogen compound biosynthetic process), GO:0010467 (gene expression), GO:0034654 (nucleobase-containing compound biosynthetic process), GO:0042254 (ribosome biogenesis), GO:0016070 (RNA metabolic process), GO:0032774 (RNA biosynthetic process), GO:0097659 (nucleic acid-templated transcription), GO:0006396 (RNA processing), GO:0034470 (ncRNA processing), GO:0006364 (rRNA processing), GO:0034660 (ncRNA metabolic process), GO:0016072 (rRNA metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0031974 (membrane-enclosed lumen), GO:0005654 (nucleoplasm), GO:0043233 (organelle lumen), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043228 (non-membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0070013 (intracellular organelle lumen), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0031981 (nuclear lumen), GO:0005730 (nucleolus), GO:0005694 (chromosome), GO:0005634 (nucleus)
Q5ABU8
Beta-mannosyltransferase 6
Beta-mannosyltransferase involved in cell wall biosynthesis. Required for beta-1,2-mannose transfer on phospholipomannan. Required for pro-inflammatory response in macrophages through phospholipomannan- induced TNF-alpha production
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
646
Membrane; Single-pass type II membrane protein
MGNYKPSIKQYVVTVKAIKSSQFGRLGICAVVLLFVLGYPFYFISNNPFDTSIRYQYVDPYNDTTRKYTTIEKQHTDIGGNGTTILYPKNLQLDQTALSQLLNTTETTNPFVQYIGNSSSIAFSQLNQTLVNHSIQVFDPFSNSDNCSDLMTETQLTISQNIIIKESFEIMVKRLMHQLDTEPAFKELAPFFQNKLSLHLRMRSYHKHFYKFARTSVWLKDYGVHLMISRVIYSQKGKKGDPQISLLYTQLYDTNWQELTNTDLLVSMQDITGEYKLEKLQFPRFLPMPFYYNPKLTKGRWYGPEDARIMLVKNQLDMEEPVVIYNSYHRQIANHTTTGKTDGSVELNFEFYRSMFVGWPFRYQLGKSNTDGFVDDRFDNVKFTRVAELKIHNQTRASIEKNWTPFVDPSERDPEDKSLYIVYQWDKLRILKCDISNLVTDDGFIHYSACRFKQDTKHDEVEKVGPIRGGTELIPTIINNKQLWVGFLRAHIDKCGCGKAMYRPNMVVLQKTDMGTFQVAYLSSYISFNIPVPGWKTHEIQCGKRDPNVLIPNGISNWEVATIDGIERDVLTMTLSAADEDNILMDIHGLKTVIKNLITNQKHGNEFNSDSVQMKCVVAYSIEFCRAYGEEQARLGLTGGWLPSHN
[ "GO:0006629", "GO:0006643", "GO:0006664", "GO:0006665", "GO:0006687", "GO:0006688", "GO:0008150", "GO:0008152", "GO:0008610", "GO:0009058", "GO:0009247", "GO:0009987", "GO:0030148", "GO:0044238", "GO:0046467", "GO:1901135", "GO:1901137", "GO:1903509" ]
[ "GO:0006629", "GO:0006643", "GO:0006664", "GO:0006665", "GO:0006687", "GO:0006688", "GO:0008150", "GO:0008152", "GO:0008610", "GO:0009058", "GO:0009247", "GO:0009987", "GO:0030148", "GO:0044238", "GO:0046467", "GO:1901135", "GO:1901137", "GO:1903509" ]
[]
[]
AF-Q5ABU8-F1-model_v6.pdb
237561.Q5ABU8
null
[ "IPR021988" ]
{"IPR021988": [146, 624]}
- IPR021988: Beta-mannosyltransferase (family) [146-624]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016757 (glycosyltransferase activity), GO:0016758 (hexosyltransferase activity), GO:0000030 (mannosyltransferase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:1901576 (organic substance biosynthetic process), GO:1901564 (organonitrogen compound metabolic process), GO:0006629 (lipid metabolic process), GO:0044255 (cellular lipid metabolic process), GO:0044249 (cellular biosynthetic process), GO:0005975 (carbohydrate metabolic process), GO:0044260 (cellular macromolecule metabolic process), GO:0043170 (macromolecule metabolic process), GO:1901135 (carbohydrate derivative metabolic process), GO:0044262 (cellular carbohydrate metabolic process), GO:1901566 (organonitrogen compound biosynthetic process), GO:0006643 (membrane lipid metabolic process), GO:0044264 (cellular polysaccharide metabolic process), GO:0005976 (polysaccharide metabolic process), GO:1903509 (liposaccharide metabolic process), GO:1901137 (carbohydrate derivative biosynthetic process), GO:0046467 (membrane lipid biosynthetic process), GO:0008610 (lipid biosynthetic process), GO:0006665 (sphingolipid metabolic process), GO:0006664 (glycolipid metabolic process), GO:0010412 (mannan metabolic process), GO:0030148 (sphingolipid biosynthetic process), GO:0009247 (glycolipid biosynthetic process), GO:0006687 (glycosphingolipid metabolic process), GO:0006688 (glycosphingolipid biosynthetic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0043226 (organelle), GO:0005622 (intracellular anatomical structure), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0031984 (organelle subcompartment), GO:0042175 (nuclear outer membrane-endoplasmic reticulum membrane network), GO:0031090 (organelle membrane), GO:0005783 (endoplasmic reticulum), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0098827 (endoplasmic reticulum subcompartment), GO:0043231 (intracellular membrane-bounded organelle), GO:0005789 (endoplasmic reticulum membrane)
P0C739
Protein BNLF2a
Participates in viral evasion from HLA class I-restricted T- cell immunity. Associates with host TAP1 and TAP2 and prevents TAP- mediated peptide transport and subsequent loading
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
60
Host endoplasmic reticulum membrane; Single-pass membrane protein
MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI
[ "GO:0002376", "GO:0002474", "GO:0002483", "GO:0008150", "GO:0019882", "GO:0019883", "GO:0019885", "GO:0048002", "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005783", "GO:0005789", "GO:0012505", "GO:0016020", "GO:0031090", "GO:0031984", "GO:0042175", "GO:0043226", "GO:0043227"...
[ "GO:0002376", "GO:0002474", "GO:0002483", "GO:0008150", "GO:0019882", "GO:0019883", "GO:0019885", "GO:0048002" ]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005783", "GO:0005789", "GO:0012505", "GO:0016020", "GO:0031090", "GO:0031984", "GO:0042175", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0098827", "GO:0110165" ]
null
null
null
[ "IPR058026" ]
{"IPR058026": [1, 60]}
- IPR058026: BNLF2a (family) [1-60]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0050789 (regulation of biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050792 (regulation of viral process), GO:0048524 (positive regulation of viral process), GO:0046782 (regulation of viral transcription) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0018995 (host cellular component), GO:0033643 (host cell part), GO:0043657 (host cell), GO:0033646 (host intracellular part), GO:0043656 (host intracellular region), GO:0033647 (host intracellular organelle), GO:0030430 (host cell cytoplasm), GO:0033648 (host intracellular membrane-bounded organelle), GO:0042025 (host cell nucleus)
A1ZB64
Bomanin Short 6
Secreted immune-induced peptide induced by Toll signaling. Has a role in resistance to bacterial and fungal infections. The strength of antimicrobial activity appears to correlate with the overall level of expression
Drosophila melanogaster (Fruit fly)
40
Secreted
MKLLSITFLFGLLALASANPLSPGNVIINGDCKVCNIRGD
[ "GO:0008150", "GO:0009636", "GO:0010046", "GO:0042221", "GO:0050896" ]
[ "GO:0008150", "GO:0009636", "GO:0010046", "GO:0042221", "GO:0050896" ]
[]
[]
AF-A1ZB64-F1-model_v6.pdb
7227.FBpp0085906
[ "B7FNR2", "Q9V8F9", "A1ZB61", "Q9W2Q9", "Q9VD49", "Q9V8F6", "A0A0B4K792", "Q8SYA4", "Q9V8G0", "D4G7G1" ]
[ "IPR013172" ]
{"IPR013172": [1, 36]}
- Bomanin Tailed 2 - Bomanin short 4 - Bomanin bicipital 2, isoform A - Bomanin Short 2 - Bomanin tailed 1 - Daisho1 - Bomanin tailed 3, isoform A - Bomanin Short 5 - Bomanin Short 1 - Bomanin Short 3
- IPR013172: Bomanin (family) [1-36]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0030545 (signaling receptor regulator activity), GO:0097367 (carbohydrate derivative binding), GO:0005515 (protein binding), GO:0030546 (signaling receptor activator activity), GO:0008061 (chitin binding) Biological Process (BP): GO:0008150 (biological process), GO:0002376 (immune system process), GO:0050896 (response to stimulus), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0009605 (response to external stimulus), GO:0006950 (response to stress), GO:0051707 (response to other organism), GO:0006955 (immune response), GO:0009607 (response to biotic stimulus), GO:0006952 (defense response), GO:0043207 (response to external biotic stimulus), GO:0009617 (response to bacterium), GO:0006959 (humoral immune response), GO:0098542 (defense response to other organism), GO:0019730 (antimicrobial humoral response), GO:0042742 (defense response to bacterium), GO:0019731 (antibacterial humoral response) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005576 (extracellular region)
Q59LY1
Biofilm regulator 1
Transcription factor required for hyphal growth, biofilm formation, and virulence. Promotes formation of both conventional and pheromone-stimulated biofilms. Binds and recruits HDA1 to promoters of hypha-specific genes in a rapamycin-dependent manner. Involved in the switch between two heritable states, the white and opaque states. These two cell types differ in many characteristics, including cell structure, mating competence, and virulence. Each state is heritable for many generations, and switching between states occurs stochastically at low frequency
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
422
Nucleus
MSSSSSLSSSTTTATTTSARIRLPSISELTSRSTISGGSNNGNGSALKSQISPRLSDTSRILPSILKNTSGSSTPTSSSTPFKCPPIKSTVGGTLSSGNTQSNYVLGNTKINSLPRLSSPTLPVKVQPQQQPQLPPASSLSPVTRVINTPPQQPQSVSASTSPNTQYQYYQYQQQSSPIQQQQQQQQATPAATPTVMQMAQNQPSHPAPLQYATQQYYPQPVYYQSPAGVPPPPPSVTHQGHIIAVHQHPGHLPQVGVNGMPPNVGYTIVQPEIVNKSTNRCHRCGTTETPEWRRGPKGVRTLCNACGLFHAKLVKRKGAALAAEEVLNNKVTKGKNGRRISMKKHLLNESLKQQQQINGVGIPINGFNHQILPPSFKPQQGGIATLPPLMHGQYPNNVNNLVIHQPPPQQQQQQQQHNNIC
[ "GO:0002831", "GO:0002833", "GO:0006355", "GO:0006357", "GO:0006950", "GO:0008150", "GO:0009267", "GO:0009607", "GO:0009889", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010570", "GO:0019219", "GO:0019222", "GO:0030447", "GO:0031667", "GO:0031669", "GO:0033554", "GO:0036170"...
[ "GO:0002831", "GO:0002833", "GO:0006355", "GO:0006357", "GO:0006950", "GO:0008150", "GO:0009267", "GO:0009607", "GO:0009889", "GO:0009987", "GO:0010468", "GO:0010556", "GO:0010570", "GO:0019219", "GO:0019222", "GO:0030447", "GO:0031667", "GO:0031669", "GO:0033554", "GO:0036170"...
[ "GO:0001216", "GO:0003674", "GO:0003676", "GO:0003677", "GO:0003700", "GO:0005488", "GO:0043565", "GO:0140110" ]
[ "GO:0000785", "GO:0005575", "GO:0005622", "GO:0005694", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0110165" ]
AF-Q59LY1-F1-model_v6.pdb
237561.Q59LY1
[ "Q5A271", "Q59TL7", "Q59XB5", "Q7Z883", "A0A1D8PFP2", "Q59U34", "Q59ME1", "Q5AMQ6", "Q5ANJ4", "Q5A0E5", "Q5ACU9" ]
[ "IPR013088", "IPR000679" ]
{"IPR013088": [274, 357], "IPR000679": [276, 331]}
- Biofilm and cell wall regulator 1 - Enhanced filamentous growth protein 1 - Transcription activator TEC1 - Transcription factor ROB1 - Transcription factor NDT80 - Transcriptional regulatory protein UME6 - Transcriptional regulator NRG1 - Transcriptional regulator of filamentous growth FLO8 - Repressor of filamentous growth 1 - RFX-like DNA-binding protein RFX2
- IPR013088: Zinc finger, NHR/GATA-type (homologous_superfamily) [274-357] - IPR000679: Zinc finger, GATA-type (domain) [276-331]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0032502 (developmental process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0000003 (reproduction), GO:0048869 (cellular developmental process), GO:0048589 (developmental growth), GO:0048856 (anatomical structure development), GO:0019954 (asexual reproduction), GO:0043934 (sporulation), GO:0009653 (anatomical structure morphogenesis), GO:0016049 (cell growth), GO:0048522 (positive regulation of cellular process), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0009893 (positive regulation of metabolic process), GO:0030447 (filamentous growth), GO:0003006 (developmental process involved in reproduction), GO:0000902 (cell morphogenesis), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0048468 (cell development), GO:0030154 (cell differentiation), GO:0031325 (positive regulation of cellular metabolic process), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0080090 (regulation of primary metabolic process), GO:0009891 (positive regulation of biosynthetic process), GO:0051173 (positive regulation of nitrogen compound metabolic process), GO:0010557 (positive regulation of macromolecule biosynthetic process), GO:0045935 (positive regulation of nucleobase-containing compound metabolic process), GO:0051254 (positive regulation of RNA metabolic process), GO:0000904 (cell morphogenesis involved in differentiation), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:0051252 (regulation of RNA metabolic process), GO:0031328 (positive regulation of cellular biosynthetic process), GO:0010468 (regulation of gene expression), GO:1902680 (positive regulation of RNA biosynthetic process), GO:2001141 (regulation of RNA biosynthetic process), GO:0006355 (regulation of DNA-templated transcription), GO:0006357 (regulation of transcription by RNA polymerase II), GO:0045893 (positive regulation of DNA-templated transcription), GO:1903508 (positive regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription), GO:0045944 (positive regulation of transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
Q5VW32
BRO1 domain-containing protein BROX
Nuclear envelope-associated factor that is involved in the nuclear envelope ruptures during interphase (NERDI) repair, where it is locally recruited by CHMP5 and reduces cytoskeletal stress through its action on SYN2 to help reseal the ruptured membrane
Homo sapiens (Human)
411
Nucleus membrane; Lipid-anchor. Note=During nuclear envelope repair, localizes at rupture sites where it is recruited by the CHMP7/ESCRT-III axis
MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTLQGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKLITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS
[ "GO:0000278", "GO:0000280", "GO:0006996", "GO:0006998", "GO:0007049", "GO:0007084", "GO:0008150", "GO:0009987", "GO:0010256", "GO:0016043", "GO:0022402", "GO:0022607", "GO:0031468", "GO:0044085", "GO:0044091", "GO:0048285", "GO:0061024", "GO:0071709", "GO:0071763", "GO:0071840"...
[ "GO:0000278", "GO:0000280", "GO:0006996", "GO:0006998", "GO:0007049", "GO:0007084", "GO:0008150", "GO:0009987", "GO:0010256", "GO:0016043", "GO:0022402", "GO:0022607", "GO:0031468", "GO:0044085", "GO:0044091", "GO:0048285", "GO:0061024", "GO:0071709", "GO:0071763", "GO:0071840"...
[]
[]
AF-Q5VW32-F1-model_v6.pdb
9606.ENSP00000343742
[ "Q9H444", "Q96CF2", "Q9P026", "Q9Y323" ]
[ "IPR038499", "IPR004328", "IPR038898" ]
{"IPR038499": [1, 374], "IPR038898": [2, 378], "IPR004328": [4, 411]}
- Charged multivesicular body protein 4b - Charged multivesicular body protein 5 - Charged multivesicular body protein 4c - Charged multivesicular body protein 4a
- IPR038499: BRO1 domain superfamily (homologous_superfamily) [1-374] - IPR004328: BRO1 domain (domain) [4-411] - IPR038898: BRO1 domain-containing protein BROX (family) [2-378]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0050789 (regulation of biological process), GO:0065007 (biological regulation), GO:0048583 (regulation of response to stimulus), GO:0023051 (regulation of signaling), GO:0050794 (regulation of cellular process), GO:0010646 (regulation of cell communication), GO:0009966 (regulation of signal transduction), GO:0008277 (regulation of G protein-coupled receptor signaling pathway) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0043226 (organelle), GO:0005576 (extracellular region), GO:0005615 (extracellular space), GO:0070062 (extracellular exosome), GO:0043227 (membrane-bounded organelle), GO:0043230 (extracellular organelle), GO:0065010 (extracellular membrane-bounded organelle), GO:0031982 (vesicle), GO:1903561 (extracellular vesicle)
P0AD14
Sensor histidine kinase BtsS
Member of the two-component regulatory system BtsS/BtsR, which is part of a nutrient-sensing regulatory network composed of BtsS/BtsR, the low-affinity pyruvate signaling system YpdA/YpdB and their respective target proteins, BtsT and YhjX. Responds to depletion of nutrients, specifically serine, and the concomitant presence of extracellular pyruvate. BtsS is a high-affinity receptor for extracellular pyruvate that activates BtsR by phosphorylation. Activation of the BtsS/BtsR signaling cascade also suppresses YpdA/YpdB-mediated yhjX induction
Escherichia coli (strain K12)
561
Cell inner membrane; Multi-pass membrane protein
MYDFNLVLLLLQQMCVFLVIAWLMSKTPLFIPLMQVTVRLPHKFLCYIVFSIFCIMGTWFGLHIDDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSMGGMTALSCMISTIVEGLLGGLVHSILIRRGRTDKVFNPITAGAVTFVAEMVQMLIILAIARPYEDAVRLVSNIAAPMMVTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEVNSMKVAQVLYQELDIGAVAITDREKLLAFTGIGDDHHLPGKPISSTYTLKAIETGEVVYADGNEVPYRCSLHPQCKLGSTLVIPLRGENQRVMGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAGQYERQKAMLTQSEIKLLHAQVNPHFLFNALNTIKAVIRRDSEQASQLVQYLSTFFRKNLKRPSEFVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFTLQPIVENAIKHGTSQLLDTGRVAISARREGQHLMLEIEDNAGLYQPVTNASGLGMNLVDKRLRERFGDDYGISVACEPDSYTRITLRLPWRDEA
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0031406", "GO:0033293", "GO:0036094", "GO:0043167", "GO:0043168", "GO:0043177" ]
[]
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0031406", "GO:0033293", "GO:0036094", "GO:0043167", "GO:0043168", "GO:0043177" ]
[]
AF-P0AD14-F1-model_v6.pdb
511145.b2126
[ "Q9ALR8", "Q2M5W2", "Q2M7K8", "P77742", "P77740", "Q2MAV6" ]
[ "IPR003018", "IPR050640", "IPR036890", "IPR011620", "IPR010559", "IPR029016" ]
{"IPR029016": [231, 356], "IPR036890": [423, 557], "IPR050640": [36, 560], "IPR011620": [27, 196], "IPR003018": [218, 365], "IPR010559": [371, 448]}
- Transcriptional regulatory protein-like BtsR - Transcriptional regulatory protein BtsR - Transcriptional regulatory protein BtsR - Transcriptional regulatory protein BtsR - Transcriptional regulatory protein YpdB - Transcriptional regulatory protein YpdB - Transcriptional regulatory protein YpdB - Pyruvate/proton symporter BtsT - Uncharacterized MFS-type transporter YhjX - Uncharacterized protein YehS
- IPR003018: GAF domain (domain) [218-365] - IPR050640: Bacterial two-component sensor kinase systems (family) [36-560] - IPR036890: Histidine kinase/HSP90-like ATPase superfamily (homologous_superfamily) [423-557] - IPR011620: Signal transduction histidine kinase, 5TM receptor LytS, transmembrane region (domain) [27-196] - IPR010559: Signal transduction histidine kinase, internal region (domain) [371-448] - IPR029016: GAF-like domain superfamily (homologous_superfamily) [231-356]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016772 (transferase activity, transferring phosphorus-containing groups), GO:0016301 (kinase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0023052 (signaling), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0009605 (response to external stimulus), GO:0051716 (cellular response to stimulus), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0007154 (cell communication), GO:0007165 (signal transduction), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0050794 (regulation of cellular process), GO:0006793 (phosphorus metabolic process), GO:0009991 (response to extracellular stimulus), GO:1901564 (organonitrogen compound metabolic process), GO:0019538 (protein metabolic process), GO:0043170 (macromolecule metabolic process), GO:0036211 (protein modification process), GO:0006796 (phosphate-containing compound metabolic process), GO:0043412 (macromolecule modification), GO:0031667 (response to nutrient levels), GO:0006468 (protein phosphorylation), GO:0018193 (peptidyl-amino acid modification), GO:0016310 (phosphorylation), GO:0018202 (peptidyl-histidine modification) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0016020 (membrane), GO:0005886 (plasma membrane)
P53705
Bud site selection protein BUD4
Required for establishment of the axial budding pattern in yeast cells. May be involved in the selection of future sites of septation in hyphal cells. Contributes to morphogenesis and is important for induction of hyphal growth. Also plays a role in epithelial adherence, and is involved in intestinal colonization and systemic infection. The role in adhesion is probably minor compared with its role in morphogenesis
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,709
Cell surface. Bud neck. Spore, perispore. Note=Localizes to a ring at the mother-bud neck of yeast and pseudohyphal cells. Localizes to single or double rings distal to the junction of the mother cell and germ tube in hyphal cells. Requires septins for proper localization. Also found at the cell-surface of blastospores
MQTSISTTTIEDHLHHYSPEESQKLLSRESSINTDLFKHENESVDLLLKEMNSTPSKLLPIDKHSHLQLQPQSSSASIFNSPTKPLNFPRTNSKPSLDPNSSSDTYTSEQDQEKGKEEKKDTAFQTSFDRNFDLDNSIDIQQTIQHQQQQPQQQQQLPQTDNNLIDEFSFQTPMTSTLDLTKQNPTVDKINENHAPTYINTSPNKSIMKKATPKASPKKVAFTATNPEIHHYPDNRVEEEDQSQQKEDSVEPPSIQHQWKDPSQFNYSDEDTNASVPPTPPLHTTKPTFAQLLNKNNEVNSEPEALTDMKLKHENFSNLSLDEKVNLYLSPTNNNNSKNVSDMDSHLQNLQDASKNKTNENIHNLSFALKAPKNDIENPLNSLTNADISLRSSGSSQSSLQSLRDDNRVLESTPGSPKKVNPGLSLNDGIKGFSDEVVESLLPRDLSRDKLETTKENDAPEHNNENFIDAKSTNTNKGQLLVSSDDHLDSFDRSYNHTEQSILNLLNSASQSQISLNALEKQKQIQEQEQTQAAEPEEETSFSDNIKVKQEPKSNLEFVKVTIKKEPVSATEIKAPKREFSSRILRIKNEDEIAEPADIHPKKENEANSHVEDTDALLKKALNDDEESDTTQNSTKMSIRFHIDSDWKLEDSNDGDREDNDDISRFEKSDILNDVSQTSDIIGDKYGNSSSEITTKTLAPPRSDNNDKENSKSFEDPANNESSQQQLEVPHTKEDDSILANSSNIAPPEELTLPVVEANDYSSFNDVTKTFDAYSSFEESLSREHETDSKPINFISIWHKQEKQKKHQIHKVPTKQIIASYQQYKNEQESRVTSDKVKIPNAIQSKKFKEVNVMSRRVVSPDMDDLNVSQFLPELSEDSGFKDLNFANYSNNTNRPRSFTPLSTKNVLSNIDNDPNVVEPPEPKSYAEIRNARRLSANKAAPNQAPPLPPQRQPSSTRSNSNKRVSRFRVPTFEIRRTSSALAPCDMYNDIFDDFGAGSKPTIKAEGMKTLPSMDKDDVKRILNAKKGVTQDEYINAKLVDQKPKKNSIVTDPEDRYEELQQTASIHNATIDSSIYGRPDSISTDMLPYLSDELKKPPTALLSADRLFMEQEVHPLRSNSVLVHPGAGAATNSSMLPEPDFELINSPTRNVSNNSDNVAISGNASTISFNQLDMNFDDQATIGQKIQEQPASKSANTVRGDDDGLASAPETPRTPTKKESISSKPAKLSSASPRKSPIKIGSPVRVIKKNGSIAGIEPIPKATHKPKKSFQGNEISNHKVRDGGISPSSGSEHQQHNPSMVSVPSQYTDATSTVPDENKDVQHKPREKQKQKHHHRHHHHKQKTDIPGVVDDEIPDVGLQERGKLFFRVLGIKNINLPDINTHKGRFTLTLDNGVHCVTTPEYNMDDHNVAIGKEFELTVADSLEFILTLKASYEKPRGTLVEVTEKKVVKSRNRLSRLFGSKDIITTTKFVPTEVKDTWANKFAPDGSFARCYIDLQQFEDQITGKALQFDLNCFNEWETMSNGNQPMKRGKPYKIAQLEVKMLYVPRSDPREILPTSIRSAYESINELNNEQNNYFEGYLHQEGGDCPIFKKRFFKLMGTSLLAHSEISHKTRAKINLSKVVDLIYVDKENIDRSNHRNFSDVLLLDHAFKIKFANGELIDFCAPNKHEMKIWIQNLQEIIYRNRFRRQPWVNLMLQQQQQQQSSQQ
[ "GO:0000278", "GO:0000280", "GO:0000281", "GO:0000282", "GO:0000910", "GO:0006996", "GO:0007049", "GO:0007114", "GO:0007120", "GO:0007155", "GO:0007163", "GO:0008150", "GO:0009987", "GO:0016043", "GO:0019954", "GO:0022402", "GO:0022413", "GO:0022414", "GO:0030010", "GO:0030447"...
[ "GO:0000278", "GO:0000280", "GO:0000281", "GO:0000282", "GO:0000910", "GO:0006996", "GO:0007049", "GO:0007114", "GO:0007120", "GO:0007155", "GO:0007163", "GO:0008150", "GO:0009987", "GO:0016043", "GO:0019954", "GO:0022402", "GO:0022413", "GO:0022414", "GO:0030010", "GO:0030447"...
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0050839" ]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005856", "GO:0005933", "GO:0005935", "GO:0005938", "GO:0005940", "GO:0009986", "GO:0030427", "GO:0032156", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0071944", "GO:0110165" ]
AF-P53705-F1-model_v6.pdb
237561.P53705
[ "A0A1D8PQK0", "A0A1D8PM01", "A0A1D8PD83", "A0A1D8PP67", "Q59W62", "A0A1D8PDK6", "Q5A6K6", "A0A1D8PCY5" ]
[ "IPR001849", "IPR011993", "IPR052007" ]
{"IPR011993": [1561, 1686], "IPR052007": [42, 1709], "IPR001849": [1575, 1686]}
- Riboflavin synthase - Cell division control protein 10 - Serine/threonine-protein kinase GIN4 - Septin - DH domain-containing protein - Septin - 6,7-dimethyl-8-ribityllumazine synthase - Axl2p
- IPR001849: Pleckstrin homology domain (domain) [1575-1686] - IPR011993: PH-like domain superfamily (homologous_superfamily) [1561-1686] - IPR052007: Bud site selection protein 4 (family) [42-1709]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0009987 (cellular process), GO:0065007 (biological regulation), GO:0051179 (localization), GO:0050789 (regulation of biological process), GO:0051641 (cellular localization), GO:0071840 (cellular component organization or biogenesis), GO:0007017 (microtubule-based process), GO:0033036 (macromolecule localization), GO:0050794 (regulation of cellular process), GO:0070727 (cellular macromolecule localization), GO:0016043 (cellular component organization), GO:0000226 (microtubule cytoskeleton organization), GO:0032886 (regulation of microtubule-based process), GO:0051128 (regulation of cellular component organization), GO:0033043 (regulation of organelle organization), GO:0031122 (cytoplasmic microtubule organization), GO:0008104 (protein localization), GO:0006996 (organelle organization), GO:0097435 (supramolecular fiber organization), GO:0007010 (cytoskeleton organization), GO:0033365 (protein localization to organelle), GO:0051493 (regulation of cytoskeleton organization), GO:0044380 (protein localization to cytoskeleton), GO:0072698 (protein localization to microtubule cytoskeleton), GO:1905508 (protein localization to microtubule organizing center), GO:0071539 (protein localization to centrosome) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005815 (microtubule organizing center), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005816 (spindle pole body), GO:0043229 (intracellular organelle), GO:0043228 (non-membrane-bounded organelle), GO:0044732 (mitotic spindle pole body), GO:0043232 (intracellular non-membrane-bounded organelle), GO:0005856 (cytoskeleton), GO:0015630 (microtubule cytoskeleton)
Q9Y7W4
Serine/threonine-protein kinase BUR1
Serine/threonine-protein kinase involved in transcription regulation. Phosphorylates the UBC2/RAD6 ubiquitin-conjugating enzyme (E2), leading to monoubiquitination of histone H2B and the silencing of telomeric-associated genes. Also required for histone H3 methylation. Necessary for the recovery from pheromone-induced growth arrest in the cell cycle G1 phase (By similarity). Required for pseudohyphal growth and virulence in mice
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
745
Nucleus
MSVIAGHHVPRSNDQRQYDTPSVPINIAPDSEGHIHEMSRLKDYEVIEKLGQGTFGVVQKAKSKKDGSLVAIKQLINHSAKEGFPITAMREITILKQLNHKNILTIQDMIFEEPKMSNRTDIITMRGSFYTVTPYMSSDLVGLLENPKIKLELGQIKCIMQQLLKGIQYVHNQKFLHRDIKAANILIGQDGVLKIADFGLARIYHGNVPRLGMGPGGGEKAYTGLVVTRWYRPPEILLGERKYTTAVDLWGIGCVFAELFTGKPILVGKSDSHQAQIVFELVGSPLTWTDAAKLPNKNEYSCGLACKRSLEAKFASIMPTEAIDLLSGLLTLDPFKRLNALDALNHKFFSTDPLPLLPTQMPKFEESHEIDKERFKKLKDKEQAVSELKPPTEIRYDNHSESRYNADHSTFGGGVGGKETSFSSGKSDYIDHYEPRARRDHYEPRIRNDNKDSNDVRGEFESATRQEQRRRDIQNRLDAGGMDTYIPKTTTAKLREHSGTESLSKKYDNYQPINVSRGSKSPSPSKLSSISQSKADLISKPSAPKVASRESSLERKQVSNGIRTTTDVEPPRARARRPTDMFGRPLTSNSTQAQPTRNKSVERPKDLEKPTNGVTEDRNKKPVLEEKKEVVKPNLAIPKIKKSSSLVSLSSRSSTTPVISNPSKVTKRAASSVTPPVLPKKPKISKTSSESEVSDLEEDSDFTGENATVFERFMALEQLQKSPVYKRIINEKMRFEKLSGGHKSM
[ "GO:0000128", "GO:0007155", "GO:0007162", "GO:0008150", "GO:0009268", "GO:0009628", "GO:0009987", "GO:0010570", "GO:0022407", "GO:0022408", "GO:0030155", "GO:0030447", "GO:0036177", "GO:0040007", "GO:0040008", "GO:0044182", "GO:0045926", "GO:0045927", "GO:0048518", "GO:0048519"...
[ "GO:0000128", "GO:0007155", "GO:0007162", "GO:0008150", "GO:0009268", "GO:0009628", "GO:0009987", "GO:0010570", "GO:0022407", "GO:0022408", "GO:0030155", "GO:0030447", "GO:0036177", "GO:0040007", "GO:0040008", "GO:0044182", "GO:0045926", "GO:0045927", "GO:0048518", "GO:0048519"...
[ "GO:0003674", "GO:0003824", "GO:0004672", "GO:0016301", "GO:0016740", "GO:0016772", "GO:0016773", "GO:0140096" ]
[]
AF-Q9Y7W4-F1-model_v6.pdb
237561.Q9Y7W4
[ "Q59T89", "Q5A5P9", "Q5ADU9", "Q5AG95", "Q5ALX3", "Q5A4H9", "A0A1D8PD68", "Q5A462", "A0A1D8PUA6", "Q5AAS1", "Q5AK73", "Q5AHH0", "Q9HF08" ]
[ "IPR008271", "IPR050108", "IPR017441", "IPR011009", "IPR000719" ]
{"IPR011009": [38, 355], "IPR050108": [42, 355], "IPR000719": [44, 349], "IPR008271": [175, 187], "IPR017441": [50, 73]}
- Bur2p - Transcription elongation factor SPT5 - DNA-directed RNA polymerase subunit - Cyclin-like domain-containing protein - TFIIH complex kinase subunit - Transcription elongation factor SPT4 - Mediator of RNA polymerase II transcription subunit 1 - CID domain-containing protein - [RNA-polymerase]-subunit kinase - RNA polymerase II subunit A C-terminal domain phosphatase
- IPR008271: Serine/threonine-protein kinase, active site (active_site) [175-187] - IPR050108: Cyclin-dependent kinase (family) [42-355] - IPR017441: Protein kinase, ATP binding site (binding_site) [50-73] - IPR011009: Protein kinase-like domain superfamily (homologous_superfamily) [38-355] - IPR000719: Protein kinase domain (domain) [44-349]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0140096 (catalytic activity, acting on a protein), GO:0016772 (transferase activity, transferring phosphorus-containing groups), GO:0004672 (protein kinase activity), GO:0004674 (protein serine/threonine kinase activity), GO:0097472 (cyclin-dependent protein kinase activity), GO:0016301 (kinase activity), GO:0016773 (phosphotransferase activity, alcohol group as acceptor), GO:0004693 (cyclin-dependent protein serine/threonine kinase activity), GO:0008353 (RNA polymerase II CTD heptapeptide repeat kinase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0065007 (biological regulation), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0048522 (positive regulation of cellular process), GO:0019222 (regulation of metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0050794 (regulation of cellular process), GO:0009893 (positive regulation of metabolic process), GO:0030447 (filamentous growth), GO:0044238 (primary metabolic process), GO:0071704 (organic substance metabolic process), GO:0045927 (positive regulation of growth), GO:0040008 (regulation of growth), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:1901576 (organic substance biosynthetic process), GO:1901564 (organonitrogen compound metabolic process), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0031325 (positive regulation of cellular metabolic process), GO:0046483 (heterocycle metabolic process), GO:0009889 (regulation of biosynthetic process), GO:0010570 (regulation of filamentous growth), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0044249 (cellular biosynthetic process), GO:0031323 (regulation of cellular metabolic process), GO:0090033 (positive regulation of filamentous growth), GO:0080090 (regulation of primary metabolic process), GO:0043170 (macromolecule metabolic process), GO:0009891 (positive regulation of biosynthetic process), GO:0006793 (phosphorus metabolic process), GO:0051173 (positive regulation of nitrogen compound metabolic process), GO:1901566 (organonitrogen compound biosynthetic process), GO:0010557 (positive regulation of macromolecule biosynthetic process), GO:1900430 (positive regulation of filamentous growth of a population of unicellular organisms), GO:0045935 (positive regulation of nucleobase-containing compound metabolic process), GO:0051254 (positive regulation of RNA metabolic process), GO:0043412 (macromolecule modification), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0019219 (regulation of nucleobase-containing compound metabolic process), GO:1900428 (regulation of filamentous growth of a population of unicellular organisms), GO:0051252 (regulation of RNA metabolic process), GO:0031328 (positive regulation of cellular biosynthetic process), GO:0010468 (regulation of gene expression), GO:0070784 (regulation of growth of unicellular organism as a thread of attached cells), GO:1902680 (positive regulation of RNA biosynthetic process), GO:2001141 (regulation of RNA biosynthetic process), GO:0006468 (protein phosphorylation), GO:0006355 (regulation of DNA-templated transcription), GO:0016310 (phosphorylation), GO:0006357 (regulation of transcription by RNA polymerase II), GO:0045893 (positive regulation of DNA-templated transcription), GO:1903508 (positive regulation of nucleic acid-templated transcription), GO:1903506 (regulation of nucleic acid-templated transcription), GO:0045944 (positive regulation of transcription by RNA polymerase II) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0032991 (protein-containing complex), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:1902494 (catalytic complex), GO:0043229 (intracellular organelle), GO:1990234 (transferase complex), GO:0043227 (membrane-bounded organelle), GO:0061695 (transferase complex, transferring phosphorus-containing groups), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus), GO:1902911 (protein kinase complex), GO:1902554 (serine/threonine protein kinase complex), GO:0000307 (cyclin-dependent protein kinase holoenzyme complex)
Q2TBE0
CWF19-like protein 2
null
Homo sapiens (Human)
894
null
MATSMAAASGRFESAKSIEERKEQTRNARAEVLRQAKANFEKEERRKELKRLRGEDTWMLPDVNERIEQFSQEHSVKKKKKKDKHSKKAKKEKKKKSKKQKYEKNNESSDSSSSSEDEWVEAVPSQTPDKEKAWKVKDEKSGKDDTQIIKRDEWMTVDFMSVKTVSSSSLKAEKETMRKIEQEKNQALEQSKLMERELNPYWKDGGTGLPPEDCSVSSITKVSVVEDGGLSWLRKSYLRMKEQAEKQSRNFEDIVAERYGSMEIFQSKLEDAEKAASTKEDYRRERWRKPTYSDKAQNCQESRESDLVKYGNSSRDRYATTDTAKNSNNEKFIGDEKDKRPGSLETCRRESNPRQNQEFSFGNLRAKFLRPSDDEELSFHSKGRKFEPLSSSSALVAQGSLCSGFRKPTKNSEERLTSWSRSDGRGDKKHSNQKPSETSTDEHQHVPEDPREKSQDEVLRDDPPKKEHLRDTKSTFAGSPERESIHILSVDEKNKLGAKIIKAEMMGNMELAEQLKVQLEKANKFKETITQIPKKSGVENEDQQEVILVRTDQSGRVWPVNTPGKSLESQGGRRKRQMVSTHEERERVRYFHDDDNLSLNDLVKNEKMGTAENQNKLFMRMASKFMGKTDGDYYTLDDMFVSKAAERERLGEEEENQRKKAIAEHRSLAAQMEKCLYCFDSSQFPKHLIVAIGVKVYLCLPNVRSLTEGHCLIVPLQHHRAATLLDEDIWEEIQMFRKSLVKMFEDKGLDCIFLETNMSMKKQYHMVYECIPLPKEVGDMAPIYFKKAIMESDEEWSMNKKLIDLSSKDIRKSVPRGLPYFSVDFGLHGGFAHVIEDQHKFPHYFGKEIIGGMLDIEPRLWRKGIRESFEDQRKKALQFAQWWKPYDFTKSKNY
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0005654", "GO:0031974", "GO:0031981", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0043233", "GO:0070013", "GO:0110165" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0005654", "GO:0031974", "GO:0031981", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0043233", "GO:0070013", "GO:0110165" ]
AF-Q2TBE0-F1-model_v6.pdb
9606.ENSP00000282251
[ "Q6P4I0", "Q9BTK5", "Q5TH73", "Q9UDV1", "Q6IB86", "Q6FGS0", "Q6P2Q9", "Q96DI7", "Q9Y2Q8", "D6RC18", "Q9NV13", "Q9NYD8", "Q8TBD2", "Q5D0D6", "Q9NQT7", "Q9H8X8", "Q9BRX9", "Q8WUD4", "Q5BKT2", "Q9UIS5", "Q9UPG1", "Q9ULP3", "P62318", "Q99974", "Q9Y3C6", "Q9NW64", "Q9U...
[ "IPR036265", "IPR006768", "IPR040194", "IPR006767" ]
{"IPR036265": [663, 803], "IPR040194": [76, 890], "IPR006768": [664, 786], "IPR006767": [795, 889]}
- Pre-mRNA-processing factor 17 - Pre-mRNA-processing factor 19 - 116 kDa U5 small nuclear ribonucleoprotein component - Cell division cycle 5-like protein - Pre-mRNA-splicing factor SYF2 - Peptidyl-prolyl cis-trans isomerase-like 1 - U2 small nuclear ribonucleoprotein A' - Pre-mRNA-processing-splicing factor 8 - Pleiotropic regulator 1 - Protein BUD31 homolog
- IPR036265: HIT-like superfamily (homologous_superfamily) [663-803] - IPR006768: Cwf19-like, C-terminal domain-1 (domain) [664-786] - IPR040194: Cwf19-like protein (family) [76-890] - IPR006767: Cwf19-like protein, C-terminal domain-2 (domain) [795-889]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:0006725 (cellular aromatic compound metabolic process), GO:0034641 (cellular nitrogen compound metabolic process), GO:1901360 (organic cyclic compound metabolic process), GO:0006139 (nucleobase-containing compound metabolic process), GO:0043170 (macromolecule metabolic process), GO:0046483 (heterocycle metabolic process), GO:0090304 (nucleic acid metabolic process), GO:0010467 (gene expression), GO:0016070 (RNA metabolic process), GO:0006396 (RNA processing), GO:0008380 (RNA splicing), GO:0006397 (mRNA processing), GO:0016071 (mRNA metabolic process), GO:0000398 (mRNA splicing, via spliceosome), GO:0000375 (RNA splicing, via transesterification reactions), GO:0000377 (RNA splicing, via transesterification reactions with bulged adenosine as nucleophile) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0031974 (membrane-enclosed lumen), GO:0005654 (nucleoplasm), GO:0043229 (intracellular organelle), GO:0043233 (organelle lumen), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0070013 (intracellular organelle lumen), GO:0031981 (nuclear lumen), GO:0005634 (nucleus)
Q54LT7
Probable cytochrome P450 519E1
null
Dictyostelium discoideum (Social amoeba)
506
Membrane; Single-pass membrane protein
MGIGLIILYLLIGLLAYDFTKKNKKISKNDPKQPLAIPVLGHLHLFGSQPHRSLTELAKKFGGIFTLWMGDERSMVITDPNILRELYVKNHLNFYNRASSESIRIYSGNLVDISFSVGESWKNRRRYVSAALTKTKVLNVITLIEEQANFLINSMQYYAKSGEPFFPHKYYNKYTMNIVMSIGFSKTISENESVEEGPISQLIIPFYNILENLGSGNLGDYVWYTQPFFYFKNKKLEQDTKKVYTFLEEIYNEHIKNLDESNPRDLMDQLIISTGGKEKDMVIHVSTDFLLAGSDTNASTLEWFCIFLANNPEIQKKAYEELISVVGKDCKAVTTKYRDDCPYLVGAIKETLRMRTPAPLSLIRVSEEDFMTSGGIFIPKGTQIVPNLYGIGQNFVDDPSSYKPERWVEYYKNKTPTREMEATTETKSNITTEILPNDLDKVVLPFSIGPRNCPGNIISEINLFLACSNILLNFEFSNGGKKIDETEVFGITIHPKDFSIQLKKRE
[ "GO:0008150", "GO:0042221", "GO:0050896", "GO:1901698", "GO:1902351" ]
[ "GO:0008150", "GO:0042221", "GO:0050896", "GO:1901698", "GO:1902351" ]
[]
[]
AF-Q54LT7-F1-model_v6.pdb
44689.Q54LT7
null
[ "IPR017972", "IPR036396", "IPR001128", "IPR002401" ]
{"IPR036396": [16, 506], "IPR001128": [31, 501], "IPR002401": [58, 476], "IPR017972": [446, 455]}
- IPR017972: Cytochrome P450, conserved site (conserved_site) [446-455] - IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [16-506] - IPR001128: Cytochrome P450 (family) [31-501] - IPR002401: Cytochrome P450, E-class, group I (family) [58-476]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity), GO:0016705 (oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen), GO:0008395 (steroid hydroxylase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0099120 (socially cooperative development), GO:0048856 (anatomical structure development), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0044238 (primary metabolic process), GO:0044255 (cellular lipid metabolic process), GO:0044249 (cellular biosynthetic process), GO:1901576 (organic substance biosynthetic process), GO:0006629 (lipid metabolic process), GO:0044283 (small molecule biosynthetic process), GO:0030587 (sorocarp development), GO:0006082 (organic acid metabolic process), GO:0030587 (sorocarp development), GO:0006631 (fatty acid metabolic process), GO:0043436 (oxoacid metabolic process), GO:0016053 (organic acid biosynthetic process), GO:0008610 (lipid biosynthetic process), GO:0006633 (fatty acid biosynthetic process), GO:0019752 (carboxylic acid metabolic process), GO:0046394 (carboxylic acid biosynthetic process), GO:0072330 (monocarboxylic acid biosynthetic process), GO:0032787 (monocarboxylic acid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0043229 (intracellular organelle), GO:0005783 (endoplasmic reticulum), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle)
Q14T82
Lauric acid 10-hydroxylase
Cytochrome P450 hydroxylase catalyzing the conversion of decanoate (capric acid) and dodecanoate (lauric acid) to their corresponding omega-hydroxy metabolites, 10-hydroxydecanoate and 12- hydroxydodecanoate, respectively; these hydroxylated components affect plant growth, including reducing root elongation
Petunia hybrida (Petunia)
573
Endoplasmic reticulum membrane; Multi-pass membrane protein
MDYVNILLGLFFTWFLVNGLMSLRRRKISKKLPPGPFPLPIIGNLHLLGNHPHKSLAQLAKIHGPIMNLKLGQLITVVISSSVVAREVLQKQDLTFSNRFVPDVVHVRNHSDFSFVWLPVNSRWRTLRKIMNSSIFSGNKLDGNQHLRSKKVQELIDYCQKCAKNGEAVDIGRATFGTTLNLLSNTIFSKDLTNPFSDSAKEFKELVWNIMVEAWKTQFGGLLSFPLRKFDPQGIKRRMTNYFTKFLGLISGLIDERLKERNLRDNANIDVLDALLNISKRTQKRLTGIKSSSCLVSLFPTPFLPFIIICPFLYLLIFHRCKVSDLNGEGSYVGGRVQLNHTPLQIGCDRLTVSNKPRNYGDSYSSFRTCLQGLILHLNTLEWANGRTTSRIHTLLAKKHKKTISQHICTSKKIKIKKLLEHFLSFGAIVKKNLPIPPGGFSSSLFHVKWRKTLSCLGYIIPKDSQVLVSVWAIGRNSDLWENPLVFKPERFWESEIDIRGRDFELIPFGAGRRICPGLPLAIRMIPVALGSLLNSFNWKLYGGIAPKDLDMEEKFGITLAKAQPLLAIPTPL
[ "GO:0001676", "GO:0006082", "GO:0006629", "GO:0006631", "GO:0006690", "GO:0008150", "GO:0008152", "GO:0009987", "GO:0019369", "GO:0019752", "GO:0032787", "GO:0033559", "GO:0043436", "GO:0044238", "GO:0044281", "GO:0048252", "GO:0050789", "GO:0050793", "GO:0051791", "GO:0065007"...
[ "GO:0001676", "GO:0006082", "GO:0006629", "GO:0006631", "GO:0006690", "GO:0008150", "GO:0008152", "GO:0009987", "GO:0019369", "GO:0019752", "GO:0032787", "GO:0033559", "GO:0043436", "GO:0044238", "GO:0044281", "GO:0048252", "GO:0050789", "GO:0050793", "GO:0051791", "GO:0065007"...
[ "GO:0003674", "GO:0003824", "GO:0004497", "GO:0016491", "GO:0016705", "GO:0016712", "GO:0120250", "GO:0120319", "GO:0120502" ]
[]
AF-Q14T82-F1-model_v6.pdb
null
null
[ "IPR017972", "IPR036396", "IPR001128", "IPR002401" ]
{"IPR036396": [21, 572], "IPR001128": [33, 558], "IPR002401": [60, 539], "IPR017972": [509, 518]}
- IPR017972: Cytochrome P450, conserved site (conserved_site) [509-518] - IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [21-572] - IPR001128: Cytochrome P450 (family) [33-558] - IPR002401: Cytochrome P450, E-class, group I (family) [60-539]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016705 (oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen), GO:0004497 (monooxygenase activity), GO:0016709 (oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044238 (primary metabolic process), GO:0044255 (cellular lipid metabolic process), GO:0044249 (cellular biosynthetic process), GO:1901576 (organic substance biosynthetic process), GO:0006629 (lipid metabolic process), GO:0006720 (isoprenoid metabolic process), GO:0008299 (isoprenoid biosynthetic process), GO:0008610 (lipid biosynthetic process), GO:0006721 (terpenoid metabolic process), GO:0016114 (terpenoid biosynthetic process), GO:0006714 (sesquiterpenoid metabolic process), GO:0016106 (sesquiterpenoid biosynthetic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0012505 (endomembrane system), GO:0043229 (intracellular organelle), GO:0005783 (endoplasmic reticulum), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle)
P38505
Calcium-binding protein 1
Calcium-binding protein which probably acts as a calcium sensor and modulator, contributing to cellular Ca(2+)-mediated signaling. Activates endogenous kinase(s) in a Ca(2+)-dependent manner. Plays a role in regulating actin cytoskeleton dynamics. Regulates the association of actin filaments in a bundle but not actin polymerization and/or nucleation processes. Required for host cell phagocytosis and macropinocytosis
Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
134
Cytoplasm. Cell projection, phagocytic cup. Cell projection, pseudopodium. Note=During host erythrocyte phagocytosis, co-localizes with F-actin to the phagocytic cup. Leaves the phagocytic cup before the formation of phagosomes. Co-localizes with FAK in the pseudopodium
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
[ "GO:0001932", "GO:0008150", "GO:0019222", "GO:0030100", "GO:0031399", "GO:0032231", "GO:0032879", "GO:0032956", "GO:0032970", "GO:0033043", "GO:0042325", "GO:0043549", "GO:0044087", "GO:0045807", "GO:0045859", "GO:0048518", "GO:0048522", "GO:0048548", "GO:0048549", "GO:0050764"...
[ "GO:0001932", "GO:0008150", "GO:0019222", "GO:0030100", "GO:0031399", "GO:0032231", "GO:0032879", "GO:0032956", "GO:0032970", "GO:0033043", "GO:0042325", "GO:0043549", "GO:0044087", "GO:0045807", "GO:0045859", "GO:0048518", "GO:0048522", "GO:0048548", "GO:0048549", "GO:0050764"...
[ "GO:0003674", "GO:0003779", "GO:0003785", "GO:0005488", "GO:0005509", "GO:0005515", "GO:0008092", "GO:0036094", "GO:0043167", "GO:0043169", "GO:0044877", "GO:0046872", "GO:0051015" ]
[ "GO:0001891", "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005886", "GO:0016020", "GO:0031143", "GO:0042995", "GO:0071944", "GO:0110165", "GO:0120025" ]
AF-P38505-F1-model_v6.pdb
null
null
[ "IPR002048", "IPR039647", "IPR011992", "IPR018247" ]
{"IPR011992": [4, 131], "IPR039647": [3, 60], "IPR002048": [1, 134], "IPR018247": [10, 129]}
- IPR002048: EF-hand domain (domain) [1-134] - IPR039647: EF-hand domain pair protein CML-like (family) [3-60] - IPR011992: EF-hand domain pair (homologous_superfamily) [4-131] - IPR018247: EF-Hand 1, calcium-binding site (binding_site) [10-129]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0043167 (ion binding), GO:0043169 (cation binding), GO:0046872 (metal ion binding), GO:0005509 (calcium ion binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0050789 (regulation of biological process), GO:0009987 (cellular process), GO:0048519 (negative regulation of biological process), GO:0065008 (regulation of biological quality), GO:0050794 (regulation of cellular process), GO:0071840 (cellular component organization or biogenesis), GO:0048523 (negative regulation of cellular process), GO:0051129 (negative regulation of cellular component organization), GO:0016043 (cellular component organization), GO:0051128 (regulation of cellular component organization), GO:0032970 (regulation of actin filament-based process), GO:0090066 (regulation of anatomical structure size), GO:0044087 (regulation of cellular component biogenesis), GO:0031333 (negative regulation of protein-containing complex assembly), GO:0032535 (regulation of cellular component size), GO:1902903 (regulation of supramolecular fiber organization), GO:0010639 (negative regulation of organelle organization), GO:0043254 (regulation of protein-containing complex assembly), GO:0043244 (regulation of protein-containing complex disassembly), GO:0033043 (regulation of organelle organization), GO:0032956 (regulation of actin cytoskeleton organization), GO:1902904 (negative regulation of supramolecular fiber organization), GO:0032272 (negative regulation of protein polymerization), GO:0030835 (negative regulation of actin filament depolymerization), GO:0051493 (regulation of cytoskeleton organization), GO:0051494 (negative regulation of cytoskeleton organization), GO:1901879 (regulation of protein depolymerization), GO:0032271 (regulation of protein polymerization), GO:0030837 (negative regulation of actin filament polymerization), GO:0110053 (regulation of actin filament organization), GO:0030832 (regulation of actin filament length), GO:0008064 (regulation of actin polymerization or depolymerization), GO:0030833 (regulation of actin filament polymerization), GO:0051693 (actin filament capping), GO:0030834 (regulation of actin filament depolymerization), GO:0051016 (barbed-end actin filament capping) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005737 (cytoplasm), GO:0005622 (intracellular anatomical structure)
Q5ADW3
Cullin-associated NEDD8-dissociated protein 1
Key assembly factor of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes that promotes the exchange of the substrate- recognition F-box subunit in SCF complexes, thereby playing a key role in the cellular repertoire of SCF complexes. Acts as a F-box protein exchange factor (Probable)
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
1,195
null
MHDINFNILKDRAMDVDPDIRFMALEDLRKFLQDESAASTRTTLNQSLENFFPILLNMLNDQNPDVQTQAIKSFEPMVKYLSNETFSKLVKKLFALVQQNSSSTGNVTGMKSFTVSVPNIALRSLFAQSNSRDKSEFVSDKLSNSNYRFDPHLARYIMDYLIPQIVGNPVTIDSIELLIDLVTEIGYVLTQDELLNLSLYLTKVALTETGLIGKKSMVALERVVALVRTEVVIDKLLAQINQSIEPTKLFVIFQLYSVCLKRGIKPNSIDTIYNTITSNLNIEATEEEDDDDLDFDNLVKENSLKDEALTTLIDLVSQHFLPVESKNTVIALIKSYVNYNPLAQDEDFIDDEEDDISFSDDEQEDDGDGENDGSWKLRAKATILTRALLKSFPDTLELLSKEVLPVFSFADSNDQVVSEVIKSSIAIVNSTSPRDSTNVSELFPIIAARMKLAKETQVPLFLKLVESLNRFDNTSLVLEVFKIIKDRKLITSGSFDYLQFYSSTLKFHDNLPPLVIERMSSDFIKNLDDKSFNMITDSIKCLSLLFHQDSLEKLDAIVDLLIYKVENSKQYPSDLVRQSIIALGEAYGRADKQKILNVFKHSIEYEGTSKTTIDVLTQIYSTDIPSEYSYLILKKLSTSIMSSTEATSVASLLLMNKIFERLPSGDYDDTAGNLVQLLAVTNKANYECIFHILIKLVGTVLQETHRAPLLQTIVKLVNEGKIEVADNSFFQFITTACNQIPDLYNFFEDGLNLNSELSAKILAICASQNKLENKIMERREEFQNYYNSNINDSRLAFDILFLGYVGTHIEVKELDVQTLIGLLSNSQLTNDDNISAASTALGLIAQKHIDSAVPIILNAYESSEKTIIRGSLVDSLSIAADACNEDQKRVIWDKVFNFPVEFDHEVITELKKSGELLGKIPVVDELTINTDNLKTTYLILVITKSLLNNLQATKVNNTLLDSLIKSSIEWLNIVNIDIRQIVVGNLLTGLHSKPDTILPILDSIILPKIFDQLQAEDSFKKIITMGPYKYVLDEGLEIRKLCYEFIYSVISLENAVIKKYNINLEKIASKIIEVGLIDTQTDITVLACINLTNYIELHKDSAVELITRDGGNAFTTMINNLKKQLSKKLSAKASTQDSESHQERIKSIIKLSKKFASVVEAAESIELAAAIRVWNEYNNDLKTNFTIYYNSTDGV
[ "GO:0006508", "GO:0006511", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009057", "GO:0009987", "GO:0010498", "GO:0019538", "GO:0019941", "GO:0030163", "GO:0031146", "GO:0043161", "GO:0043170", "GO:0043632", "GO:0044238", "GO:0051603", "GO:0000151", "GO:0005575", "GO:0019005"...
[ "GO:0006508", "GO:0006511", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009057", "GO:0009987", "GO:0010498", "GO:0019538", "GO:0019941", "GO:0030163", "GO:0031146", "GO:0043161", "GO:0043170", "GO:0043632", "GO:0044238", "GO:0051603" ]
[]
[ "GO:0000151", "GO:0005575", "GO:0019005", "GO:0031461", "GO:0032991", "GO:0140535", "GO:1902494", "GO:1990234" ]
AF-Q5ADW3-F1-model_v6.pdb
237561.Q5ADW3
[ "Q5ADL9", "Q59RB3", "Q59WE2", "A0A1D8PJL5", "A0A1D8PRP1", "Q59PI9", "A0A1D8PJP6", "A0A1D8PP13", "Q5A7Q5", "A0A1D8PDR1", "Q5AJB7" ]
[ "IPR016024", "IPR011989", "IPR039852", "IPR013932", "IPR021133", "IPR000357" ]
{"IPR011989": [2, 1178], "IPR016024": [5, 1188], "IPR039852": [4, 1185], "IPR013932": [1003, 1181], "IPR000357": [51, 80], "IPR021133": [51, 89]}
- SCF ubiquitin ligase complex subunit - Cullin - Cullin - Cullin - COP9 signalosome complex subunit 5 - E3 ubiquitin ligase complex SCF subunit - NEDD8 family protein - Elongin-C - NEDD8-conjugating enzyme UBC12 - Defective in cullin neddylation protein 1
- IPR016024: Armadillo-type fold (homologous_superfamily) [5-1188] - IPR011989: Armadillo-like helical (homologous_superfamily) [2-1178] - IPR039852: Cullin-associated NEDD8-dissociated protein 1/2 (family) [4-1185] - IPR013932: TATA-binding protein interacting (TIP20) (domain) [1003-1181] - IPR021133: HEAT, type 2 (repeat) [51-89] - IPR000357: HEAT repeat (repeat) [51-80]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0050896 (response to stimulus), GO:0009605 (response to external stimulus), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0006950 (response to stress), GO:0009607 (response to biotic stimulus), GO:0007154 (cell communication), GO:0009991 (response to extracellular stimulus), GO:0031668 (cellular response to extracellular stimulus), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0036180 (filamentous growth of a population of unicellular organisms in response to biotic stimulus), GO:0042594 (response to starvation), GO:0071496 (cellular response to external stimulus), GO:0033554 (cellular response to stress), GO:0036170 (filamentous growth of a population of unicellular organisms in response to starvation), GO:0009267 (cellular response to starvation), GO:0031669 (cellular response to nutrient levels), GO:0031667 (response to nutrient levels) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0031012 (extracellular matrix), GO:0062039 (biofilm matrix), GO:0062040 (fungal biofilm matrix)
Q14444
Caprin-1
mRNA-binding protein that acts as a regulator of mRNAs transport, translation and/or stability, and which is involved in neurogenesis, synaptic plasticity in neurons and cell proliferation and migration in multiple cell types. Plays an essential role in cytoplasmic stress granule formation. Acts as an mRNA regulator by mediating formation of some phase-separated membraneless compartment: undergoes liquid-liquid phase separation upon binding to target mRNAs, leading to assemble mRNAs into cytoplasmic ribonucleoprotein granules that concentrate mRNAs with associated regulatory factors. Undergoes liquid-liquid phase separation following phosphorylation and interaction with FMR1, promoting formation of cytoplasmic ribonucleoprotein granules that concentrate mRNAs with factors that inhibit translation and mediate deadenylation of target mRNAs. In these cytoplasmic ribonucleoprotein granules, CAPRIN1 mediates recruitment of CNOT7 deadenylase, leading to mRNA deadenylation and degradation. Binds directly and selectively to MYC and CCND2 mRNAs. In neuronal cells, directly binds to several mRNAs associated with RNA granules, including BDNF, CAMK2A, CREB1, MAP2, NTRK2 mRNAs, as well as to GRIN1 and KPNB1 mRNAs, but not to rRNAs
Homo sapiens (Human)
709
Cytoplasm, Cytoplasmic ribonucleoprotein granule. Cytoplasm, cytosol. Cell projection, dendrite. Cell projection, lamellipodium. Note=Mediates formation and localizes to cytoplasmic ribonucleoprotein membraneless compartments. Associated with RNA granules. At the leading edge of migrating fibroblasts, colocalizes with DDX3X
MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPAEEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQPNQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQPQVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTELQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNTQQVN
[ "GO:0000288", "GO:0000290", "GO:0000956", "GO:0006139", "GO:0006401", "GO:0006402", "GO:0006417", "GO:0006446", "GO:0006996", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009057", "GO:0009889", "GO:0009890", "GO:0009892", "GO:0009893", "GO:0009894", "GO:0009896", "GO:0009987"...
[ "GO:0000288", "GO:0000290", "GO:0000956", "GO:0006139", "GO:0006401", "GO:0006402", "GO:0006417", "GO:0006446", "GO:0006996", "GO:0008150", "GO:0008152", "GO:0009056", "GO:0009057", "GO:0009889", "GO:0009890", "GO:0009892", "GO:0009893", "GO:0009894", "GO:0009896", "GO:0009987"...
[]
[]
AF-Q14444-F1-model_v6.pdb
9606.ENSP00000340329
[ "Q9Y2S4", "Q53HJ1", "Q99700", "Q8N6R8", "Q9H4A8", "Q96B58", "Q99556", "Q5D048", "Q9NVF2", "Q8N102", "Q9NVB6", "Q99054", "Q9UPA1", "Q93004", "Q61516", "Q8WUM2", "Q9UMF9", "Q9NSL7", "Q9UDL5", "Q5HYE9", "O15536", "Q92900", "Q01085", "Q96E95", "Q5FVF0", "Q9UGL5", "Q96...
[ "IPR028816", "IPR041637", "IPR022070" ]
{"IPR028816": [33, 695], "IPR041637": [132, 247], "IPR022070": [359, 685]}
- Ras GTPase-activating protein-binding protein 1 - Ras GTPase-activating protein-binding protein 2 - Fragile X messenger ribonucleoprotein 1 - RNA cytidine acetyltransferase - Ubiquitin carboxyl-terminal hydrolase 10 - RNA-binding protein FXR2 - RNA-binding protein FXR1 - Nucleolysin TIAR - Cytotoxic granule associated RNA binding protein TIA1 - Polyadenylate-binding protein 1
- IPR028816: Caprin (family) [33-695] - IPR041637: Caprin-1 dimerization domain (domain) [132-247] - IPR022070: Cytoplasmic activation/proliferation-associated protein-1 C term (domain) [359-685]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0005515 (protein binding), GO:0003676 (nucleic acid binding), GO:0003723 (RNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0050789 (regulation of biological process), GO:0048519 (negative regulation of biological process), GO:0019222 (regulation of metabolic process), GO:0050794 (regulation of cellular process), GO:0048523 (negative regulation of cellular process), GO:0009892 (negative regulation of metabolic process), GO:0051172 (negative regulation of nitrogen compound metabolic process), GO:0010605 (negative regulation of macromolecule metabolic process), GO:0009889 (regulation of biosynthetic process), GO:0051171 (regulation of nitrogen compound metabolic process), GO:0060255 (regulation of macromolecule metabolic process), GO:0031323 (regulation of cellular metabolic process), GO:0009890 (negative regulation of biosynthetic process), GO:0080090 (regulation of primary metabolic process), GO:0031324 (negative regulation of cellular metabolic process), GO:0034248 (regulation of amide metabolic process), GO:0010556 (regulation of macromolecule biosynthetic process), GO:0051246 (regulation of protein metabolic process), GO:0051248 (negative regulation of protein metabolic process), GO:0031326 (regulation of cellular biosynthetic process), GO:0010558 (negative regulation of macromolecule biosynthetic process), GO:0031327 (negative regulation of cellular biosynthetic process), GO:0010629 (negative regulation of gene expression), GO:0010468 (regulation of gene expression), GO:0034249 (negative regulation of amide metabolic process), GO:0017148 (negative regulation of translation), GO:2000112 (regulation of cellular macromolecule biosynthetic process), GO:0006417 (regulation of translation), GO:2000113 (negative regulation of cellular macromolecule biosynthetic process), GO:0010608 (post-transcriptional regulation of gene expression) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0031252 (cell leading edge), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure), GO:0005737 (cytoplasm), GO:0016020 (membrane)
Q1K615
Beta-apo-4'-carotenal oxygenase
Beta-apo-4'-carotenal oxygenase involved in the last step of synthesis of neurosporaxanthin, a carboxylic apocarotenoid acting as an essential protective pigment and leading to orange pigmentation. Converts the aldehyde beta-apo-4'-carotenal into neurosporaxanthin. Neurosporaxanthin is synthesized from geranyl-geranyl pyrophosphate (GGPP) through several enzymatic activities. Phytoene synthase activity performed by the bifunctional enzyme al-2 first produces phytoene from geranyl-geranyl pyrophosphate (GGPP). The phytoene dehydrogenase al-1 then introduces 5 desaturations to lead to 3,4-didehydrolycopene via the intermediates phytofluene, zeta-carotene, neurosporene and lycopene. Al-2 cyclase activity then converts 3,4-didehydrolycopene into torulene. Al-2 can also convet lycopene into gamma-carotene which in turn is converted to beta- carotene by an additional al-2 cyclization reaction. Torulene is the substrate of the dioxidase cao-2 that breaks the molecule, removing five carbon atoms to yield beta-apo-4'-carotenal, whereas the aldehyde dehydrogenase ylo-1 mediates the last step by converting beta-apo-4'- carotenal into neurosporaxanthin (Probable)
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 /
533
null
MAASKVEIAPFEVTPLDAIPAVCSTARATFASHKTKNLQWRLVQLRKLYWALDDFKASLMAALQQDLRKGGYESDFTEVDWVKNDCLHMINNLETFAKTEKLKDLPVTYSMMNFRVKKEPLGTVLIIGPYNFPIQLVLAPLVGAIGAGCTAVIKPSELTPACAMAMKEMIESRLDRDAFAVVNGGVPETNALMEEKWDKIMFTGSAQVGSIIARKAAETLTPVCLELGGRNPAFVTKKANLALAARRLMWGKVLNAGQVCMSHNYVLVDKDVADTFIEFLKIAYKDMFPNGAKASPDLSRIVNARHFNRIKKMLDETKGKIVMGGEMDESELYIEPTAVLVDSLDDPMMQEESFGPIFSIYPVDTLDQALSIANNVHRTPLALMAFGDKSETNRILDEMTSGGACINDSYFHGAVHTVPFGGVGDSGWGAYRGKASFDNFTHFRTVSETPTWMDRFLRVRYMPYDWSELRLLQRWTNKKPNFDRQGTVAKGSEYWMWYFLGLGTKGGVKGALMRWLVVVAGYYLSAYMKARRA
[ "GO:0006629", "GO:0006720", "GO:0006721", "GO:0008150", "GO:0008152", "GO:0008299", "GO:0008610", "GO:0009058", "GO:0009987", "GO:0016109", "GO:0016114", "GO:0016116", "GO:0016117", "GO:0042440", "GO:0044238", "GO:0046148", "GO:0003674", "GO:0003824", "GO:0004029", "GO:0004030"...
[ "GO:0006629", "GO:0006720", "GO:0006721", "GO:0008150", "GO:0008152", "GO:0008299", "GO:0008610", "GO:0009058", "GO:0009987", "GO:0016109", "GO:0016114", "GO:0016116", "GO:0016117", "GO:0042440", "GO:0044238", "GO:0046148" ]
[ "GO:0003674", "GO:0003824", "GO:0004029", "GO:0004030", "GO:0016491", "GO:0016620", "GO:0016903" ]
[]
AF-Q1K615-F1-model_v6.pdb
367110.Q1K615
[ "Q1K773", "Q7SAQ2", "Q7SBJ5", "V5IP16", "Q7RVN3", "A7UXI1", "A7UWE4" ]
[ "IPR012394", "IPR016162", "IPR016161", "IPR016163", "IPR015590" ]
{"IPR016161": [21, 464], "IPR016162": [27, 444], "IPR016163": [229, 426], "IPR012394": [17, 486], "IPR015590": [17, 446]}
- Carotenoid dioxygenase - Peroxisomal membrane protein - ATPase family AAA domain-containing protein 1 - Peroxin - Hsc70 cochaperone - Mitochondrial fission 1 protein - Bifunctional lycopene cyclase/phytoene synthase
- IPR012394: Aldehyde dehydrogenase NAD(P)-dependent (family) [17-486] - IPR016162: Aldehyde dehydrogenase, N-terminal (homologous_superfamily) [27-444] - IPR016161: Aldehyde/histidinol dehydrogenase (homologous_superfamily) [21-464] - IPR016163: Aldehyde dehydrogenase, C-terminal (homologous_superfamily) [229-426] - IPR015590: Aldehyde dehydrogenase domain (domain) [17-446]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016903 (oxidoreductase activity, acting on the aldehyde or oxo group of donors), GO:0016620 (oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor), GO:0004030 (aldehyde dehydrogenase [NAD(P)+] activity), GO:0004029 (aldehyde dehydrogenase (NAD+) activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process), GO:0044281 (small molecule metabolic process), GO:0044238 (primary metabolic process), GO:0044255 (cellular lipid metabolic process), GO:1901615 (organic hydroxy compound metabolic process), GO:0006066 (alcohol metabolic process), GO:0006629 (lipid metabolic process), GO:0034308 (primary alcohol metabolic process), GO:0006720 (isoprenoid metabolic process), GO:1901568 (fatty acid derivative metabolic process), GO:0006721 (terpenoid metabolic process), GO:0016101 (diterpenoid metabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0031975 (envelope), GO:0016020 (membrane), GO:0005737 (cytoplasm), GO:0031090 (organelle membrane), GO:0031967 (organelle envelope), GO:0005739 (mitochondrion), GO:0043229 (intracellular organelle), GO:0019867 (outer membrane), GO:0043227 (membrane-bounded organelle), GO:0005740 (mitochondrial envelope), GO:0031968 (organelle outer membrane), GO:0043231 (intracellular membrane-bounded organelle), GO:0098588 (bounding membrane of organelle), GO:0031966 (mitochondrial membrane), GO:0005741 (mitochondrial outer membrane)
Q59VH7
Secreted aspartic protease 7
Secreted aspartic peptidases (SAPs) are a group of ten acidic hydrolases considered as key virulence factors (By similarity). These enzymes supply the fungus with nutrient amino acids as well as are able to degrade the selected host's proteins involved in the immune defense (By similarity)
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
588
Secreted
MQRVLELLLLSSTALAVIGDGFIALPVHKLQAGEGSAHFPNRLPIFDVVNGVAKSVEDDVNQIIQPIFGNGIFSGGSIQGTHSGNGHSVKYEVSLPSSSSQKGSNGPSSTDNKDTDPSKTGFSLDDLMNSIPTDFWNLIGLNKAPTSSDNGSKDADFTPSAVSQVEQPTSKSVESTAPGPASSASSSSSSEAASSSQPSEDSQPSSSANKKTGAFFLSLDNTQTLYTATLKVGSPAQEVQVMIDTGSSDLWFISSGNSQCKVNGGSIDCDKYGVFDKSKSSTWHDNKTDYSISYYDGDKASGTMGQDNITFADGFSIENANFAVIDNTTSSIGVFGVGYPELEAVKSKYTNLPFAMKEQNLIAKVAYSLYLDSRDAVQGYILFGGIDHAKYTGDLKAFDIVQSNDKYVYSQIPLTSVASSLNNYTNAYGLPAGSNHPKVGAVIYNGTDSFNGGVDLKDTPTLLDTGTTYSYLSKDQVESIVGLYGNVTYNDAGKAYEVPCWVGNPGNYLEFNFKNEQYIKVPTSEFVISVGTYASGAELCVFGILPGTHSILGDNFMRSVYAVFDLEDHVISIAQAAYNDNHAVVPIE
[ "GO:0006508", "GO:0008150", "GO:0008152", "GO:0009987", "GO:0019538", "GO:0043170", "GO:0044238", "GO:0003674", "GO:0003824", "GO:0004175", "GO:0004190", "GO:0008233", "GO:0016787", "GO:0070001", "GO:0140096", "GO:0005575", "GO:0005576", "GO:0031982", "GO:0043226", "GO:0043227"...
[ "GO:0006508", "GO:0008150", "GO:0008152", "GO:0009987", "GO:0019538", "GO:0043170", "GO:0044238" ]
[ "GO:0003674", "GO:0003824", "GO:0004175", "GO:0004190", "GO:0008233", "GO:0016787", "GO:0070001", "GO:0140096" ]
[ "GO:0005575", "GO:0005576", "GO:0031982", "GO:0043226", "GO:0043227", "GO:0043230", "GO:0065010", "GO:0110165", "GO:1903561" ]
AF-Q59VH7-F1-model_v6.pdb
237561.Q59VH7
null
[ "IPR001969", "IPR033876", "IPR001461", "IPR033121", "IPR021109" ]
{"IPR021109": [211, 587], "IPR001461": [186, 575], "IPR033876": [224, 576], "IPR033121": [226, 576], "IPR001969": [241, 252]}
- IPR001969: Aspartic peptidase, active site (active_site) [241-252] - IPR033876: Secreted aspartic endopeptidase (domain) [224-576] - IPR001461: Aspartic peptidase A1 (family) [186-575] - IPR033121: Peptidase family A1 domain (domain) [226-576] - IPR021109: Aspartic peptidase domain superfamily (homologous_superfamily) [211-587]
Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0140096 (catalytic activity, acting on a protein), GO:0016787 (hydrolase activity), GO:0008233 (peptidase activity), GO:0004175 (endopeptidase activity), GO:0070001 (aspartic-type peptidase activity), GO:0004190 (aspartic-type endopeptidase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0040007 (growth), GO:0009987 (cellular process), GO:0051703 (biological process involved in intraspecies interaction between organisms), GO:0009605 (response to external stimulus), GO:0009628 (response to abiotic stimulus), GO:0044237 (cellular metabolic process), GO:0042221 (response to chemical), GO:0009607 (response to biotic stimulus), GO:0006807 (nitrogen compound metabolic process), GO:0044010 (single-species biofilm formation), GO:0098743 (cell aggregation), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0006950 (response to stress), GO:0045926 (negative regulation of growth), GO:0071704 (organic substance metabolic process), GO:0044403 (biological process involved in symbiotic interaction), GO:0051707 (response to other organism), GO:0040008 (regulation of growth), GO:0044238 (primary metabolic process), GO:0009408 (response to heat), GO:0051701 (biological process involved in interaction with host), GO:0009266 (response to temperature stimulus), GO:0098630 (aggregation of unicellular organisms), GO:0010035 (response to inorganic substance), GO:1901564 (organonitrogen compound metabolic process), GO:0036180 (filamentous growth of a population of unicellular organisms in response to biotic stimulus), GO:0043207 (response to external biotic stimulus), GO:0052173 (response to defenses of other organism), GO:0006979 (response to oxidative stress), GO:0070887 (cellular response to chemical stimulus), GO:0033554 (cellular response to stress), GO:0019538 (protein metabolic process), GO:0075136 (response to host), GO:0009268 (response to pH), GO:0090609 (single-species submerged biofilm formation), GO:0043170 (macromolecule metabolic process), GO:0006793 (phosphorus metabolic process), GO:0034599 (cellular response to oxidative stress), GO:0010038 (response to metal ion), GO:0036211 (protein modification process), GO:0052200 (response to host defenses), GO:0043412 (macromolecule modification), GO:0071241 (cellular response to inorganic substance), GO:0062197 (cellular response to chemical stress), GO:0042710 (biofilm formation), GO:0006796 (phosphate-containing compound metabolic process), GO:0044011 (single-species biofilm formation on inanimate substrate), GO:1901701 (cellular response to oxygen-containing compound), GO:0000302 (response to reactive oxygen species), GO:0071248 (cellular response to metal ion), GO:0090605 (submerged biofilm formation), GO:0046688 (response to copper ion), GO:0034614 (cellular response to reactive oxygen species), GO:0006468 (protein phosphorylation), GO:0052572 (response to host immune response), GO:0042783 (evasion of host immune response) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0043226 (organelle), GO:0005576 (extracellular region), GO:0043227 (membrane-bounded organelle), GO:0043230 (extracellular organelle), GO:0065010 (extracellular membrane-bounded organelle), GO:0031982 (vesicle), GO:1903561 (extracellular vesicle)
A0A2H1A5W4
Cell wall integrity transcriptional regulator CAS5
Transcription factor involved in the cell wall damage response. Required for expression of numerous cell wall biosynthesis inhibitor caspofungin-responsive genes. Plays a key role in adherence, hyphal development, and virulence (By similarity)
Candidozyma auris (Yeast) (Candida auris)
679
Nucleus. Cytoplasm. Note=Localizes to the cytoplasm under basal conditions and translocates to the nucleus during caspofungin treatment
MENYLMSSPSQHHHPHQQPHQQHNPYANSDTLTNLPNLENDLDFSDSEVVPPSKDYQGSPNVYDGLDFSTDMATDFVYDSTLEFDLDDHKHMPDPAEMGHSKHFSVDRPLSAPFYLSQNSRTNFNHSRNISLDDTAYKRSFHKHSASLVSNAAEPPSGTFAHSHSSNTLQSSSDSMPQLSSSVSNPSLLDSPHSAMQTATPGRRHKSSSVSSHTNLYTTPLRGGTHVSPLTHTKVGKTPIGKTHRRNRSRASLEPSSAHLLATVANMKGTSNASNLALSSAQTPSGHLTASTSQHFHGINLSEANPFHNEFVSPGVGSGHLSDHDATPLNTPAGRDHSSMASQFFTPISHNRSFGGSLLESSSSAMGSAASAFPSNLSSNDLSVASSSNSSARPGMAPLRRNDTLDSITIEDQEDDACKQLRKAKSFTSFAEQRMSQLMKQRAGKSSKDLGNVFTDSTPDASSSGRSPRKDSSSGNSYSKSASVDLLSASLVVPDHNDSYLKSYPASMDLASITNASSGNHASPSPPKTSSRLMPPIESQEPSSSRSRGSSTSKPRQTLASAAAKKLNKKVPQTYPTASQIQKAATTEDIAKFAESILQSENKRPIFVKKQEEEVYDPKKKHKCPLCLARFQRPEHVKRHLKSHSSEKPFQCEEPNCGRRFNRKDNLKAHLKKIHHKNL
[ "GO:0008150", "GO:0009987", "GO:0016043", "GO:0031505", "GO:0045229", "GO:0071554", "GO:0071555", "GO:0071840", "GO:0071852", "GO:0005575", "GO:0005622", "GO:0005634", "GO:0005737", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
[ "GO:0008150", "GO:0009987", "GO:0016043", "GO:0031505", "GO:0045229", "GO:0071554", "GO:0071555", "GO:0071840", "GO:0071852" ]
[]
[ "GO:0005575", "GO:0005622", "GO:0005634", "GO:0005737", "GO:0043226", "GO:0043227", "GO:0043229", "GO:0043231", "GO:0110165" ]
AF-A0A2H1A5W4-F1-model_v6.pdb
498019.A0A2H1A5W4
null
[ "IPR013087", "IPR036236" ]
{"IPR036236": [631, 677], "IPR013087": [622, 675]}
- IPR013087: Zinc finger C2H2-type (domain) [622-675] - IPR036236: Zinc finger C2H2 superfamily (homologous_superfamily) [631-677]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding) Biological Process (BP): GO:0008150 (biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0050896 (response to stimulus), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0009605 (response to external stimulus), GO:0030447 (filamentous growth), GO:0071840 (cellular component organization or biogenesis), GO:0006950 (response to stress), GO:0071554 (cell wall organization or biogenesis), GO:0051707 (response to other organism), GO:0009607 (response to biotic stimulus), GO:0006952 (defense response), GO:0016043 (cellular component organization), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0071852 (fungal-type cell wall organization or biogenesis), GO:0043207 (response to external biotic stimulus), GO:0071555 (cell wall organization), GO:0009611 (response to wounding), GO:0098542 (defense response to other organism), GO:0031505 (fungal-type cell wall organization), GO:0045229 (external encapsulating structure organization), GO:0031667 (response to nutrient levels) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0005737 (cytoplasm), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
P70343
Caspase-4
Inflammatory caspase that acts as the effector of the non- canonical inflammasome by mediating lipopolysaccharide (LPS)-induced pyroptosis. Also indirectly activates the NLRP3 and NLRP6 inflammasomes. Acts as a thiol protease that cleaves a tetrapeptide after an Asp residue at position P1: catalyzes cleavage of CGAS and GSDMD. In contrast to its human ortholog, does not cleave IL18. Effector of the non-canonical inflammasome independently of NLRP3 inflammasome and CASP1: the non-canonical inflammasome promotes pyroptosis through GSDMD cleavage without involving secretion of cytokine IL1B and IL18. In the non-canonical inflammasome, CASP4/CASP11 is activated by direct binding to the lipid A moiety of LPS without the need of an upstream sensor. LPS-binding promotes CASP4/CASP11 activation and CASP4/CASP11-mediated cleavage of GSDMD, followed by pyroptosis of infected cells and their extrusion into the gut lumen. Also indirectly promotes secretion of mature cytokines (IL1A, IL18 and HMGB1) downstream of GSDMD-mediated pyroptosis via activation of the NLRP3 and NLRP6 inflammasomes (By similarity). Involved in NLRP3- dependent CASP1 activation and IL1B and IL18 secretion in response to non-canonical activators, such as UVB radiation or cholera enterotoxin. Involved in NLRP6 inflammasome-dependent activation in response to lipoteichoic acid (LTA), a cell-wall component of Gram- positive bacteria, which leads to CASP1 activation and IL1B and IL18 secretion. Involved in LPS-induced IL6 secretion; this activity may not require caspase enzymatic activity (By similarity). The non-canonical inflammasome is required for innate immunity to cytosolic, but not vacuolar, bacteria. Plays a crucial role in the restriction of S.typhimurium replication in colonic epithelial cells during infection. Activation of the non-canonical inflammasome in brain endothelial cells can lead to excessive pyroptosis, leading to blood-brain barrier breakdown. Pyroptosis limits bacterial replication, while cytokine secretion promotes the recruitment and activation of immune cells and triggers mucosal inflammation. May also act as an activator of adaptive immunity in dendritic cells, following activation by oxidized phospholipid 1-palmitoyl-2-arachidonoyl- sn-glycero-3- phosphorylcholine, an oxidized phospholipid (oxPAPC). Cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP4/CASP11 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part. In contrast, it does not directly process IL1B. During non-canonical inflammasome activation, cuts CGAS and may play a role in the regulation of antiviral innate immune activation
Mus musculus (Mouse)
373
Cytoplasm, cytosol. Cytoplasm. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion. Inflammasome. Secreted. Note=Predominantly localizes to the endoplasmic reticulum (ER). Association with the ER membrane requires TMEM214. Released in the extracellular milieu by keratinocytes following UVB irradiation
MAENKHPDKPLKVLEQLGKEVLTEYLEKLVQSNVLKLKEEDKQKFNNAERSDKRWVFVDAMKKKHSKVGEMLLQTFFSVDPGSHHGEANLEMEEPEESLNTLKLCSPEEFTRLCREKTQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFITRLISCFRKHACSCHLFDIFLKVQQSFEKASIHSQMPTIDRATLTRYFYLFPGN
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0032991", "GO:0110165", "GO:0160074" ]
[]
[]
[ "GO:0005575", "GO:0005622", "GO:0005737", "GO:0005829", "GO:0032991", "GO:0110165", "GO:0160074" ]
AF-P70343-F1-model_v6.pdb
10090.ENSMUSP00000027012
[ "Q91WS2", "Q3TT82", "Q9EPB4", "T1W2H6", "Q8BS50", "Q9R030", "Q8VEC5", "Q9R017", "Q3UP24", "Q3UEM3", "Q9Z2D3", "Q9R029", "Q67EY4", "Q9D8T2", "Q8BN26", "O88879", "Q9D2Y4", "Q91VF3", "Q9JIB6", "Q91VJ1", "Q62167", "Q4PLS0", "Q2LKV8", "Q2M4J6", "P70380", "Q6UTW9", "Q6U...
[ "IPR002398", "IPR033139", "IPR001309", "IPR029030", "IPR015917", "IPR011600", "IPR001315", "IPR011029", "IPR016129", "IPR002138" ]
{"IPR011029": [4, 85], "IPR029030": [109, 372], "IPR002398": [1, 373], "IPR001315": [1, 92], "IPR015917": [121, 371], "IPR001309": [130, 258], "IPR011600": [131, 368], "IPR002138": [286, 371], "IPR016129": [193, 207], "IPR033139": [245, 256]}
- Gasdermin-D - NACHT, LRR and PYD domains-containing protein 1a - Caspase-1 - Apoptosis-associated speck-like protein containing a CARD - NACHT, LRR and PYD domains-containing protein 3 - NLR family CARD domain-containing protein 4 - Interferon-inducible protein AIM2 - NACHT, LRR and PYD domains-containing protein 6 - Baculoviral IAP repeat-containing protein 1e - Baculoviral IAP repeat-containing protein 1b
- IPR002398: Peptidase C14 family (family) [1-373] - IPR033139: Peptidase family C14A, cysteine active site (active_site) [245-256] - IPR001309: Peptidase C14, p20 domain (domain) [130-258] - IPR029030: Caspase-like domain superfamily (homologous_superfamily) [109-372] - IPR015917: Peptidase C14A, caspase catalytic domain (domain) [121-371] - IPR011600: Peptidase C14, caspase domain (domain) [131-368] - IPR001315: CARD domain (domain) [1-92] - IPR011029: Death-like domain superfamily (homologous_superfamily) [4-85] - IPR016129: Peptidase family C14A, His active site (active_site) [193-207] - IPR002138: Peptidase C14, caspase non-catalytic subunit p10 (domain) [286-371]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0140096 (catalytic activity, acting on a protein), GO:0016787 (hydrolase activity), GO:0005515 (protein binding), GO:0008233 (peptidase activity), GO:0008234 (cysteine-type peptidase activity), GO:0004175 (endopeptidase activity), GO:0004197 (cysteine-type endopeptidase activity) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0048518 (positive regulation of biological process), GO:0050789 (regulation of biological process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0022414 (reproductive process), GO:0000003 (reproduction), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0009605 (response to external stimulus), GO:0048869 (cellular developmental process), GO:0048856 (anatomical structure development), GO:0023056 (positive regulation of signaling), GO:0019222 (regulation of metabolic process), GO:0048584 (positive regulation of response to stimulus), GO:0051240 (positive regulation of multicellular organismal process), GO:0002684 (positive regulation of immune system process), GO:0006807 (nitrogen compound metabolic process), GO:0002682 (regulation of immune system process), GO:0051239 (regulation of multicellular organismal process), GO:0071704 (organic substance metabolic process), GO:0003006 (developmental process involved in reproduction), GO:0048522 (positive regulation of cellular process), GO:0009607 (response to biotic stimulus), GO:0008219 (cell death), GO:0050794 (regulation of cellular process), GO:0048583 (regulation of response to stimulus), GO:0009893 (positive regulation of metabolic process), GO:0023051 (regulation of signaling), GO:0006950 (response to stress), GO:0030029 (actin filament-based process), GO:0051707 (response to other organism), GO:0044238 (primary metabolic process), GO:0009967 (positive regulation of signal transduction), GO:0060759 (regulation of response to cytokine stimulus), GO:0032103 (positive regulation of response to external stimulus), GO:0012501 (programmed cell death), GO:1901564 (organonitrogen compound metabolic process), GO:0035234 (ectopic germ cell programmed cell death), GO:0043207 (response to external biotic stimulus), GO:0010604 (positive regulation of macromolecule metabolic process), GO:0048468 (cell development), GO:0030154 (cell differentiation), GO:0080134 (regulation of response to stress), GO:0019538 (protein metabolic process), GO:0009966 (regulation of signal transduction), GO:0006952 (defense response), GO:0060255 (regulation of macromolecule metabolic process), GO:0032101 (regulation of response to external stimulus), GO:0002700 (regulation of production of molecular mediator of immune response), GO:0060760 (positive regulation of response to cytokine stimulus), GO:0001817 (regulation of cytokine production), GO:0030036 (actin cytoskeleton organization), GO:0043170 (macromolecule metabolic process), GO:0098542 (defense response to other organism), GO:0010646 (regulation of cell communication), GO:0002702 (positive regulation of production of molecular mediator of immune response), GO:0002697 (regulation of immune effector process), GO:0009617 (response to bacterium), GO:0010623 (programmed cell death involved in cell development), GO:0010647 (positive regulation of cell communication), GO:0001819 (positive regulation of cytokine production), GO:0031349 (positive regulation of defense response), GO:0002699 (positive regulation of immune effector process), GO:0031347 (regulation of defense response), GO:0001961 (positive regulation of cytokine-mediated signaling pathway), GO:0006508 (proteolysis), GO:0001959 (regulation of cytokine-mediated signaling pathway), GO:0070269 (pyroptosis), GO:0002718 (regulation of cytokine production involved in immune response), GO:0051604 (protein maturation), GO:0010628 (positive regulation of gene expression), GO:0032652 (regulation of interleukin-1 production), GO:0010468 (regulation of gene expression), GO:0050727 (regulation of inflammatory response), GO:0050729 (positive regulation of inflammatory response), GO:0042742 (defense response to bacterium), GO:0032732 (positive regulation of interleukin-1 production), GO:0006996 (organelle organization), GO:0010467 (gene expression), GO:0097435 (supramolecular fiber organization), GO:0007015 (actin filament organization), GO:0002720 (positive regulation of cytokine production involved in immune response), GO:0010935 (regulation of macrophage cytokine production), GO:0061081 (positive regulation of myeloid leukocyte cytokine production involved in immune response), GO:0016485 (protein processing), GO:0032651 (regulation of interleukin-1 beta production), GO:0007010 (cytoskeleton organization), GO:0050830 (defense response to Gram-positive bacterium), GO:0032731 (positive regulation of interleukin-1 beta production), GO:0060907 (positive regulation of macrophage cytokine production), GO:0016540 (protein autoprocessing) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0032991 (protein-containing complex), GO:0005829 (cytosol), GO:0005622 (intracellular anatomical structure), GO:0061702 (inflammasome complex), GO:0005737 (cytoplasm)
Q567I9
Cytochrome b5 domain-containing protein 1
Radial spoke stalk protein that binds heme under oxidizing conditions (Probable). Required for the coordinated beating of multiple cilia maybe by functioning in a redox signaling pathway
Danio rerio (Zebrafish) (Brachydanio rerio)
214
Cytoplasm, cytoskeleton, cilium axoneme. Note=Localizes to the radial spoke stalk
MRRSKYFTPNEVSLHNTINDIWVSYLGKVYDLTPLLEAYKGDVLLKPIIECAGKDISHWFDPKTKDILTHVDPLTGCIKYYTPRGRFIHIPPPCPRTDWANNFGKPWWKDNRYEVGLLSAKTRWIRIINTLTSQEQKLEVCSEESLDEILHRYLFYNSHAASYTWKLSGINLDMSKTLSENGIPEEDEFYCGSPDCNLFSPSICLYFNDDLTEL
[ "GO:0003341", "GO:0003352", "GO:0003356", "GO:0007017", "GO:0007018", "GO:0008150", "GO:0009987", "GO:0032886", "GO:0050789", "GO:0050794", "GO:0060632", "GO:0065007" ]
[ "GO:0003341", "GO:0003352", "GO:0003356", "GO:0007017", "GO:0007018", "GO:0008150", "GO:0009987", "GO:0032886", "GO:0050789", "GO:0050794", "GO:0060632", "GO:0065007" ]
[]
[]
AF-Q567I9-F1-model_v6.pdb
7955.ENSDARP00000072883
[ "F1RC30", "F1QGB9", "F1QTK3", "F1QV44", "F1QWI3", "F1Q6H8", "A0A0R4IKF7", "F1QUA2", "Q502I6" ]
[ "IPR052320", "IPR036400", "IPR001199" ]
{"IPR036400": [1, 99], "IPR052320": [2, 213], "IPR001199": [4, 79]}
- Intelectin 2 - Cilia and flagella-associated protein 58 - Cytochrome b5 reductase 4 - Axonemal dynein light intermediate polypeptide 1 - Sulfite oxidase, mitochondrial
- IPR052320: Cytochrome b5 domain-containing (family) [2-213] - IPR036400: Cytochrome b5-like heme/steroid binding domain superfamily (homologous_superfamily) [1-99] - IPR001199: Cytochrome b5-like heme/steroid binding domain (domain) [4-79]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0016491 (oxidoreductase activity), GO:0003676 (nucleic acid binding), GO:0016705 (oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen), GO:0003723 (RNA binding), GO:0016717 (oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water) Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biological regulation), GO:0050896 (response to stimulus), GO:0050789 (regulation of biological process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO:0032502 (developmental process), GO:0009987 (cellular process), GO:0048519 (negative regulation of biological process), GO:0032501 (multicellular organismal process), GO:0009605 (response to external stimulus), GO:0048869 (cellular developmental process), GO:0048856 (anatomical structure development), GO:0007275 (multicellular organism development), GO:0009653 (anatomical structure morphogenesis), GO:0009607 (response to biotic stimulus), GO:0050794 (regulation of cellular process), GO:0006950 (response to stress), GO:0048523 (negative regulation of cellular process), GO:0051707 (response to other organism), GO:0009887 (animal organ morphogenesis), GO:0048598 (embryonic morphogenesis), GO:0043207 (response to external biotic stimulus), GO:0009888 (tissue development), GO:0048468 (cell development), GO:0030154 (cell differentiation), GO:0060042 (retina morphogenesis in camera-type eye), GO:0048731 (system development), GO:0048513 (animal organ development), GO:0006952 (defense response), GO:0009790 (embryo development), GO:0009615 (response to virus), GO:0098542 (defense response to other organism), GO:0048703 (embryonic viscerocranium morphogenesis), GO:0048863 (stem cell differentiation), GO:0048864 (stem cell development), GO:0048705 (skeletal system morphogenesis), GO:0048568 (embryonic organ development), GO:0001501 (skeletal system development), GO:0048562 (embryonic organ morphogenesis), GO:0048880 (sensory system development), GO:0042742 (defense response to bacterium), GO:0007423 (sensory organ development), GO:0090596 (sensory organ morphogenesis), GO:0060485 (mesenchyme development), GO:0048762 (mesenchymal cell differentiation), GO:0009792 (embryo development ending in birth or egg hatching), GO:0014033 (neural crest cell differentiation), GO:0048925 (lateral line system development), GO:0043009 (chordate embryonic development), GO:0048592 (eye morphogenesis), GO:0001654 (eye development), GO:0048704 (embryonic skeletal system morphogenesis), GO:0014032 (neural crest cell development), GO:0048884 (neuromast development), GO:0150063 (visual system development), GO:0048706 (embryonic skeletal system development), GO:0043010 (camera-type eye development), GO:0048593 (camera-type eye morphogenesis) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0030017 (sarcomere), GO:0031674 (I band), GO:0030018 (Z disc), GO:0005737 (cytoplasm), GO:0099080 (supramolecular complex), GO:0099081 (supramolecular polymer), GO:0043292 (contractile fiber), GO:0043229 (intracellular organelle), GO:0043228 (non-membrane-bounded organelle), GO:0099512 (supramolecular fiber), GO:0030016 (myofibril), GO:0043232 (intracellular non-membrane-bounded organelle)
Q5A1E3
Transcriptional regulator CBF1
Transcription factor that binds ribosomal protein gene promoters and rDNA locus with TBF1. Necessary for the expression of genes involved in assimilation of inorganic sulfate. Also required for the expression of respiratory genes and glycolytic genes. Does not bind to centromeres and is not necessary for efficient chromosome segregationas as does S.cerevisiae CBF1
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
251
Nucleus
MVKSHKRTLEKDEEHQEKKKANKISKDDMEIDAELLTQQASDSAHTDTATAAVAAVNNEQGKELEQTESSTNQTSALDKDDKETKDNLNPREETQSSHQEIDIPKDQLTNQQNLADQHQQYQYHQQLAQTNFKTEPTNSAKPPHGSEEWHRQRRENHKEVERKRRESINTGIRELARLIPTTDTNKAQILQRAVEYIKRLKENENNNIEKWTLEKLLTEQAVSELSASNEKLKHELESAYREIEQLKRGKK
[ "GO:0000070", "GO:0000096", "GO:0000097", "GO:0000103", "GO:0000278", "GO:0000280", "GO:0000819", "GO:0006082", "GO:0006139", "GO:0006351", "GO:0006520", "GO:0006555", "GO:0006790", "GO:0006996", "GO:0007049", "GO:0007059", "GO:0008150", "GO:0008152", "GO:0008652", "GO:0009058"...
[ "GO:0000070", "GO:0000096", "GO:0000097", "GO:0000103", "GO:0000278", "GO:0000280", "GO:0000819", "GO:0006082", "GO:0006139", "GO:0006351", "GO:0006520", "GO:0006555", "GO:0006790", "GO:0006996", "GO:0007049", "GO:0007059", "GO:0008150", "GO:0008152", "GO:0008652", "GO:0009058"...
[ "GO:0003674", "GO:0003676", "GO:0003677", "GO:0003690", "GO:0003700", "GO:0005488", "GO:0019237", "GO:0043565", "GO:0140110", "GO:1990837" ]
[ "GO:0000785", "GO:0005575", "GO:0005622", "GO:0005694", "GO:0043226", "GO:0043228", "GO:0043229", "GO:0043232", "GO:0110165" ]
AF-Q5A1E3-F1-model_v6.pdb
237561.Q5A1E3
[ "Q59LN9", "A0A1D8PQN4", "Q5A5T7" ]
[ "IPR036638", "IPR011598", "IPR047206" ]
{"IPR036638": [143, 210], "IPR047206": [147, 233], "IPR011598": [152, 206]}
- Met28p - Met4p - Histone H3-like centromeric protein CSE4
- IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [143-210] - IPR011598: Myc-type, basic helix-loop-helix (bHLH) domain (domain) [152-206] - IPR047206: Centromere-binding protein 1-like, bHLHzip domain (domain) [147-233]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0097159 (organic cyclic compound binding), GO:0003700 (DNA-binding transcription factor activity), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding), GO:0043565 (sequence-specific DNA binding) Biological Process (BP): GO:0008150 (biological process), GO:0040007 (growth), GO:0009987 (cellular process), GO:0050896 (response to stimulus), GO:0009605 (response to external stimulus), GO:0051716 (cellular response to stimulus), GO:0030447 (filamentous growth), GO:0006950 (response to stress), GO:0009607 (response to biotic stimulus), GO:0007154 (cell communication), GO:0009991 (response to extracellular stimulus), GO:0031668 (cellular response to extracellular stimulus), GO:0044182 (filamentous growth of a population of unicellular organisms), GO:0036180 (filamentous growth of a population of unicellular organisms in response to biotic stimulus), GO:0042594 (response to starvation), GO:0071496 (cellular response to external stimulus), GO:0033554 (cellular response to stress), GO:0036170 (filamentous growth of a population of unicellular organisms in response to starvation), GO:0009267 (cellular response to starvation), GO:0031669 (cellular response to nutrient levels), GO:0031667 (response to nutrient levels) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0005622 (intracellular anatomical structure), GO:0043226 (organelle), GO:0043229 (intracellular organelle), GO:0043227 (membrane-bounded organelle), GO:0043231 (intracellular membrane-bounded organelle), GO:0005634 (nucleus)
P31225
Corticosteroid-binding protein
May be a flavoprotein with enzymatic activity
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
489
null
MSRTKSTKVLIIGAGVSGLKAAETILSKSFLTGDDVLVVEAQNRIGGRLKTTDTSQSKLGINYDLGASWFHDSLNNIVLNHMINDGLLDDEKDVYFDDKDLKTFSSTGEVPIVDKKLNRVLEDIEKYIQLYFNRNLGVPDLSLRDIVAQYFEKYNRLITEEQREYCGRMMRYLEFWFGISWDRISGKYAVTTHQGRNLLNKKGYGYLVESLAKRIPESSLLLEEPVNKIIRNNKDAGKRVLVETINGLQIFCDYLIVTVPQSILSLEESSPYSIKWEPKLPQRLVESINSIHFGALGKVIFEFDRIFWDNSKDRFQIIADHTDGDLSRELTELPKPFTYPLFAVNFGRVHNGKASLVILTQAPLTNYLETHPDQAWQYYQPMLQKLSINDEPIPDPINTIVTDWTTNPYIRGSYSTMYTNDDPSDLIISLSGDFEDLGISEPYIKFAGEHTTSEGTGCVHGAYMSGIYAADCILENIFRNDVTGYTIIG
[ "GO:0005575", "GO:0030312", "GO:0031012", "GO:0062039", "GO:0062040", "GO:0071944", "GO:0110165", "GO:0140047" ]
[]
[]
[ "GO:0005575", "GO:0030312", "GO:0031012", "GO:0062039", "GO:0062040", "GO:0071944", "GO:0110165", "GO:0140047" ]
AF-P31225-F1-model_v6.pdb
237561.P31225
[ "Q5AH20", "A0A1D8PLL0", "Q59KV5", "A0A1D8PLN0", "A0A1D8PPP3", "Q59Z50", "Q5AL17", "Q5ABD8", "Q5A0M7", "A0A1D8PSW6", "Q5AMQ8", "Q5ANN8", "A0A1D8PC76", "A0A1D8PGT5" ]
[ "IPR036188", "IPR002937", "IPR050281" ]
{"IPR036188": [4, 475], "IPR050281": [7, 477], "IPR002937": [16, 474]}
- Ornithine decarboxylase - Spermidine synthase - Aldehyde dehydrogenase domain-containing protein - Aldehyde dehydrogenase - Agmatinase - Afp99p - Spermine synthase - Amine oxidase - Amine oxidase - Polyamine oxidase
- IPR036188: FAD/NAD(P)-binding domain superfamily (homologous_superfamily) [4-475] - IPR002937: Amine oxidase (domain) [16-474] - IPR050281: Flavin monoamine oxidase and related enzymes (family) [7-477]
Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:0008289 (lipid binding), GO:0005496 (steroid binding) Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009056 (catabolic process), GO:0071704 (organic substance metabolic process), GO:0006807 (nitrogen compound metabolic process), GO:1901575 (organic substance catabolic process), GO:1901564 (organonitrogen compound metabolic process), GO:0009308 (amine metabolic process), GO:1901565 (organonitrogen compound catabolic process), GO:0006576 (biogenic amine metabolic process), GO:0009310 (amine catabolic process), GO:0006595 (polyamine metabolic process), GO:0042402 (cellular biogenic amine catabolic process), GO:0006598 (polyamine catabolic process) Cellular Component (CC): GO:0005575 (cellular component), GO:0110165 (cellular anatomical entity), GO:0071944 (cell periphery), GO:0030312 (external encapsulating structure), GO:0031012 (extracellular matrix), GO:0062039 (biofilm matrix), GO:0062040 (fungal biofilm matrix)