SynCodonLM-V2 / README.md
jheuschkel's picture
Update README.md
d40173d verified
metadata
license: apache-2.0
datasets:
  - jheuschkel/clustered-cds-dataset
language:
  - en
pipeline_tag: fill-mask
tags:
  - codon
  - Codon
  - biology
  - synthetic
  - dna
  - mrna
  - optimization
  - codon-optimization
  - codon-embedding
  - codon-representation
  - codon-language-model
  - codon-language
misc:
  - codon

Model Card for SynCodonLM


Installation

git clone https://github.com/Boehringer-Ingelheim/SynCodonLM.git
cd SynCodonLM
pip install -r requirements.txt #maybe not neccesary depending on your env :)

Usage

SynCodonLM uses token-type ID's to add species-specific codon sontext to it's thinking.

Before use, find the token type ID (species_token_type) for your species of interest here!
Or use our list of model organisms below

Embedding a Coding DNA Sequence

from SynCodonLM import CodonEmbeddings

model = CodonEmbeddings() #this loads the model & tokenizer using our built-in functions

seq = 'ATGTCCACCGGGCGGTGA'

mean_pooled_embedding = model.get_mean_embedding(seq, species_token_type=30) #E. coli
#returns --> tensor of shape [768]

raw_output = model.get_raw_embeddings(seq, species_token_type=67) #E. coli
raw_embedding_final_layer = raw_output.hidden_states[-1] #treat this like a typical Hugging Face model dictionary based output!
#returns --> tensor of shape [batch size (1), sequence length, 768]

Codon Optimizing a Protein Sequence

This has not yet been rigourosly evaluated, although we can confidently say it will generate 'natural looking' coding-DNA sequences.
from SynCodonLM import CodonOptimizer

optimizer = CodonOptimizer() #this loads the model & tokenizer using our built-in functions

result = optimizer.optimize(
    protein_sequence="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK", #GFP 
    species_token_type=30, #E. coli
    deterministic=True #true by default
)
codon_optimized_sequence = result.sequence

Citation

If you use this work, please cite:

@article {Heuschkel2025.08.19.671089,
    author = {Heuschkel, James and Kingsley, Laura and Pefaur, Noah and Nixon, Andrew and Cramer, Steven},
    title = {Advancing Codon Language Modeling with Synonymous Codon Constrained Masking},
    elocation-id = {2025.08.19.671089},
    year = {2025},
    doi = {10.1101/2025.08.19.671089},
    publisher = {Cold Spring Harbor Laboratory},
    abstract = {Codon language models offer a promising framework for modeling protein-coding DNA sequences, yet current approaches often conflate codon usage with amino acid semantics, limiting their ability to capture DNA-level biology. We introduce SynCodonLM, a codon language model that enforces a biologically grounded constraint: masked codons are only predicted from synonymous options, guided by the known protein sequence. This design disentangles codon-level from protein-level semantics, enabling the model to learn nucleotide-specific patterns. The constraint is implemented by masking non-synonymous codons from the prediction space prior to softmax. Unlike existing models, which cluster codons by amino acid identity, SynCodonLM clusters by nucleotide properties, revealing structure aligned with DNA-level biology. Furthermore, SynCodonLM outperforms existing models on 6 of 7 benchmarks sensitive to DNA-level features, including mRNA and protein expression. Our approach advances domain-specific representation learning and opens avenues for sequence design in synthetic biology, as well as deeper insights into diverse bioprocesses.Competing Interest StatementThe authors have declared no competing interest.},
    URL = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089},
    eprint = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089.full.pdf},
    journal = {bioRxiv}
}

Model Organisms Species Token Type IDs

Organism Token-Type ID
E. coli 30
S. cerevisiae 118
C. elegans 212
D. melanogaster 190
D. rerio 428
M. musculus 368
A. thaliana 258
H. sapiens 373
C. griseus 345