progen2-large / README.md
ZhiyuanChen's picture
Upload folder using huggingface_hub
bfe2230 verified
metadata
datasets:
  - multimolecule/uniref
  - multimolecule/bfd
  - multimolecule/oas
library_name: multimolecule
license: agpl-3.0
pipeline_tag: text-generation
tags:
  - Biology
  - Protein
widget:
  - example_title: prion protein (Kanno blood group)
    expected_suffix: G
    output:
      text: >-
        MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIV
        S T A Q K Q T L T A L N A A - K L T L L Q Q L L J H A L J S J L A - M Q
        Q S H J L V S H V R I V
    pipeline_tag: text-generation
    sequence_type: Protein
    task: text-generation
    text: >-
      MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIV
  - example_title: interleukin 10
    expected_suffix: 'N'
    output:
      text: >-
        MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR
        K A S A S S H V E S K J - L A T A E V N A S S G - L - A - T T L A L R N
        G A - J A V Y L V V S T S
    pipeline_tag: text-generation
    sequence_type: Protein
    task: text-generation
    text: >-
      MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR
  - example_title: Zaire ebolavirus
    expected_suffix: 'Y'
    output:
      text: >-
        NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQC
        S A I A E S A - Y A A J Q M A V T E H L D S J L Q H A E A E R K G L E A
        A Q L M A D L V G T A A V
    pipeline_tag: text-generation
    sequence_type: Protein
    task: text-generation
    text: >-
      NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQC
  - example_title: SARS coronavirus
    expected_suffix: S
    output:
      text: >-
        MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFDNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFKCTFEYI
        V A A A A G T T A K A A L K E A K J K E A T S S S - W A A A S J Q L A A
        J D A A R E Q S T A S V
    pipeline_tag: text-generation
    sequence_type: Protein
    task: text-generation
    text: >-
      MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFDNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFKCTFEYI

ProGen2

Pre-trained model on protein sequences using a causal language modeling (CLM) objective.

Disclaimer

This is an UNOFFICIAL implementation of the ProGen2: Exploring the Boundaries of Protein Language Models by Erik Nijkamp, Jeffrey A. Ruffolo, et al.

The OFFICIAL repository of ProGen2 is at enijkamp/progen.

The MultiMolecule team has confirmed that the provided model and checkpoints are producing the same intermediate representations as the original implementation.

The team releasing ProGen2 did not write this model card for this model so this model card has been written by the MultiMolecule team.

Model Details

ProGen2 is a GPT-J-style model pre-trained on a large corpus of protein sequences in a self-supervised fashion. This means that the model was trained on the raw amino acids of protein sequences only, with an automatic process to generate inputs and labels from those sequences. Please refer to the Training Details section for more information on the training process.

Variants

Model Specification

Variants Num Layers Hidden Size Num Heads Intermediate Size Num Parameters (M) FLOPs (G) MACs (G) Context Length
ProGen2-xlarge 32 4096 16 16384 6443.66 6735.76 3367.27 1024
ProGen2-large 2560 32 10240 2517.34 2664.21 1331.45
ProGen2-bfd90
ProGen2-base 27 1536 16 6144 764.81 826.85 413.12 2048
ProGen2-oas 1024
ProGen2-medium
ProGen2-small 12 1024 4096 151.15 167.74 83.75

Links

Usage

The model file depends on the multimolecule library. You can install it using pip:

pip install multimolecule

Direct Use

Text Generation

You can use this model directly with a pipeline for text generation:

import multimolecule  # you must import multimolecule to register models
from transformers import pipeline

generator = pipeline("text-generation", model="multimolecule/progen2-large")
output = generator("MGHGVSRPPVVTLR", max_new_tokens=50)

Downstream Use

Extract Features

Here is how to use this model to get the features of a given sequence in PyTorch:

from multimolecule import ProteinTokenizer, ProGen2Model


tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-large")
model = ProGen2Model.from_pretrained("multimolecule/progen2-large")

text = "MGHGVSRPPVVTLRPAVLDDCPVLWR"
input = tokenizer(text, return_tensors="pt")

output = model(**input)

Sequence Classification / Regression

This model is not fine-tuned for any specific task. You will need to fine-tune the model on a downstream task to use it for sequence classification or regression.

Here is how to use this model as backbone to fine-tune for a sequence-level task in PyTorch:

import torch
from multimolecule import ProteinTokenizer, ProGen2ForSequencePrediction


tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-large")
model = ProGen2ForSequencePrediction.from_pretrained("multimolecule/progen2-large")

text = "MGHGVSRPPVVTLRPAVLDDCPVLWR"
input = tokenizer(text, return_tensors="pt")
label = torch.tensor([1])

output = model(**input, labels=label)

Token Classification / Regression

This model is not fine-tuned for any specific task. You will need to fine-tune the model on a downstream task to use it for token classification or regression.

Here is how to use this model as backbone to fine-tune for a residue-level task in PyTorch:

import torch
from multimolecule import ProteinTokenizer, ProGen2ForTokenPrediction


tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-large")
model = ProGen2ForTokenPrediction.from_pretrained("multimolecule/progen2-large")

text = "MGHGVSRPPVVTLRPAVLDDCPVLWR"
input = tokenizer(text, return_tensors="pt")
label = torch.randint(2, (len(text), ))

output = model(**input, labels=label)

Training Details

ProGen2 used Causal Language Modeling (CLM) as the pre-training objective: given a protein sequence, the model is trained to predict the next amino acid token autoregressively.

Training Data

The ProGen2 models were pre-trained on protein sequence databases:

  • Uniref90: A clustered version of the UniProt database at 90% sequence identity, containing approximately 135 million sequences.
  • BFD30: The Big Fantastic Database clustered at 30% sequence identity, approximately one-third the size of Uniref90.
  • BFD90: The Big Fantastic Database clustered at 90% sequence identity, approximately twice the size of Uniref90.
  • OAS: The Observed Antibody Space database, clustered at 85% sequence identity.

Different model variants were trained on different combinations:

  • progen2-small, progen2-medium, progen2-base, progen2-large, progen2-xlarge: Trained on Uniref90 and BFD30.
  • progen2-bfd90: Trained on Uniref90 and BFD90.
  • progen2-oas: Trained on the OAS database.

Training Procedure

ProGen2 used causal language modeling (CLM) as the pre-training objective.

Pre-training

The model was trained on Google TPU-v3 pods using JAX.

  • Batch size: 500,000 -- 1,000,000
  • Steps: 350,000 -- 400,000
  • Optimizer: Adam(β1=0.9, β2=0.999, ε=1e-8)
  • Learning rate: 1e-5 -- 6e-4
  • Learning rate scheduler: Cosine
  • Learning rate warm-up: 3,000 -- 10,000 steps
  • Weight decay: 0.1
  • Maximum Gradient Norm: 0.8 -- 1.0

Citation

BibTeX:

@ARTICLE{Nijkamp2023-jz,
  title     = "{ProGen2}: Exploring the boundaries of protein language models",
  author    = "Nijkamp, Erik and Ruffolo, Jeffrey A and Weinstein, Eli N and
               Naik, Nikhil and Madani, Ali",
  abstract  = "Attention-based models trained on protein sequences have
               demonstrated incredible success at classification and generation
               tasks relevant for artificial-intelligence-driven protein
               design. However, we lack a sufficient understanding of how very
               large-scale models and data play a role in effective protein
               model development. We introduce a suite of protein language
               models, named ProGen2, that are scaled up to 6.4B parameters and
               trained on different sequence datasets drawn from over a billion
               proteins from genomic, metagenomic, and immune repertoire
               databases. ProGen2 models show state-of-the-art performance in
               capturing the distribution of observed evolutionary sequences,
               generating novel viable sequences, and predicting protein
               fitness without additional fine-tuning. As large model sizes and
               raw numbers of protein sequences continue to become more widely
               accessible, our results suggest that a growing emphasis needs to
               be placed on the data distribution provided to a protein
               sequence model. Our models and code are open sourced for
               widespread adoption in protein engineering. A record of this
               paper's Transparent Peer Review process is included in the
               supplemental information.",
  journal   = "Cell Syst.",
  publisher = "Elsevier BV",
  volume    =  14,
  number    =  11,
  pages     = "968--978.e3",
  month     =  nov,
  year      =  2023,
  keywords  = "fitness prediction; language modeling; protein design",
  copyright = "http://www.elsevier.com/open-access/userlicense/1.0/",
  language  = "en"
}

The artifacts distributed in this repository are part of the MultiMolecule project. If you use MultiMolecule in your research, you must cite the MultiMolecule project as follows:

@software{chen_2024_12638419,
  author    = {Chen, Zhiyuan and Zhu, Sophia Y.},
  title     = {MultiMolecule},
  doi       = {10.5281/zenodo.12638419},
  publisher = {Zenodo},
  url       = {https://doi.org/10.5281/zenodo.12638419},
  year      = 2024,
  month     = may,
  day       = 4
}

Contact

Please use GitHub issues of MultiMolecule for any questions or comments on the model card.

Please contact the authors of the ProGen2 paper for questions or comments on the paper/model.

License

This model is licensed under the GNU Affero General Public License.

For additional terms and clarifications, please refer to our License FAQ.

SPDX-License-Identifier: AGPL-3.0-or-later