contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
194
A
Exams
PROGRAMMING
900
[ "implementation", "math" ]
null
null
One day the Codeforces round author sat exams. He had *n* exams and he needed to get an integer from 2 to 5 for each exam. He will have to re-sit each failed exam, i.e. the exam that gets mark 2. The author would need to spend too much time and effort to make the sum of his marks strictly more than *k*. That could have spoilt the Codeforces round. On the other hand, if the sum of his marks is strictly less than *k*, the author's mum won't be pleased at all. The Codeforces authors are very smart and they always get the mark they choose themselves. Also, the Codeforces authors just hate re-sitting exams. Help the author and find the minimum number of exams he will have to re-sit if he passes the exams in the way that makes the sum of marks for all *n* exams equal exactly *k*.
The single input line contains space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=250) — the number of exams and the required sum of marks. It is guaranteed that there exists a way to pass *n* exams in the way that makes the sum of marks equal exactly *k*.
Print the single number — the minimum number of exams that the author will get a 2 for, considering that the sum of marks for all exams must equal *k*.
[ "4 8\n", "4 10\n", "1 3\n" ]
[ "4\n", "2\n", "0\n" ]
In the first sample the author has to get a 2 for all his exams. In the second sample he should get a 3 for two exams and a 2 for two more. In the third sample he should get a 3 for one exam.
500
[ { "input": "4 8", "output": "4" }, { "input": "4 10", "output": "2" }, { "input": "1 3", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "4 9", "output": "3" }, { "input": "50 234", "output": "0" }, { "input": "50 100", "output": "50" }, { "input": "50 250", "output": "0" }, { "input": "29 116", "output": "0" }, { "input": "20 69", "output": "0" }, { "input": "46 127", "output": "11" }, { "input": "3 7", "output": "2" }, { "input": "36 99", "output": "9" }, { "input": "45 104", "output": "31" }, { "input": "13 57", "output": "0" }, { "input": "25 106", "output": "0" }, { "input": "8 19", "output": "5" }, { "input": "20 69", "output": "0" }, { "input": "13 32", "output": "7" }, { "input": "47 128", "output": "13" }, { "input": "17 73", "output": "0" }, { "input": "3 7", "output": "2" }, { "input": "16 70", "output": "0" }, { "input": "1 5", "output": "0" }, { "input": "38 137", "output": "0" }, { "input": "7 20", "output": "1" }, { "input": "1 5", "output": "0" }, { "input": "36 155", "output": "0" }, { "input": "5 15", "output": "0" }, { "input": "27 75", "output": "6" }, { "input": "21 73", "output": "0" }, { "input": "2 5", "output": "1" }, { "input": "49 177", "output": "0" }, { "input": "7 20", "output": "1" }, { "input": "44 173", "output": "0" }, { "input": "49 219", "output": "0" }, { "input": "16 70", "output": "0" }, { "input": "10 28", "output": "2" } ]
1,587,381,878
2,147,483,647
PyPy 3
OK
TESTS
38
280
0
n, k = map(int, input().split()) print(n*3-k if k <= n * 3 else 0)
Title: Exams Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day the Codeforces round author sat exams. He had *n* exams and he needed to get an integer from 2 to 5 for each exam. He will have to re-sit each failed exam, i.e. the exam that gets mark 2. The author would need to spend too much time and effort to make the sum of his marks strictly more than *k*. That could have spoilt the Codeforces round. On the other hand, if the sum of his marks is strictly less than *k*, the author's mum won't be pleased at all. The Codeforces authors are very smart and they always get the mark they choose themselves. Also, the Codeforces authors just hate re-sitting exams. Help the author and find the minimum number of exams he will have to re-sit if he passes the exams in the way that makes the sum of marks for all *n* exams equal exactly *k*. Input Specification: The single input line contains space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=250) — the number of exams and the required sum of marks. It is guaranteed that there exists a way to pass *n* exams in the way that makes the sum of marks equal exactly *k*. Output Specification: Print the single number — the minimum number of exams that the author will get a 2 for, considering that the sum of marks for all exams must equal *k*. Demo Input: ['4 8\n', '4 10\n', '1 3\n'] Demo Output: ['4\n', '2\n', '0\n'] Note: In the first sample the author has to get a 2 for all his exams. In the second sample he should get a 3 for two exams and a 2 for two more. In the third sample he should get a 3 for one exam.
```python n, k = map(int, input().split()) print(n*3-k if k <= n * 3 else 0) ```
3
5
D
Follow Traffic Rules
PROGRAMMING
2,100
[ "implementation", "math" ]
D. Follow Traffic Rules
1
64
Everybody knows that the capital of Berland is connected to Bercouver (the Olympic capital) by a direct road. To improve the road's traffic capacity, there was placed just one traffic sign, limiting the maximum speed. Traffic signs in Berland are a bit peculiar, because they limit the speed only at that point on the road where they are placed. Right after passing the sign it is allowed to drive at any speed. It is known that the car of an average Berland citizen has the acceleration (deceleration) speed of *a* km/h2, and has maximum speed of *v* km/h. The road has the length of *l* km, and the speed sign, limiting the speed to *w* km/h, is placed *d* km (1<=≤<=*d*<=&lt;<=*l*) away from the capital of Berland. The car has a zero speed at the beginning of the journey. Find the minimum time that an average Berland citizen will need to get from the capital to Bercouver, if he drives at the optimal speed. The car can enter Bercouver at any speed.
The first line of the input file contains two integer numbers *a* and *v* (1<=≤<=*a*,<=*v*<=≤<=10000). The second line contains three integer numbers *l*, *d* and *w* (2<=≤<=*l*<=≤<=10000; 1<=≤<=*d*<=&lt;<=*l*; 1<=≤<=*w*<=≤<=10000).
Print the answer with at least five digits after the decimal point.
[ "1 1\n2 1 3\n", "5 70\n200 170 40\n" ]
[ "2.500000000000\n", "8.965874696353\n" ]
none
0
[ { "input": "1 1\n2 1 3", "output": "2.500000000000" }, { "input": "5 70\n200 170 40", "output": "8.965874696353" }, { "input": "6 80\n100 50 10", "output": "7.312347829731" }, { "input": "7 80\n100 50 50", "output": "5.345224838248" }, { "input": "8 80\n100 50 199", "output": "5.000000000000" }, { "input": "200 1000\n3 2 1", "output": "0.290249882934" }, { "input": "200 1000\n3 2 10000", "output": "0.173205080757" }, { "input": "200 1000\n1000 500 1023", "output": "3.162277660168" }, { "input": "200 1000\n1000 999 10", "output": "4.482261988326" }, { "input": "20 40\n10000 1 30", "output": "251.000000000000" }, { "input": "20 40\n10000 799 30", "output": "251.125000000000" }, { "input": "20 40\n9958 9799 30", "output": "250.075000000000" }, { "input": "9998 9999\n3 2 1", "output": "0.042231317453" }, { "input": "9998 9999\n3 2 6580", "output": "0.024497347285" }, { "input": "9998 9999\n800 40 10000", "output": "0.400040006001" }, { "input": "9998 9999\n800 516 124", "output": "0.668565367679" }, { "input": "4 120\n5112 3000 130", "output": "57.600000000000" }, { "input": "4 120\n5112 3000 113", "output": "57.702083333333" }, { "input": "9000 1\n10000 9999 1", "output": "10000.000055555556" }, { "input": "2 10000\n270 64 16", "output": "16.431676725155" }, { "input": "2 20\n270 64 16", "output": "18.500000000000" }, { "input": "2 16\n270 64 16", "output": "20.875000000000" }, { "input": "2000 10000\n8000 4000 4000", "output": "2.828427124746" }, { "input": "2000 4000\n8000 4000 4000", "output": "3.000000000000" }, { "input": "2000 10\n8000 4000 4000", "output": "800.002500000000" }, { "input": "7143 4847\n4193 2677 1991", "output": "1.438097228927" }, { "input": "5744 5873\n3706 1656 8898", "output": "1.142252435725" }, { "input": "7992 3250\n9987 6772 5806", "output": "3.276251405251" }, { "input": "240 4275\n6270 1836 6361", "output": "7.228416147400" }, { "input": "5369 9035\n1418 879 3344", "output": "0.726785762909" }, { "input": "7062 9339\n2920 1289 8668", "output": "0.909374070882" }, { "input": "8755 9643\n1193 27 3992", "output": "0.522044043034" }, { "input": "448 3595\n2696 1020 5667", "output": "3.469252698452" }, { "input": "2141 3899\n968 262 991", "output": "0.967126013479" }, { "input": "3834 4202\n2471 607 6315", "output": "1.136044961574" }, { "input": "5527 8154\n3974 3550 1639", "output": "1.555031897139" }, { "input": "7220 8458\n2246 1326 6963", "output": "0.788771617656" }, { "input": "8914 8762\n3749 1899 2287", "output": "1.172208101814" }, { "input": "607 2714\n2021 1483 3963", "output": "2.580499677039" }, { "input": "9788 8432\n2795 2025 3436", "output": "0.863942827831" }, { "input": "26 12\n17 13 29", "output": "1.647435897436" }, { "input": "12 42\n6 5 19", "output": "1.000000000000" }, { "input": "50 22\n42 1 12", "output": "2.129090909091" }, { "input": "38 3\n47 16 4", "output": "15.706140350877" }, { "input": "24 33\n35 2 45", "output": "1.748106060606" }, { "input": "11 13\n24 15 37", "output": "2.437062937063" }, { "input": "49 43\n12 6 30", "output": "0.699854212224" }, { "input": "35 23\n17 12 20", "output": "1.078881987578" }, { "input": "23 4\n5 2 13", "output": "1.336956521739" }, { "input": "8 28\n22 4 29", "output": "2.345207879912" }, { "input": "38 35\n16 12 38", "output": "0.917662935482" }, { "input": "21 41\n26 18 47", "output": "1.573591584939" }, { "input": "2 50\n21 1 6", "output": "4.582575694956" }, { "input": "32 7\n15 6 17", "output": "2.252232142857" }, { "input": "15 13\n10 3 26", "output": "1.202564102564" }, { "input": "46 20\n4 2 35", "output": "0.417028828114" }, { "input": "26 28\n46 9 44", "output": "2.181318681319" }, { "input": "9 35\n41 22 3", "output": "4.577276992968" }, { "input": "39 42\n35 19 12", "output": "1.803482716151" }, { "input": "28 24\n31 13 21", "output": "1.733630952381" } ]
1,628,049,794
4,934
PyPy 3
WRONG_ANSWER
TESTS
1
154
20,172,800
a, v = map(int, input().split()) l, d, w = map(int, input().split()) def getLastT(v1, dist): t1 = (w - v1) / a d1 = 0.5 * a * (t1 ** 2) if d1 >= dist: return (-v1 + (v1 ** 2 + 2 * a * dist) ** 0.5) / a t2 = (dist - d1) / w return t1 + t2 if w >= v: t1 = v / a if 0.5 * a * (t1 ** 2) <= l: t2 = (l - 0.5 * a * (t1 ** 2)) / v else: t1 = (2 * l / a) ** 0.5 t2 = 0 t = t1 + t2 print('{t:.5f}'.format(t = t)) elif (w ** 2) / (2 * a) >= d: t1 = ((2 * d) / a) ** 0.5 v1 = a * t1 t2 = getLastT(v1, l - d) t = t1 + t2 print('{t:.5f}'.format(t = t)) elif (v ** 2 - 0) / (2 * a) + (v ** 2 - w ** 2) / (2 * a) >= d: t2 = -w / a + ((w ** 2) / (2 * (a ** 2)) + d / a) ** 0.5 t1 = w / a + t2 t3 = getLastT(w, l - d) t = t1 + t2 + t3 print('{t:.5f}'.format(t = t)) else: t1 = v / a t3 = (v - w) / a t2 = (d - ((v ** 2 - 0) / (2 * a) + (v ** 2 - w ** 2) / (2 * a))) / v t4 = getLastT(w, l - d) t = t1 + t2 + t3 + t4 print('{t:.5f}'.format(t = t))
Title: Follow Traffic Rules Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Everybody knows that the capital of Berland is connected to Bercouver (the Olympic capital) by a direct road. To improve the road's traffic capacity, there was placed just one traffic sign, limiting the maximum speed. Traffic signs in Berland are a bit peculiar, because they limit the speed only at that point on the road where they are placed. Right after passing the sign it is allowed to drive at any speed. It is known that the car of an average Berland citizen has the acceleration (deceleration) speed of *a* km/h2, and has maximum speed of *v* km/h. The road has the length of *l* km, and the speed sign, limiting the speed to *w* km/h, is placed *d* km (1<=≤<=*d*<=&lt;<=*l*) away from the capital of Berland. The car has a zero speed at the beginning of the journey. Find the minimum time that an average Berland citizen will need to get from the capital to Bercouver, if he drives at the optimal speed. The car can enter Bercouver at any speed. Input Specification: The first line of the input file contains two integer numbers *a* and *v* (1<=≤<=*a*,<=*v*<=≤<=10000). The second line contains three integer numbers *l*, *d* and *w* (2<=≤<=*l*<=≤<=10000; 1<=≤<=*d*<=&lt;<=*l*; 1<=≤<=*w*<=≤<=10000). Output Specification: Print the answer with at least five digits after the decimal point. Demo Input: ['1 1\n2 1 3\n', '5 70\n200 170 40\n'] Demo Output: ['2.500000000000\n', '8.965874696353\n'] Note: none
```python a, v = map(int, input().split()) l, d, w = map(int, input().split()) def getLastT(v1, dist): t1 = (w - v1) / a d1 = 0.5 * a * (t1 ** 2) if d1 >= dist: return (-v1 + (v1 ** 2 + 2 * a * dist) ** 0.5) / a t2 = (dist - d1) / w return t1 + t2 if w >= v: t1 = v / a if 0.5 * a * (t1 ** 2) <= l: t2 = (l - 0.5 * a * (t1 ** 2)) / v else: t1 = (2 * l / a) ** 0.5 t2 = 0 t = t1 + t2 print('{t:.5f}'.format(t = t)) elif (w ** 2) / (2 * a) >= d: t1 = ((2 * d) / a) ** 0.5 v1 = a * t1 t2 = getLastT(v1, l - d) t = t1 + t2 print('{t:.5f}'.format(t = t)) elif (v ** 2 - 0) / (2 * a) + (v ** 2 - w ** 2) / (2 * a) >= d: t2 = -w / a + ((w ** 2) / (2 * (a ** 2)) + d / a) ** 0.5 t1 = w / a + t2 t3 = getLastT(w, l - d) t = t1 + t2 + t3 print('{t:.5f}'.format(t = t)) else: t1 = v / a t3 = (v - w) / a t2 = (d - ((v ** 2 - 0) / (2 * a) + (v ** 2 - w ** 2) / (2 * a))) / v t4 = getLastT(w, l - d) t = t1 + t2 + t3 + t4 print('{t:.5f}'.format(t = t)) ```
0
522
A
Reposts
PROGRAMMING
1,200
[ "*special", "dfs and similar", "dp", "graphs", "trees" ]
null
null
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on. These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed. Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive. We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Print a single integer — the maximum length of a repost chain.
[ "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n", "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n", "1\nSoMeStRaNgEgUe reposted PoLyCaRp\n" ]
[ "6\n", "2\n", "2\n" ]
none
500
[ { "input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya", "output": "6" }, { "input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp", "output": "2" }, { "input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp", "output": "2" }, { "input": "1\niuNtwVf reposted POlYcarP", "output": "2" }, { "input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS", "output": "11" }, { "input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl", "output": "6" }, { "input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj", "output": "9" }, { "input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI", "output": "3" } ]
1,599,741,916
2,147,483,647
PyPy 3
OK
TESTS
36
155
0
n=int(input()) p={'polycarp':1} c=0 for i in range(n): l=[x.lower() for x in input().split()] p[l[0]]=p[l[2]]+1 print(max(p.values()))
Title: Reposts Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on. These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed. Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke. Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive. We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user. Output Specification: Print a single integer — the maximum length of a repost chain. Demo Input: ['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n'] Demo Output: ['6\n', '2\n', '2\n'] Note: none
```python n=int(input()) p={'polycarp':1} c=0 for i in range(n): l=[x.lower() for x in input().split()] p[l[0]]=p[l[2]]+1 print(max(p.values())) ```
3
841
B
Godsend
PROGRAMMING
1,100
[ "games", "math" ]
null
null
Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally?
First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array. Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes).
[ "4\n1 3 2 3\n", "2\n2 2\n" ]
[ "First\n", "Second\n" ]
In first sample first player remove whole array in one move and win. In second sample first player can't make a move and lose.
1,000
[ { "input": "4\n1 3 2 3", "output": "First" }, { "input": "2\n2 2", "output": "Second" }, { "input": "4\n2 4 6 8", "output": "Second" }, { "input": "5\n1 1 1 1 1", "output": "First" }, { "input": "4\n720074544 345031254 849487632 80870826", "output": "Second" }, { "input": "1\n0", "output": "Second" }, { "input": "1\n999999999", "output": "First" }, { "input": "2\n1 999999999", "output": "First" }, { "input": "4\n3 3 4 4", "output": "First" }, { "input": "2\n1 2", "output": "First" }, { "input": "8\n2 2 2 1 1 2 2 2", "output": "First" }, { "input": "5\n3 3 2 2 2", "output": "First" }, { "input": "4\n0 1 1 0", "output": "First" }, { "input": "3\n1 2 2", "output": "First" }, { "input": "6\n2 2 1 1 4 2", "output": "First" }, { "input": "8\n2 2 2 3 3 2 2 2", "output": "First" }, { "input": "4\n2 3 3 4", "output": "First" }, { "input": "10\n2 2 2 2 3 1 2 2 2 2", "output": "First" }, { "input": "6\n2 2 1 1 2 2", "output": "First" }, { "input": "3\n1 1 2", "output": "First" }, { "input": "6\n2 4 3 3 4 6", "output": "First" }, { "input": "6\n4 4 3 3 4 4", "output": "First" }, { "input": "4\n1 1 2 2", "output": "First" }, { "input": "4\n1 3 5 7", "output": "First" }, { "input": "4\n2 1 1 2", "output": "First" }, { "input": "4\n1 3 3 2", "output": "First" }, { "input": "5\n3 2 2 2 2", "output": "First" }, { "input": "3\n2 1 1", "output": "First" }, { "input": "4\n1000000000 1000000000 1000000000 99999999", "output": "First" }, { "input": "4\n2 2 1 1", "output": "First" }, { "input": "5\n2 3 2 3 2", "output": "First" }, { "input": "1\n1", "output": "First" }, { "input": "4\n1000000000 1000000000 1000000000 1", "output": "First" }, { "input": "5\n2 2 2 1 1", "output": "First" }, { "input": "6\n2 1 1 1 1 2", "output": "First" }, { "input": "6\n1 2 2 2 2 1", "output": "First" }, { "input": "11\n2 2 2 2 2 1 2 2 2 2 2", "output": "First" }, { "input": "5\n1 3 2 2 2", "output": "First" }, { "input": "3\n2 3 2", "output": "First" }, { "input": "2\n1 1", "output": "First" }, { "input": "5\n4 4 4 3 3", "output": "First" }, { "input": "5\n3 3 4 4 4", "output": "First" }, { "input": "1\n2", "output": "Second" } ]
1,614,359,003
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
6
2,000
69,222,400
def solve(n, a): if a[0]%2 or a[-1]%2: return "First" for i in range(n): if sum(a[:i])%2 and sum(a[i:])%2: return 'First' return 'Second' n = int(input()) a = list(map(int, input().split())) if sum(a)%2: print('First') else: print(solve(n, a))
Title: Godsend Time Limit: None seconds Memory Limit: None megabytes Problem Description: Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally? Input Specification: First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array. Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109). Output Specification: Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes). Demo Input: ['4\n1 3 2 3\n', '2\n2 2\n'] Demo Output: ['First\n', 'Second\n'] Note: In first sample first player remove whole array in one move and win. In second sample first player can't make a move and lose.
```python def solve(n, a): if a[0]%2 or a[-1]%2: return "First" for i in range(n): if sum(a[:i])%2 and sum(a[i:])%2: return 'First' return 'Second' n = int(input()) a = list(map(int, input().split())) if sum(a)%2: print('First') else: print(solve(n, a)) ```
0
255
D
Mr. Bender and Square
PROGRAMMING
1,800
[ "binary search", "implementation", "math" ]
null
null
Mr. Bender has a digital table of size *n*<=×<=*n*, each cell can be switched on or off. He wants the field to have at least *c* switched on squares. When this condition is fulfilled, Mr Bender will be happy. We'll consider the table rows numbered from top to bottom from 1 to *n*, and the columns — numbered from left to right from 1 to *n*. Initially there is exactly one switched on cell with coordinates (*x*,<=*y*) (*x* is the row number, *y* is the column number), and all other cells are switched off. Then each second we switch on the cells that are off but have the side-adjacent cells that are on. For a cell with coordinates (*x*,<=*y*) the side-adjacent cells are cells with coordinates (*x*<=-<=1,<=*y*), (*x*<=+<=1,<=*y*), (*x*,<=*y*<=-<=1), (*x*,<=*y*<=+<=1). In how many seconds will Mr. Bender get happy?
The first line contains four space-separated integers *n*,<=*x*,<=*y*,<=*c* (1<=≤<=*n*,<=*c*<=≤<=109; 1<=≤<=*x*,<=*y*<=≤<=*n*; *c*<=≤<=*n*2).
In a single line print a single integer — the answer to the problem.
[ "6 4 3 1\n", "9 3 8 10\n" ]
[ "0\n", "2\n" ]
Initially the first test has one painted cell, so the answer is 0. In the second test all events will go as is shown on the figure. <img class="tex-graphics" src="https://espresso.codeforces.com/51bd695513bdc59c6ded01f0d34daa5361285209.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
2,000
[ { "input": "6 4 3 1", "output": "0" }, { "input": "9 3 8 10", "output": "2" }, { "input": "9 4 3 10", "output": "2" }, { "input": "9 8 2 10", "output": "2" }, { "input": "1 1 1 1", "output": "0" }, { "input": "10 7 2 7", "output": "2" }, { "input": "8 2 6 10", "output": "2" }, { "input": "8 1 2 10", "output": "3" }, { "input": "6 1 4 10", "output": "3" }, { "input": "1000000 951981 612086 60277", "output": "174" }, { "input": "1000000 587964 232616 62357", "output": "177" }, { "input": "1000000 948438 69861 89178", "output": "211" }, { "input": "1000000000 504951981 646612086 602763371", "output": "17360" }, { "input": "1000000000 81587964 595232616 623563697", "output": "17657" }, { "input": "1000000000 55 60 715189365", "output": "37707" }, { "input": "1000000000 85 61 857945620", "output": "41279" }, { "input": "1000000000 55 85 423654797", "output": "28970" }, { "input": "1000000000 63 65 384381709", "output": "27600" }, { "input": "1000000000 44 30 891773002", "output": "42159" }, { "input": "1000000000 6 97 272656295", "output": "23250" }, { "input": "1000000000 999999946 999999941 715189365", "output": "37707" }, { "input": "1000000000 999999916 999999940 857945620", "output": "41279" }, { "input": "1000000000 999999946 999999916 423654797", "output": "28970" }, { "input": "1000000000 999999938 999999936 384381709", "output": "27600" }, { "input": "1000000000 55 999999941 715189365", "output": "37707" }, { "input": "1000000000 85 999999940 857945620", "output": "41279" }, { "input": "1000000000 55 999999916 423654797", "output": "28970" }, { "input": "1000000000 63 999999936 384381709", "output": "27600" }, { "input": "1000000000 44 999999971 891773002", "output": "42159" }, { "input": "1000000000 6 999999904 272656295", "output": "23250" }, { "input": "1000000000 999999946 60 715189365", "output": "37707" }, { "input": "1000000000 999999916 61 857945620", "output": "41279" }, { "input": "1000000000 999999946 85 423654797", "output": "28970" }, { "input": "1000000000 999999938 65 384381709", "output": "27600" }, { "input": "1000000000 999999957 30 891773002", "output": "42159" }, { "input": "548813503 532288332 26800940 350552333", "output": "13239" }, { "input": "847251738 695702891 698306947 648440371", "output": "18006" }, { "input": "891773002 152235342 682786380 386554406", "output": "13902" }, { "input": "812168727 57791401 772019566 644719499", "output": "17954" }, { "input": "71036059 25478942 38920202 19135721", "output": "3093" }, { "input": "549 198 8 262611", "output": "635" }, { "input": "848 409 661 620581", "output": "771" }, { "input": "892 364 824 53858", "output": "183" }, { "input": "813 154 643 141422", "output": "299" }, { "input": "72 40 68 849", "output": "25" }, { "input": "958 768 649 298927", "output": "431" }, { "input": "800 305 317 414868", "output": "489" }, { "input": "721 112 687 232556", "output": "556" }, { "input": "522 228 495 74535", "output": "249" }, { "input": "737 231 246 79279", "output": "199" }, { "input": "6 4 3 36", "output": "6" }, { "input": "9 3 8 55", "output": "7" }, { "input": "9 4 3 73", "output": "8" }, { "input": "9 8 2 50", "output": "7" }, { "input": "1 1 1 1", "output": "0" }, { "input": "10 7 2 7", "output": "2" }, { "input": "8 2 6 20", "output": "3" }, { "input": "8 1 2 64", "output": "13" }, { "input": "6 1 4 15", "output": "3" }, { "input": "8 8 3 1", "output": "0" } ]
1,679,952,040
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
7
92
0
n, x, y, c = map(int, input().split()) # Binary search on time lo = 0 hi = n * n while lo < hi: mid = (lo + hi) // 2 # Calculate number of switched on cells after mid seconds switched_on = 1 + (mid * 2 + 1) * mid * 2 // 4 for i in range(1, n+1): for j in range(1, n+1): # Check if cell (i, j) is switched on after mid seconds if (i+j)%2 == (x+y)%2 and abs(i-x) + abs(j-y) <= mid: switched_on += 1 if switched_on >= c: hi = mid else: lo = mid + 1 print(lo)
Title: Mr. Bender and Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Bender has a digital table of size *n*<=×<=*n*, each cell can be switched on or off. He wants the field to have at least *c* switched on squares. When this condition is fulfilled, Mr Bender will be happy. We'll consider the table rows numbered from top to bottom from 1 to *n*, and the columns — numbered from left to right from 1 to *n*. Initially there is exactly one switched on cell with coordinates (*x*,<=*y*) (*x* is the row number, *y* is the column number), and all other cells are switched off. Then each second we switch on the cells that are off but have the side-adjacent cells that are on. For a cell with coordinates (*x*,<=*y*) the side-adjacent cells are cells with coordinates (*x*<=-<=1,<=*y*), (*x*<=+<=1,<=*y*), (*x*,<=*y*<=-<=1), (*x*,<=*y*<=+<=1). In how many seconds will Mr. Bender get happy? Input Specification: The first line contains four space-separated integers *n*,<=*x*,<=*y*,<=*c* (1<=≤<=*n*,<=*c*<=≤<=109; 1<=≤<=*x*,<=*y*<=≤<=*n*; *c*<=≤<=*n*2). Output Specification: In a single line print a single integer — the answer to the problem. Demo Input: ['6 4 3 1\n', '9 3 8 10\n'] Demo Output: ['0\n', '2\n'] Note: Initially the first test has one painted cell, so the answer is 0. In the second test all events will go as is shown on the figure. <img class="tex-graphics" src="https://espresso.codeforces.com/51bd695513bdc59c6ded01f0d34daa5361285209.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python n, x, y, c = map(int, input().split()) # Binary search on time lo = 0 hi = n * n while lo < hi: mid = (lo + hi) // 2 # Calculate number of switched on cells after mid seconds switched_on = 1 + (mid * 2 + 1) * mid * 2 // 4 for i in range(1, n+1): for j in range(1, n+1): # Check if cell (i, j) is switched on after mid seconds if (i+j)%2 == (x+y)%2 and abs(i-x) + abs(j-y) <= mid: switched_on += 1 if switched_on >= c: hi = mid else: lo = mid + 1 print(lo) ```
0
485
A
Factory
PROGRAMMING
1,400
[ "implementation", "math", "matrices" ]
null
null
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory. The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*). Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
[ "1 5\n", "3 6\n" ]
[ "No\n", "Yes\n" ]
none
1,000
[ { "input": "1 5", "output": "No" }, { "input": "3 6", "output": "Yes" }, { "input": "1 8", "output": "Yes" }, { "input": "2 3", "output": "No" }, { "input": "3 24", "output": "Yes" }, { "input": "1 1", "output": "Yes" }, { "input": "100000 100000", "output": "Yes" }, { "input": "1 99989", "output": "No" }, { "input": "512 2", "output": "Yes" }, { "input": "100 24", "output": "No" }, { "input": "1 100000", "output": "No" }, { "input": "100000 1", "output": "Yes" }, { "input": "3 99929", "output": "No" }, { "input": "99961 99971", "output": "No" }, { "input": "1 65536", "output": "Yes" }, { "input": "4 65536", "output": "Yes" }, { "input": "3 65536", "output": "Yes" }, { "input": "32768 65536", "output": "Yes" }, { "input": "65535 65536", "output": "Yes" }, { "input": "1 65535", "output": "No" }, { "input": "98812 100000", "output": "No" }, { "input": "10 5", "output": "Yes" }, { "input": "6 8", "output": "Yes" } ]
1,415,207,775
2,775
Python 3
OK
TESTS
23
93
0
a, m = map(int, input().split()) for i in range(m): b = a % m a += b if b == 0: print("Yes") exit(0) print("No")
Title: Factory Time Limit: None seconds Memory Limit: None megabytes Problem Description: One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory. The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*). Given the number of details *a* on the first day and number *m* check if the production stops at some moment. Input Specification: The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105). Output Specification: Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No". Demo Input: ['1 5\n', '3 6\n'] Demo Output: ['No\n', 'Yes\n'] Note: none
```python a, m = map(int, input().split()) for i in range(m): b = a % m a += b if b == 0: print("Yes") exit(0) print("No") ```
3
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,616,938,068
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
80
216
0
n = int(input()) forces = [list(map(int, input().split(" "))) for x in range(n)] resultant_vector = [0, 0, 0] for i in range(n): resultant_vector = [x + y for x, y in zip(resultant_vector, forces[i])] acting_force = sum(resultant_vector) if(acting_force != 0): print("NO") else: print("YES")
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python n = int(input()) forces = [list(map(int, input().split(" "))) for x in range(n)] resultant_vector = [0, 0, 0] for i in range(n): resultant_vector = [x + y for x, y in zip(resultant_vector, forces[i])] acting_force = sum(resultant_vector) if(acting_force != 0): print("NO") else: print("YES") ```
0
353
A
Domino
PROGRAMMING
1,200
[ "implementation", "math" ]
null
null
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
[ "2\n4 2\n6 4\n", "1\n2 3\n", "3\n1 4\n2 3\n4 4\n" ]
[ "0\n", "-1\n", "1\n" ]
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
500
[ { "input": "2\n4 2\n6 4", "output": "0" }, { "input": "1\n2 3", "output": "-1" }, { "input": "3\n1 4\n2 3\n4 4", "output": "1" }, { "input": "5\n5 4\n5 4\n1 5\n5 5\n3 3", "output": "1" }, { "input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4", "output": "-1" }, { "input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4", "output": "-1" }, { "input": "1\n2 4", "output": "0" }, { "input": "1\n1 1", "output": "-1" }, { "input": "1\n1 2", "output": "-1" }, { "input": "2\n1 1\n3 3", "output": "0" }, { "input": "2\n1 1\n2 2", "output": "-1" }, { "input": "2\n1 1\n1 2", "output": "-1" }, { "input": "5\n1 2\n6 6\n1 1\n3 3\n6 1", "output": "1" }, { "input": "5\n5 4\n2 6\n6 2\n1 4\n6 2", "output": "0" }, { "input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1", "output": "0" }, { "input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5", "output": "-1" }, { "input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1", "output": "1" }, { "input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4", "output": "-1" }, { "input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2", "output": "0" }, { "input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5", "output": "-1" }, { "input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4", "output": "-1" }, { "input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4", "output": "-1" }, { "input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6", "output": "1" }, { "input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5", "output": "1" }, { "input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3", "output": "1" }, { "input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5", "output": "1" }, { "input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5", "output": "-1" }, { "input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6", "output": "-1" }, { "input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1", "output": "-1" }, { "input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6", "output": "-1" }, { "input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4", "output": "1" }, { "input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6", "output": "-1" }, { "input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2", "output": "0" }, { "input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3", "output": "-1" }, { "input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3", "output": "-1" }, { "input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4", "output": "-1" }, { "input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5", "output": "1" }, { "input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1", "output": "1" }, { "input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5", "output": "-1" }, { "input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2", "output": "0" }, { "input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1", "output": "0" }, { "input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2", "output": "1" }, { "input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2", "output": "0" }, { "input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2", "output": "-1" }, { "input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5", "output": "0" }, { "input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1", "output": "-1" }, { "input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5", "output": "-1" }, { "input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3", "output": "-1" }, { "input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5", "output": "0" }, { "input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4", "output": "-1" }, { "input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2", "output": "-1" }, { "input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2", "output": "1" }, { "input": "1\n2 2", "output": "0" }, { "input": "3\n2 4\n6 6\n3 3", "output": "-1" }, { "input": "2\n3 6\n4 1", "output": "1" }, { "input": "3\n1 1\n1 1\n3 3", "output": "-1" }, { "input": "3\n2 3\n1 1\n2 3", "output": "1" }, { "input": "3\n2 2\n2 1\n1 2", "output": "1" }, { "input": "3\n1 1\n1 1\n1 1", "output": "-1" } ]
1,558,019,615
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
7
248
0
n=int(input()) x_arr=[] y_arr=[] for i in range(n): x,y=map(int,input().split()) x_arr.append(x) y_arr.append(y) if (sum(x_arr)%2==0) and (sum(y_arr)%2==0): print(0) elif ((sum(x_arr)%2==0) and (sum(y_arr)%2!=0)) or ((sum(x_arr)%2!=0) and (sum(y_arr)%2==0)): print(-1) else: print(1) # print(c)
Title: Domino Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half. Output Specification: Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1. Demo Input: ['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
```python n=int(input()) x_arr=[] y_arr=[] for i in range(n): x,y=map(int,input().split()) x_arr.append(x) y_arr.append(y) if (sum(x_arr)%2==0) and (sum(y_arr)%2==0): print(0) elif ((sum(x_arr)%2==0) and (sum(y_arr)%2!=0)) or ((sum(x_arr)%2!=0) and (sum(y_arr)%2==0)): print(-1) else: print(1) # print(c) ```
0
116
A
Tram
PROGRAMMING
800
[ "implementation" ]
null
null
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
[ "4\n0 3\n2 5\n4 2\n4 0\n" ]
[ "6\n" ]
For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
500
[ { "input": "4\n0 3\n2 5\n4 2\n4 0", "output": "6" }, { "input": "5\n0 4\n4 6\n6 5\n5 4\n4 0", "output": "6" }, { "input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0", "output": "18" }, { "input": "3\n0 1\n1 1\n1 0", "output": "1" }, { "input": "4\n0 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "3\n0 0\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "5\n0 73\n73 189\n189 766\n766 0\n0 0", "output": "766" }, { "input": "5\n0 0\n0 0\n0 0\n0 1\n1 0", "output": "1" }, { "input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0", "output": "1011" }, { "input": "5\n0 1\n1 2\n2 1\n1 2\n2 0", "output": "2" }, { "input": "5\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0", "output": "22" }, { "input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0", "output": "1776" }, { "input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0", "output": "1016" }, { "input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0", "output": "3" }, { "input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0", "output": "2071" }, { "input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0", "output": "3" }, { "input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0", "output": "1329" }, { "input": "2\n0 863\n863 0", "output": "863" }, { "input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0", "output": "8" }, { "input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0", "output": "11" }, { "input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0", "output": "7" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 900\n900 0", "output": "900" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1000\n1000 0", "output": "1000" }, { "input": "3\n0 802\n175 188\n815 0", "output": "815" }, { "input": "3\n0 910\n910 976\n976 0", "output": "976" }, { "input": "3\n0 2\n2 1\n1 0", "output": "2" } ]
1,696,151,247
2,147,483,647
PyPy 3-64
OK
TESTS
71
186
1,740,800
n = int(input()) minCap = 0 curPass = 0 for i in range(n): a, b = map(int, input().split()) curPass -= a curPass += b minCap =max(minCap, curPass) print(minCap)
Title: Tram Time Limit: None seconds Memory Limit: None megabytes Problem Description: Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram. Input Specification: The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0. Output Specification: Print a single integer denoting the minimum possible capacity of the tram (0 is allowed). Demo Input: ['4\n0 3\n2 5\n4 2\n4 0\n'] Demo Output: ['6\n'] Note: For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
```python n = int(input()) minCap = 0 curPass = 0 for i in range(n): a, b = map(int, input().split()) curPass -= a curPass += b minCap =max(minCap, curPass) print(minCap) ```
3
598
A
Tricky Sum
PROGRAMMING
900
[ "math" ]
null
null
In this problem you are to calculate the sum of all integers from 1 to *n*, but you should take all powers of two with minus in the sum. For example, for *n*<==<=4 the sum is equal to <=-<=1<=-<=2<=+<=3<=-<=4<==<=<=-<=4, because 1, 2 and 4 are 20, 21 and 22 respectively. Calculate the answer for *t* values of *n*.
The first line of the input contains a single integer *t* (1<=≤<=*t*<=≤<=100) — the number of values of *n* to be processed. Each of next *t* lines contains a single integer *n* (1<=≤<=*n*<=≤<=109).
Print the requested sum for each of *t* integers *n* given in the input.
[ "2\n4\n1000000000\n" ]
[ "-4\n499999998352516354\n" ]
The answer for the first sample is explained in the statement.
0
[ { "input": "2\n4\n1000000000", "output": "-4\n499999998352516354" }, { "input": "10\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10", "output": "-1\n-3\n0\n-4\n1\n7\n14\n6\n15\n25" }, { "input": "10\n10\n9\n47\n33\n99\n83\n62\n1\n100\n53", "output": "25\n15\n1002\n435\n4696\n3232\n1827\n-1\n4796\n1305" }, { "input": "100\n901\n712\n3\n677\n652\n757\n963\n134\n205\n888\n847\n283\n591\n984\n1\n61\n540\n986\n950\n729\n104\n244\n500\n461\n251\n685\n631\n803\n526\n600\n1000\n899\n411\n219\n597\n342\n771\n348\n507\n775\n454\n102\n486\n333\n580\n431\n537\n355\n624\n23\n429\n276\n84\n704\n96\n536\n855\n653\n72\n718\n776\n658\n802\n777\n995\n285\n328\n405\n184\n555\n956\n410\n846\n853\n525\n983\n65\n549\n839\n929\n620\n725\n635\n303\n201\n878\n580\n139\n182\n69\n400\n788\n985\n792\n103\n248\n570\n839\n253\n417", "output": "404305\n251782\n0\n227457\n210832\n284857\n462120\n8535\n20605\n392670\n357082\n39164\n172890\n482574\n-1\n1765\n144024\n484545\n449679\n264039\n5206\n29380\n124228\n105469\n31116\n232909\n197350\n320760\n136555\n178254\n498454\n402504\n83644\n23580\n176457\n57631\n295560\n59704\n127756\n298654\n102263\n4999\n117319\n54589\n166444\n92074\n142407\n62168\n192954\n214\n91213\n37204\n3316\n246114\n4402\n141870\n363894\n211485\n2374\n256075\n299430\n214765\n319957\n300207\n493464\n39733\n52934\n81193\n16510\n15..." }, { "input": "1\n16", "output": "74" }, { "input": "60\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457", "output": "144115186196807682\n144115186733678594\n144115186733678595\n499999998352516354\n499999997352516354\n-1\n-3\n0\n-4\n36028796079439874\n36028796347875330\n36028796347875331\n144115186196807682\n144115186733678594\n144115186733678595\n499999998352516354\n499999997352516354\n-1\n-3\n0\n-4\n36028796079439874\n36028796347875330\n36028796347875331\n144115186196807682\n144115186733678594\n144115186733678595\n499999998352516354\n499999997352516354\n-1\n-3\n0\n-4\n36028796079439874\n36028796347875330\n36028796347875..." }, { "input": "13\n1\n19\n31\n19\n19\n92\n74\n69\n32\n32\n91\n42\n73", "output": "-1\n128\n434\n128\n128\n4024\n2521\n2161\n402\n402\n3932\n777\n2447" }, { "input": "1\n16383", "output": "134176770" }, { "input": "16\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100", "output": "5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908" }, { "input": "1\n414234", "output": "85794061921" }, { "input": "1\n414232", "output": "85793233454" }, { "input": "3\n414231\n414231\n414231", "output": "85792819222\n85792819222\n85792819222" }, { "input": "1\n121", "output": "7127" } ]
1,672,670,759
2,147,483,647
PyPy 3
OK
TESTS
21
93
0
from math import log2 for _ in range(int(input())): n = int(input()) q = (n*(n+1))//2 b = 2**(int(log2(n))+1) - 1 print(q-2*b)
Title: Tricky Sum Time Limit: None seconds Memory Limit: None megabytes Problem Description: In this problem you are to calculate the sum of all integers from 1 to *n*, but you should take all powers of two with minus in the sum. For example, for *n*<==<=4 the sum is equal to <=-<=1<=-<=2<=+<=3<=-<=4<==<=<=-<=4, because 1, 2 and 4 are 20, 21 and 22 respectively. Calculate the answer for *t* values of *n*. Input Specification: The first line of the input contains a single integer *t* (1<=≤<=*t*<=≤<=100) — the number of values of *n* to be processed. Each of next *t* lines contains a single integer *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the requested sum for each of *t* integers *n* given in the input. Demo Input: ['2\n4\n1000000000\n'] Demo Output: ['-4\n499999998352516354\n'] Note: The answer for the first sample is explained in the statement.
```python from math import log2 for _ in range(int(input())): n = int(input()) q = (n*(n+1))//2 b = 2**(int(log2(n))+1) - 1 print(q-2*b) ```
3
760
B
Frodo and pillows
PROGRAMMING
1,500
[ "binary search", "greedy" ]
null
null
*n* hobbits are planning to spend the night at Frodo's house. Frodo has *n* beds standing in a row and *m* pillows (*n*<=≤<=*m*). Each hobbit needs a bed and at least one pillow to sleep, however, everyone wants as many pillows as possible. Of course, it's not always possible to share pillows equally, but any hobbit gets hurt if he has at least two pillows less than some of his neighbors have. Frodo will sleep on the *k*-th bed in the row. What is the maximum number of pillows he can have so that every hobbit has at least one pillow, every pillow is given to some hobbit and no one is hurt?
The only line contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=*m*<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of hobbits, the number of pillows and the number of Frodo's bed.
Print single integer — the maximum number of pillows Frodo can have so that no one is hurt.
[ "4 6 2\n", "3 10 3\n", "3 6 1\n" ]
[ "2\n", "4\n", "3\n" ]
In the first example Frodo can have at most two pillows. In this case, he can give two pillows to the hobbit on the first bed, and one pillow to each of the hobbits on the third and the fourth beds. In the second example Frodo can take at most four pillows, giving three pillows to each of the others. In the third example Frodo can take three pillows, giving two pillows to the hobbit in the middle and one pillow to the hobbit on the third bed.
1,000
[ { "input": "4 6 2", "output": "2" }, { "input": "3 10 3", "output": "4" }, { "input": "3 6 1", "output": "3" }, { "input": "3 3 3", "output": "1" }, { "input": "1 1 1", "output": "1" }, { "input": "1 1000000000 1", "output": "1000000000" }, { "input": "100 1000000000 20", "output": "10000034" }, { "input": "1000 1000 994", "output": "1" }, { "input": "100000000 200000000 54345", "output": "10001" }, { "input": "1000000000 1000000000 1", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 500000000", "output": "1" }, { "input": "1000 1000 3", "output": "1" }, { "input": "100000000 200020000 54345", "output": "10001" }, { "input": "100 108037 18", "output": "1115" }, { "input": "100000000 200020001 54345", "output": "10002" }, { "input": "200 6585 2", "output": "112" }, { "input": "30000 30593 5980", "output": "25" }, { "input": "40000 42107 10555", "output": "46" }, { "input": "50003 50921 192", "output": "31" }, { "input": "100000 113611 24910", "output": "117" }, { "input": "1000000 483447163 83104", "output": "21965" }, { "input": "10000000 10021505 600076", "output": "147" }, { "input": "100000000 102144805 2091145", "output": "1465" }, { "input": "1000000000 1000000000 481982093", "output": "1" }, { "input": "100 999973325 5", "output": "9999778" }, { "input": "200 999999109 61", "output": "5000053" }, { "input": "30000 999999384 5488", "output": "43849" }, { "input": "40000 999997662 8976", "output": "38038" }, { "input": "50003 999999649 405", "output": "44320" }, { "input": "100000 999899822 30885", "output": "31624" }, { "input": "1000000 914032367 528790", "output": "30217" }, { "input": "10000000 999617465 673112", "output": "31459" }, { "input": "100000000 993180275 362942", "output": "29887" }, { "input": "1000000000 1000000000 331431458", "output": "1" }, { "input": "100 10466 89", "output": "144" }, { "input": "200 5701 172", "output": "84" }, { "input": "30000 36932 29126", "output": "84" }, { "input": "40000 40771 22564", "output": "28" }, { "input": "50003 51705 49898", "output": "42" }, { "input": "100000 149408 74707", "output": "223" }, { "input": "1000000 194818222 998601", "output": "18389" }, { "input": "10000000 10748901 8882081", "output": "866" }, { "input": "100000000 106296029 98572386", "output": "2510" }, { "input": "1000000000 1000000000 193988157", "output": "1" }, { "input": "100 999981057 92", "output": "9999852" }, { "input": "200 999989691 199", "output": "5000046" }, { "input": "30000 999995411 24509", "output": "43846" }, { "input": "40000 999998466 30827", "output": "37930" }, { "input": "50003 999997857 48387", "output": "43163" }, { "input": "100000 999731886 98615", "output": "43371" }, { "input": "1000000 523220797 654341", "output": "22853" }, { "input": "10000000 999922591 8157724", "output": "31464" }, { "input": "100000000 999834114 93836827", "output": "29998" }, { "input": "1000000000 1000000000 912549504", "output": "1" }, { "input": "1000 97654978 234", "output": "97976" }, { "input": "1000 97654977 234", "output": "97975" }, { "input": "1000234 97653889 1", "output": "13903" }, { "input": "1000234 97653890 1", "output": "13904" }, { "input": "3450234 97656670 3000000", "output": "9707" }, { "input": "3450234 97656669 3000000", "output": "9706" }, { "input": "3 1000000000 2", "output": "333333334" }, { "input": "2 1000000000 1", "output": "500000000" }, { "input": "2 1000000000 2", "output": "500000000" }, { "input": "3 1000000000 1", "output": "333333334" }, { "input": "3 1000000000 3", "output": "333333334" }, { "input": "2 999999999 1", "output": "500000000" }, { "input": "2 999999999 2", "output": "500000000" }, { "input": "1 999999999 1", "output": "999999999" } ]
1,485,540,337
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
5
1,000
4,608,000
import sys input = sys.stdin.readline hobbits,pillows,bedspot = list(map(int, input().split())) pillows -= hobbits counter = 1 bottom = bedspot - 1 top = bedspot while True: cat = top - bottom if cat <=pillows: pillows -= cat counter += 1 else: break if bottom > 0: bottom-=1 if top < hobbits: top+=1 print(counter)
Title: Frodo and pillows Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* hobbits are planning to spend the night at Frodo's house. Frodo has *n* beds standing in a row and *m* pillows (*n*<=≤<=*m*). Each hobbit needs a bed and at least one pillow to sleep, however, everyone wants as many pillows as possible. Of course, it's not always possible to share pillows equally, but any hobbit gets hurt if he has at least two pillows less than some of his neighbors have. Frodo will sleep on the *k*-th bed in the row. What is the maximum number of pillows he can have so that every hobbit has at least one pillow, every pillow is given to some hobbit and no one is hurt? Input Specification: The only line contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=*m*<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of hobbits, the number of pillows and the number of Frodo's bed. Output Specification: Print single integer — the maximum number of pillows Frodo can have so that no one is hurt. Demo Input: ['4 6 2\n', '3 10 3\n', '3 6 1\n'] Demo Output: ['2\n', '4\n', '3\n'] Note: In the first example Frodo can have at most two pillows. In this case, he can give two pillows to the hobbit on the first bed, and one pillow to each of the hobbits on the third and the fourth beds. In the second example Frodo can take at most four pillows, giving three pillows to each of the others. In the third example Frodo can take three pillows, giving two pillows to the hobbit in the middle and one pillow to the hobbit on the third bed.
```python import sys input = sys.stdin.readline hobbits,pillows,bedspot = list(map(int, input().split())) pillows -= hobbits counter = 1 bottom = bedspot - 1 top = bedspot while True: cat = top - bottom if cat <=pillows: pillows -= cat counter += 1 else: break if bottom > 0: bottom-=1 if top < hobbits: top+=1 print(counter) ```
0
237
A
Free Cash
PROGRAMMING
1,000
[ "implementation" ]
null
null
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately. Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe. Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors. Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe. Note that the time is given in the chronological order. All time is given within one 24-hour period.
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
[ "4\n8 0\n8 10\n8 10\n8 45\n", "3\n0 12\n10 11\n22 22\n" ]
[ "2\n", "1\n" ]
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away. In the second sample all visitors will come in different times, so it will be enough one cash.
500
[ { "input": "4\n8 0\n8 10\n8 10\n8 45", "output": "2" }, { "input": "3\n0 12\n10 11\n22 22", "output": "1" }, { "input": "5\n12 8\n15 27\n15 27\n16 2\n19 52", "output": "2" }, { "input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23", "output": "3" }, { "input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6", "output": "3" }, { "input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32", "output": "6" }, { "input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30", "output": "10" }, { "input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20", "output": "8" }, { "input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49", "output": "1" }, { "input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16", "output": "5" }, { "input": "2\n0 24\n1 0", "output": "1" }, { "input": "1\n0 0", "output": "1" }, { "input": "1\n1 5", "output": "1" }, { "input": "1\n1 1", "output": "1" }, { "input": "3\n0 0\n0 0\n0 0", "output": "3" }, { "input": "1\n5 0", "output": "1" }, { "input": "5\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "5" }, { "input": "1\n10 10", "output": "1" }, { "input": "1\n8 0", "output": "1" }, { "input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "10" }, { "input": "2\n0 0\n0 1", "output": "1" }, { "input": "2\n8 5\n8 5", "output": "2" } ]
1,654,955,391
2,147,483,647
Python 3
OK
TESTS
67
498
2,560,000
n = int(input()) a = [] for i in range(n): h, m = map(int, input().split()) a.append(h*60 + m) k = 1 max_k = 1 for i in range(n - 1): if a[i] == a[i+1]: k += 1 if max_k < k: max_k = k else: k = 1 print(max_k)
Title: Free Cash Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately. Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe. Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors. Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe. Note that the time is given in the chronological order. All time is given within one 24-hour period. Output Specification: Print a single integer — the minimum number of cashes, needed to serve all clients next day. Demo Input: ['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away. In the second sample all visitors will come in different times, so it will be enough one cash.
```python n = int(input()) a = [] for i in range(n): h, m = map(int, input().split()) a.append(h*60 + m) k = 1 max_k = 1 for i in range(n - 1): if a[i] == a[i+1]: k += 1 if max_k < k: max_k = k else: k = 1 print(max_k) ```
3
268
C
Beautiful Sets of Points
PROGRAMMING
1,500
[ "constructive algorithms", "implementation" ]
null
null
Manao has invented a new mathematical term — a beautiful set of points. He calls a set of points on a plane beautiful if it meets the following conditions: 1. The coordinates of each point in the set are integers. 1. For any two points from the set, the distance between them is a non-integer. Consider all points (*x*,<=*y*) which satisfy the inequations: 0<=≤<=*x*<=≤<=*n*; 0<=≤<=*y*<=≤<=*m*; *x*<=+<=*y*<=&gt;<=0. Choose their subset of maximum size such that it is also a beautiful set of points.
The single line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
In the first line print a single integer — the size *k* of the found beautiful set. In each of the next *k* lines print a pair of space-separated integers — the *x*- and *y*- coordinates, respectively, of a point from the set. If there are several optimal solutions, you may print any of them.
[ "2 2\n", "4 3\n" ]
[ "3\n0 1\n1 2\n2 0\n", "4\n0 3\n2 1\n3 0\n4 2\n" ]
Consider the first sample. The distance between points (0, 1) and (1, 2) equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bfe16f27ebc966df6f10ba356a1547b6e7242dd7.png" style="max-width: 100.0%;max-height: 100.0%;"/>, between (0, 1) and (2, 0) — <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/23d63d8a57cddda72562a512c05111054cd85870.png" style="max-width: 100.0%;max-height: 100.0%;"/>, between (1, 2) and (2, 0) — <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/23d63d8a57cddda72562a512c05111054cd85870.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Thus, these points form a beautiful set. You cannot form a beautiful set with more than three points out of the given points. Note that this is not the only solution.
1,500
[ { "input": "2 2", "output": "3\n0 1\n1 2\n2 0" }, { "input": "4 3", "output": "4\n0 3\n2 1\n3 0\n4 2" }, { "input": "21 21", "output": "22\n21 0\n20 1\n19 2\n18 3\n17 4\n16 5\n15 6\n14 7\n13 8\n12 9\n11 10\n10 11\n9 12\n8 13\n7 14\n6 15\n5 16\n4 17\n3 18\n2 19\n1 20\n0 21" }, { "input": "10 1", "output": "2\n1 0\n0 1" }, { "input": "4 4", "output": "5\n4 0\n3 1\n2 2\n1 3\n0 4" }, { "input": "1 1", "output": "2\n1 0\n0 1" }, { "input": "5 5", "output": "6\n5 0\n4 1\n3 2\n2 3\n1 4\n0 5" }, { "input": "100 100", "output": "101\n100 0\n99 1\n98 2\n97 3\n96 4\n95 5\n94 6\n93 7\n92 8\n91 9\n90 10\n89 11\n88 12\n87 13\n86 14\n85 15\n84 16\n83 17\n82 18\n81 19\n80 20\n79 21\n78 22\n77 23\n76 24\n75 25\n74 26\n73 27\n72 28\n71 29\n70 30\n69 31\n68 32\n67 33\n66 34\n65 35\n64 36\n63 37\n62 38\n61 39\n60 40\n59 41\n58 42\n57 43\n56 44\n55 45\n54 46\n53 47\n52 48\n51 49\n50 50\n49 51\n48 52\n47 53\n46 54\n45 55\n44 56\n43 57\n42 58\n41 59\n40 60\n39 61\n38 62\n37 63\n36 64\n35 65\n34 66\n33 67\n32 68\n31 69\n30 70\n29 71\n28 72\n27 7..." }, { "input": "96 96", "output": "97\n96 0\n95 1\n94 2\n93 3\n92 4\n91 5\n90 6\n89 7\n88 8\n87 9\n86 10\n85 11\n84 12\n83 13\n82 14\n81 15\n80 16\n79 17\n78 18\n77 19\n76 20\n75 21\n74 22\n73 23\n72 24\n71 25\n70 26\n69 27\n68 28\n67 29\n66 30\n65 31\n64 32\n63 33\n62 34\n61 35\n60 36\n59 37\n58 38\n57 39\n56 40\n55 41\n54 42\n53 43\n52 44\n51 45\n50 46\n49 47\n48 48\n47 49\n46 50\n45 51\n44 52\n43 53\n42 54\n41 55\n40 56\n39 57\n38 58\n37 59\n36 60\n35 61\n34 62\n33 63\n32 64\n31 65\n30 66\n29 67\n28 68\n27 69\n26 70\n25 71\n24 72\n23 73\n..." }, { "input": "99 100", "output": "100\n99 0\n98 1\n97 2\n96 3\n95 4\n94 5\n93 6\n92 7\n91 8\n90 9\n89 10\n88 11\n87 12\n86 13\n85 14\n84 15\n83 16\n82 17\n81 18\n80 19\n79 20\n78 21\n77 22\n76 23\n75 24\n74 25\n73 26\n72 27\n71 28\n70 29\n69 30\n68 31\n67 32\n66 33\n65 34\n64 35\n63 36\n62 37\n61 38\n60 39\n59 40\n58 41\n57 42\n56 43\n55 44\n54 45\n53 46\n52 47\n51 48\n50 49\n49 50\n48 51\n47 52\n46 53\n45 54\n44 55\n43 56\n42 57\n41 58\n40 59\n39 60\n38 61\n37 62\n36 63\n35 64\n34 65\n33 66\n32 67\n31 68\n30 69\n29 70\n28 71\n27 72\n26 73..." }, { "input": "67 58", "output": "59\n58 0\n57 1\n56 2\n55 3\n54 4\n53 5\n52 6\n51 7\n50 8\n49 9\n48 10\n47 11\n46 12\n45 13\n44 14\n43 15\n42 16\n41 17\n40 18\n39 19\n38 20\n37 21\n36 22\n35 23\n34 24\n33 25\n32 26\n31 27\n30 28\n29 29\n28 30\n27 31\n26 32\n25 33\n24 34\n23 35\n22 36\n21 37\n20 38\n19 39\n18 40\n17 41\n16 42\n15 43\n14 44\n13 45\n12 46\n11 47\n10 48\n9 49\n8 50\n7 51\n6 52\n5 53\n4 54\n3 55\n2 56\n1 57\n0 58" }, { "input": "67 59", "output": "60\n59 0\n58 1\n57 2\n56 3\n55 4\n54 5\n53 6\n52 7\n51 8\n50 9\n49 10\n48 11\n47 12\n46 13\n45 14\n44 15\n43 16\n42 17\n41 18\n40 19\n39 20\n38 21\n37 22\n36 23\n35 24\n34 25\n33 26\n32 27\n31 28\n30 29\n29 30\n28 31\n27 32\n26 33\n25 34\n24 35\n23 36\n22 37\n21 38\n20 39\n19 40\n18 41\n17 42\n16 43\n15 44\n14 45\n13 46\n12 47\n11 48\n10 49\n9 50\n8 51\n7 52\n6 53\n5 54\n4 55\n3 56\n2 57\n1 58\n0 59" }, { "input": "80 91", "output": "81\n80 0\n79 1\n78 2\n77 3\n76 4\n75 5\n74 6\n73 7\n72 8\n71 9\n70 10\n69 11\n68 12\n67 13\n66 14\n65 15\n64 16\n63 17\n62 18\n61 19\n60 20\n59 21\n58 22\n57 23\n56 24\n55 25\n54 26\n53 27\n52 28\n51 29\n50 30\n49 31\n48 32\n47 33\n46 34\n45 35\n44 36\n43 37\n42 38\n41 39\n40 40\n39 41\n38 42\n37 43\n36 44\n35 45\n34 46\n33 47\n32 48\n31 49\n30 50\n29 51\n28 52\n27 53\n26 54\n25 55\n24 56\n23 57\n22 58\n21 59\n20 60\n19 61\n18 62\n17 63\n16 64\n15 65\n14 66\n13 67\n12 68\n11 69\n10 70\n9 71\n8 72\n7 73\n6 ..." }, { "input": "100 11", "output": "12\n11 0\n10 1\n9 2\n8 3\n7 4\n6 5\n5 6\n4 7\n3 8\n2 9\n1 10\n0 11" }, { "input": "16 55", "output": "17\n16 0\n15 1\n14 2\n13 3\n12 4\n11 5\n10 6\n9 7\n8 8\n7 9\n6 10\n5 11\n4 12\n3 13\n2 14\n1 15\n0 16" }, { "input": "13 71", "output": "14\n13 0\n12 1\n11 2\n10 3\n9 4\n8 5\n7 6\n6 7\n5 8\n4 9\n3 10\n2 11\n1 12\n0 13" }, { "input": "30 40", "output": "31\n30 0\n29 1\n28 2\n27 3\n26 4\n25 5\n24 6\n23 7\n22 8\n21 9\n20 10\n19 11\n18 12\n17 13\n16 14\n15 15\n14 16\n13 17\n12 18\n11 19\n10 20\n9 21\n8 22\n7 23\n6 24\n5 25\n4 26\n3 27\n2 28\n1 29\n0 30" }, { "input": "77 77", "output": "78\n77 0\n76 1\n75 2\n74 3\n73 4\n72 5\n71 6\n70 7\n69 8\n68 9\n67 10\n66 11\n65 12\n64 13\n63 14\n62 15\n61 16\n60 17\n59 18\n58 19\n57 20\n56 21\n55 22\n54 23\n53 24\n52 25\n51 26\n50 27\n49 28\n48 29\n47 30\n46 31\n45 32\n44 33\n43 34\n42 35\n41 36\n40 37\n39 38\n38 39\n37 40\n36 41\n35 42\n34 43\n33 44\n32 45\n31 46\n30 47\n29 48\n28 49\n27 50\n26 51\n25 52\n24 53\n23 54\n22 55\n21 56\n20 57\n19 58\n18 59\n17 60\n16 61\n15 62\n14 63\n13 64\n12 65\n11 66\n10 67\n9 68\n8 69\n7 70\n6 71\n5 72\n4 73\n3 74\n..." }, { "input": "6 6", "output": "7\n6 0\n5 1\n4 2\n3 3\n2 4\n1 5\n0 6" }, { "input": "37 42", "output": "38\n37 0\n36 1\n35 2\n34 3\n33 4\n32 5\n31 6\n30 7\n29 8\n28 9\n27 10\n26 11\n25 12\n24 13\n23 14\n22 15\n21 16\n20 17\n19 18\n18 19\n17 20\n16 21\n15 22\n14 23\n13 24\n12 25\n11 26\n10 27\n9 28\n8 29\n7 30\n6 31\n5 32\n4 33\n3 34\n2 35\n1 36\n0 37" }, { "input": "88 88", "output": "89\n88 0\n87 1\n86 2\n85 3\n84 4\n83 5\n82 6\n81 7\n80 8\n79 9\n78 10\n77 11\n76 12\n75 13\n74 14\n73 15\n72 16\n71 17\n70 18\n69 19\n68 20\n67 21\n66 22\n65 23\n64 24\n63 25\n62 26\n61 27\n60 28\n59 29\n58 30\n57 31\n56 32\n55 33\n54 34\n53 35\n52 36\n51 37\n50 38\n49 39\n48 40\n47 41\n46 42\n45 43\n44 44\n43 45\n42 46\n41 47\n40 48\n39 49\n38 50\n37 51\n36 52\n35 53\n34 54\n33 55\n32 56\n31 57\n30 58\n29 59\n28 60\n27 61\n26 62\n25 63\n24 64\n23 65\n22 66\n21 67\n20 68\n19 69\n18 70\n17 71\n16 72\n15 73\n..." }, { "input": "95 99", "output": "96\n95 0\n94 1\n93 2\n92 3\n91 4\n90 5\n89 6\n88 7\n87 8\n86 9\n85 10\n84 11\n83 12\n82 13\n81 14\n80 15\n79 16\n78 17\n77 18\n76 19\n75 20\n74 21\n73 22\n72 23\n71 24\n70 25\n69 26\n68 27\n67 28\n66 29\n65 30\n64 31\n63 32\n62 33\n61 34\n60 35\n59 36\n58 37\n57 38\n56 39\n55 40\n54 41\n53 42\n52 43\n51 44\n50 45\n49 46\n48 47\n47 48\n46 49\n45 50\n44 51\n43 52\n42 53\n41 54\n40 55\n39 56\n38 57\n37 58\n36 59\n35 60\n34 61\n33 62\n32 63\n31 64\n30 65\n29 66\n28 67\n27 68\n26 69\n25 70\n24 71\n23 72\n22 73\n..." }, { "input": "93 70", "output": "71\n70 0\n69 1\n68 2\n67 3\n66 4\n65 5\n64 6\n63 7\n62 8\n61 9\n60 10\n59 11\n58 12\n57 13\n56 14\n55 15\n54 16\n53 17\n52 18\n51 19\n50 20\n49 21\n48 22\n47 23\n46 24\n45 25\n44 26\n43 27\n42 28\n41 29\n40 30\n39 31\n38 32\n37 33\n36 34\n35 35\n34 36\n33 37\n32 38\n31 39\n30 40\n29 41\n28 42\n27 43\n26 44\n25 45\n24 46\n23 47\n22 48\n21 49\n20 50\n19 51\n18 52\n17 53\n16 54\n15 55\n14 56\n13 57\n12 58\n11 59\n10 60\n9 61\n8 62\n7 63\n6 64\n5 65\n4 66\n3 67\n2 68\n1 69\n0 70" }, { "input": "4 6", "output": "5\n4 0\n3 1\n2 2\n1 3\n0 4" }, { "input": "1 4", "output": "2\n1 0\n0 1" }, { "input": "2 10", "output": "3\n2 0\n1 1\n0 2" }, { "input": "6 7", "output": "7\n6 0\n5 1\n4 2\n3 3\n2 4\n1 5\n0 6" }, { "input": "28 28", "output": "29\n28 0\n27 1\n26 2\n25 3\n24 4\n23 5\n22 6\n21 7\n20 8\n19 9\n18 10\n17 11\n16 12\n15 13\n14 14\n13 15\n12 16\n11 17\n10 18\n9 19\n8 20\n7 21\n6 22\n5 23\n4 24\n3 25\n2 26\n1 27\n0 28" }, { "input": "10 6", "output": "7\n6 0\n5 1\n4 2\n3 3\n2 4\n1 5\n0 6" }, { "input": "85 48", "output": "49\n48 0\n47 1\n46 2\n45 3\n44 4\n43 5\n42 6\n41 7\n40 8\n39 9\n38 10\n37 11\n36 12\n35 13\n34 14\n33 15\n32 16\n31 17\n30 18\n29 19\n28 20\n27 21\n26 22\n25 23\n24 24\n23 25\n22 26\n21 27\n20 28\n19 29\n18 30\n17 31\n16 32\n15 33\n14 34\n13 35\n12 36\n11 37\n10 38\n9 39\n8 40\n7 41\n6 42\n5 43\n4 44\n3 45\n2 46\n1 47\n0 48" }, { "input": "9 6", "output": "7\n6 0\n5 1\n4 2\n3 3\n2 4\n1 5\n0 6" }, { "input": "2 6", "output": "3\n2 0\n1 1\n0 2" }, { "input": "6 4", "output": "5\n4 0\n3 1\n2 2\n1 3\n0 4" }, { "input": "6 10", "output": "7\n6 0\n5 1\n4 2\n3 3\n2 4\n1 5\n0 6" }, { "input": "16 5", "output": "6\n5 0\n4 1\n3 2\n2 3\n1 4\n0 5" }, { "input": "7 6", "output": "7\n6 0\n5 1\n4 2\n3 3\n2 4\n1 5\n0 6" }, { "input": "3 4", "output": "4\n3 0\n2 1\n1 2\n0 3" }, { "input": "13 18", "output": "14\n13 0\n12 1\n11 2\n10 3\n9 4\n8 5\n7 6\n6 7\n5 8\n4 9\n3 10\n2 11\n1 12\n0 13" }, { "input": "5 100", "output": "6\n5 0\n4 1\n3 2\n2 3\n1 4\n0 5" }, { "input": "11 9", "output": "10\n9 0\n8 1\n7 2\n6 3\n5 4\n4 5\n3 6\n2 7\n1 8\n0 9" }, { "input": "13 13", "output": "14\n13 0\n12 1\n11 2\n10 3\n9 4\n8 5\n7 6\n6 7\n5 8\n4 9\n3 10\n2 11\n1 12\n0 13" }, { "input": "1 5", "output": "2\n1 0\n0 1" }, { "input": "3 19", "output": "4\n3 0\n2 1\n1 2\n0 3" }, { "input": "10 10", "output": "11\n10 0\n9 1\n8 2\n7 3\n6 4\n5 5\n4 6\n3 7\n2 8\n1 9\n0 10" }, { "input": "3 7", "output": "4\n3 0\n2 1\n1 2\n0 3" }, { "input": "98 76", "output": "77\n76 0\n75 1\n74 2\n73 3\n72 4\n71 5\n70 6\n69 7\n68 8\n67 9\n66 10\n65 11\n64 12\n63 13\n62 14\n61 15\n60 16\n59 17\n58 18\n57 19\n56 20\n55 21\n54 22\n53 23\n52 24\n51 25\n50 26\n49 27\n48 28\n47 29\n46 30\n45 31\n44 32\n43 33\n42 34\n41 35\n40 36\n39 37\n38 38\n37 39\n36 40\n35 41\n34 42\n33 43\n32 44\n31 45\n30 46\n29 47\n28 48\n27 49\n26 50\n25 51\n24 52\n23 53\n22 54\n21 55\n20 56\n19 57\n18 58\n17 59\n16 60\n15 61\n14 62\n13 63\n12 64\n11 65\n10 66\n9 67\n8 68\n7 69\n6 70\n5 71\n4 72\n3 73\n2 74\n..." }, { "input": "10 100", "output": "11\n10 0\n9 1\n8 2\n7 3\n6 4\n5 5\n4 6\n3 7\n2 8\n1 9\n0 10" } ]
1,697,356,707
2,147,483,647
Python 3
OK
TESTS
47
92
0
import sys input = lambda:sys.stdin.readline().strip() n,m = map(int,input().split()) x = min(n,m) print(x+1) for i in range(x+1): print(i,x-i)
Title: Beautiful Sets of Points Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao has invented a new mathematical term — a beautiful set of points. He calls a set of points on a plane beautiful if it meets the following conditions: 1. The coordinates of each point in the set are integers. 1. For any two points from the set, the distance between them is a non-integer. Consider all points (*x*,<=*y*) which satisfy the inequations: 0<=≤<=*x*<=≤<=*n*; 0<=≤<=*y*<=≤<=*m*; *x*<=+<=*y*<=&gt;<=0. Choose their subset of maximum size such that it is also a beautiful set of points. Input Specification: The single line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). Output Specification: In the first line print a single integer — the size *k* of the found beautiful set. In each of the next *k* lines print a pair of space-separated integers — the *x*- and *y*- coordinates, respectively, of a point from the set. If there are several optimal solutions, you may print any of them. Demo Input: ['2 2\n', '4 3\n'] Demo Output: ['3\n0 1\n1 2\n2 0\n', '4\n0 3\n2 1\n3 0\n4 2\n'] Note: Consider the first sample. The distance between points (0, 1) and (1, 2) equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bfe16f27ebc966df6f10ba356a1547b6e7242dd7.png" style="max-width: 100.0%;max-height: 100.0%;"/>, between (0, 1) and (2, 0) — <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/23d63d8a57cddda72562a512c05111054cd85870.png" style="max-width: 100.0%;max-height: 100.0%;"/>, between (1, 2) and (2, 0) — <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/23d63d8a57cddda72562a512c05111054cd85870.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Thus, these points form a beautiful set. You cannot form a beautiful set with more than three points out of the given points. Note that this is not the only solution.
```python import sys input = lambda:sys.stdin.readline().strip() n,m = map(int,input().split()) x = min(n,m) print(x+1) for i in range(x+1): print(i,x-i) ```
3
0
none
none
none
0
[ "none" ]
null
null
Leonid wants to become a glass carver (the person who creates beautiful artworks by cutting the glass). He already has a rectangular *w* mm <=×<= *h* mm sheet of glass, a diamond glass cutter and lots of enthusiasm. What he lacks is understanding of what to carve and how. In order not to waste time, he decided to practice the technique of carving. To do this, he makes vertical and horizontal cuts through the entire sheet. This process results in making smaller rectangular fragments of glass. Leonid does not move the newly made glass fragments. In particular, a cut divides each fragment of glass that it goes through into smaller fragments. After each cut Leonid tries to determine what area the largest of the currently available glass fragments has. Since there appear more and more fragments, this question takes him more and more time and distracts him from the fascinating process. Leonid offers to divide the labor — he will cut glass, and you will calculate the area of the maximum fragment after each cut. Do you agree?
The first line contains three integers *w*,<=*h*,<=*n* (2<=≤<=*w*,<=*h*<=≤<=200<=000, 1<=≤<=*n*<=≤<=200<=000). Next *n* lines contain the descriptions of the cuts. Each description has the form *H* *y* or *V* *x*. In the first case Leonid makes the horizontal cut at the distance *y* millimeters (1<=≤<=*y*<=≤<=*h*<=-<=1) from the lower edge of the original sheet of glass. In the second case Leonid makes a vertical cut at distance *x* (1<=≤<=*x*<=≤<=*w*<=-<=1) millimeters from the left edge of the original sheet of glass. It is guaranteed that Leonid won't make two identical cuts.
After each cut print on a single line the area of the maximum available glass fragment in mm2.
[ "4 3 4\nH 2\nV 2\nV 3\nV 1\n", "7 6 5\nH 4\nV 3\nV 5\nH 2\nV 1\n" ]
[ "8\n4\n4\n2\n", "28\n16\n12\n6\n4\n" ]
Picture for the first sample test:
0
[ { "input": "4 3 4\nH 2\nV 2\nV 3\nV 1", "output": "8\n4\n4\n2" }, { "input": "7 6 5\nH 4\nV 3\nV 5\nH 2\nV 1", "output": "28\n16\n12\n6\n4" }, { "input": "2 2 1\nV 1", "output": "2" }, { "input": "2 2 1\nH 1", "output": "2" }, { "input": "2 2 2\nV 1\nH 1", "output": "2\n1" }, { "input": "2 2 2\nH 1\nV 1", "output": "2\n1" }, { "input": "10 10 10\nV 6\nH 8\nV 4\nV 8\nH 2\nH 5\nV 9\nH 7\nH 3\nV 7", "output": "60\n48\n32\n32\n24\n12\n12\n12\n8\n8" }, { "input": "5 15 10\nH 8\nH 9\nV 1\nH 2\nH 6\nH 4\nH 1\nV 2\nH 13\nV 3", "output": "40\n40\n32\n24\n24\n24\n24\n18\n12\n8" }, { "input": "15 5 10\nV 13\nV 10\nV 3\nH 2\nV 9\nV 7\nV 2\nH 1\nV 4\nH 3", "output": "65\n50\n35\n21\n18\n12\n12\n12\n9\n6" }, { "input": "2 3 1\nH 1", "output": "4" }, { "input": "200000 200000 1\nH 1", "output": "39999800000" }, { "input": "2 4 1\nH 2", "output": "4" } ]
1,427,585,384
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
46
0
v_max,h_max,cnt = (int(i) for i in input().split()) v = [0,v_max] h = [0,h_max] for i in range(cnt): dr, l = input().split() l_int = int(l) if dr == 'H': for k in range(1,len(h)): if l > h[k]: h.insert(k-1,l) break h_max = max([h[k]-h[k-1] for k in range(1,len(h))]) else: for k in range(1,len(h)): if l > h[k]: v.insert(k-1,l) break v_max = max([v[k]-v[k-1] for k in range(1,len(v))]) s_max = h_max*v_max print(s_max)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Leonid wants to become a glass carver (the person who creates beautiful artworks by cutting the glass). He already has a rectangular *w* mm <=×<= *h* mm sheet of glass, a diamond glass cutter and lots of enthusiasm. What he lacks is understanding of what to carve and how. In order not to waste time, he decided to practice the technique of carving. To do this, he makes vertical and horizontal cuts through the entire sheet. This process results in making smaller rectangular fragments of glass. Leonid does not move the newly made glass fragments. In particular, a cut divides each fragment of glass that it goes through into smaller fragments. After each cut Leonid tries to determine what area the largest of the currently available glass fragments has. Since there appear more and more fragments, this question takes him more and more time and distracts him from the fascinating process. Leonid offers to divide the labor — he will cut glass, and you will calculate the area of the maximum fragment after each cut. Do you agree? Input Specification: The first line contains three integers *w*,<=*h*,<=*n* (2<=≤<=*w*,<=*h*<=≤<=200<=000, 1<=≤<=*n*<=≤<=200<=000). Next *n* lines contain the descriptions of the cuts. Each description has the form *H* *y* or *V* *x*. In the first case Leonid makes the horizontal cut at the distance *y* millimeters (1<=≤<=*y*<=≤<=*h*<=-<=1) from the lower edge of the original sheet of glass. In the second case Leonid makes a vertical cut at distance *x* (1<=≤<=*x*<=≤<=*w*<=-<=1) millimeters from the left edge of the original sheet of glass. It is guaranteed that Leonid won't make two identical cuts. Output Specification: After each cut print on a single line the area of the maximum available glass fragment in mm2. Demo Input: ['4 3 4\nH 2\nV 2\nV 3\nV 1\n', '7 6 5\nH 4\nV 3\nV 5\nH 2\nV 1\n'] Demo Output: ['8\n4\n4\n2\n', '28\n16\n12\n6\n4\n'] Note: Picture for the first sample test:
```python v_max,h_max,cnt = (int(i) for i in input().split()) v = [0,v_max] h = [0,h_max] for i in range(cnt): dr, l = input().split() l_int = int(l) if dr == 'H': for k in range(1,len(h)): if l > h[k]: h.insert(k-1,l) break h_max = max([h[k]-h[k-1] for k in range(1,len(h))]) else: for k in range(1,len(h)): if l > h[k]: v.insert(k-1,l) break v_max = max([v[k]-v[k-1] for k in range(1,len(v))]) s_max = h_max*v_max print(s_max) ```
-1
133
A
HQ9+
PROGRAMMING
900
[ "implementation" ]
null
null
HQ9+ is a joke programming language which has only four one-character instructions: - "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator. Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored. You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output.
The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive.
Output "YES", if executing the program will produce any output, and "NO" otherwise.
[ "Hi!\n", "Codeforces\n" ]
[ "YES\n", "NO\n" ]
In the first case the program contains only one instruction — "H", which prints "Hello, World!". In the second case none of the program characters are language instructions.
500
[ { "input": "Hi!", "output": "YES" }, { "input": "Codeforces", "output": "NO" }, { "input": "a+b=c", "output": "NO" }, { "input": "hq-lowercase", "output": "NO" }, { "input": "Q", "output": "YES" }, { "input": "9", "output": "YES" }, { "input": "H", "output": "YES" }, { "input": "+", "output": "NO" }, { "input": "~", "output": "NO" }, { "input": "dEHsbM'gS[\\brZ_dpjXw8f?L[4E\"s4Zc9*(,j:>p$}m7HD[_9nOWQ\\uvq2mHWR", "output": "YES" }, { "input": "tt6l=RHOfStm.;Qd$-}zDes*E,.F7qn5-b%HC", "output": "YES" }, { "input": "@F%K2=%RyL/", "output": "NO" }, { "input": "juq)k(FT.^G=G\\zcqnO\"uJIE1_]KFH9S=1c\"mJ;F9F)%>&.WOdp09+k`Yc6}\"6xw,Aos:M\\_^^:xBb[CcsHm?J", "output": "YES" }, { "input": "6G_\"Fq#<AWyHG=Rci1t%#Jc#x<Fpg'N@t%F=``YO7\\Zd;6PkMe<#91YgzTC)", "output": "YES" }, { "input": "Fvg_~wC>SO4lF}*c`Q;mII9E{4.QodbqN]C", "output": "YES" }, { "input": "p-UXsbd&f", "output": "NO" }, { "input": "<]D7NMA)yZe=`?RbP5lsa.l_Mg^V:\"-0x+$3c,q&L%18Ku<HcA\\s!^OQblk^x{35S'>yz8cKgVHWZ]kV0>_", "output": "YES" }, { "input": "f.20)8b+.R}Gy!DbHU3v(.(=Q^`z[_BaQ}eO=C1IK;b2GkD\\{\\Bf\"!#qh]", "output": "YES" }, { "input": "}do5RU<(w<q[\"-NR)IAH_HyiD{", "output": "YES" }, { "input": "Iy^.,Aw*,5+f;l@Q;jLK'G5H-r1Pfmx?ei~`CjMmUe{K:lS9cu4ay8rqRh-W?Gqv!e-j*U)!Mzn{E8B6%~aSZ~iQ_QwlC9_cX(o8", "output": "YES" }, { "input": "sKLje,:q>-D,;NvQ3,qN3-N&tPx0nL/,>Ca|z\"k2S{NF7btLa3_TyXG4XZ:`(t&\"'^M|@qObZxv", "output": "YES" }, { "input": "%z:c@1ZsQ@\\6U/NQ+M9R>,$bwG`U1+C\\18^:S},;kw!&4r|z`", "output": "YES" }, { "input": "OKBB5z7ud81[Tn@P\"nDUd,>@", "output": "NO" }, { "input": "y{0;neX]w0IenPvPx0iXp+X|IzLZZaRzBJ>q~LhMhD$x-^GDwl;,a'<bAqH8QrFwbK@oi?I'W.bZ]MlIQ/x(0YzbTH^l.)]0Bv", "output": "YES" }, { "input": "EL|xIP5_+Caon1hPpQ0[8+r@LX4;b?gMy>;/WH)pf@Ur*TiXu*e}b-*%acUA~A?>MDz#!\\Uh", "output": "YES" }, { "input": "UbkW=UVb>;z6)p@Phr;^Dn.|5O{_i||:Rv|KJ_ay~V(S&Jp", "output": "NO" }, { "input": "!3YPv@2JQ44@)R2O_4`GO", "output": "YES" }, { "input": "Kba/Q,SL~FMd)3hOWU'Jum{9\"$Ld4:GW}D]%tr@G{hpG:PV5-c'VIZ~m/6|3I?_4*1luKnOp`%p|0H{[|Y1A~4-ZdX,Rw2[\\", "output": "YES" }, { "input": "NRN*=v>;oU7[acMIJn*n^bWm!cm3#E7Efr>{g-8bl\"DN4~_=f?[T;~Fq#&)aXq%</GcTJD^e$@Extm[e\"C)q_L", "output": "NO" }, { "input": "y#<fv{_=$MP!{D%I\\1OqjaqKh[pqE$KvYL<9@*V'j8uH0/gQdA'G;&y4Cv6&", "output": "YES" }, { "input": "+SE_Pg<?7Fh,z&uITQut2a-mk8X8La`c2A}", "output": "YES" }, { "input": "Uh3>ER](J", "output": "NO" }, { "input": "!:!{~=9*\\P;Z6F?HC5GadFz)>k*=u|+\"Cm]ICTmB!`L{&oS/z6b~#Snbp/^\\Q>XWU-vY+/dP.7S=-#&whS@,", "output": "YES" }, { "input": "KimtYBZp+ISeO(uH;UldoE6eAcp|9u?SzGZd6j-e}[}u#e[Cx8.qgY]$2!", "output": "YES" }, { "input": "[:[SN-{r>[l+OggH3v3g{EPC*@YBATT@", "output": "YES" }, { "input": "'jdL(vX", "output": "NO" }, { "input": "Q;R+aay]cL?Zh*uG\"YcmO*@Dts*Gjp}D~M7Z96+<4?9I3aH~0qNdO(RmyRy=ci,s8qD_kwj;QHFzD|5,5", "output": "YES" }, { "input": "{Q@#<LU_v^qdh%gGxz*pu)Y\"]k-l-N30WAxvp2IE3:jD0Wi4H/xWPH&s", "output": "YES" }, { "input": "~@Gb(S&N$mBuBUMAky-z^{5VwLNTzYg|ZUZncL@ahS?K*As<$iNUARM3r43J'jJB)$ujfPAq\"G<S9flGyakZg!2Z.-NJ|2{F>]", "output": "YES" }, { "input": "Jp5Aa>aP6fZ!\\6%A}<S}j{O4`C6y$8|i3IW,WHy&\"ioE&7zP\"'xHAY;:x%@SnS]Mr{R|})gU", "output": "YES" }, { "input": "ZA#:U)$RI^sE\\vuAt]x\"2zipI!}YEu2<j$:H0_9/~eB?#->", "output": "YES" }, { "input": "&ppw0._:\\p-PuWM@l}%%=", "output": "NO" }, { "input": "P(^pix\"=oiEZu8?@d@J(I`Xp5TN^T3\\Z7P5\"ZrvZ{2Fwz3g-8`U!)(1$a<g+9Q|COhDoH;HwFY02Pa|ZGp$/WZBR=>6Jg!yr", "output": "YES" }, { "input": "`WfODc\\?#ax~1xu@[ao+o_rN|L7%v,p,nDv>3+6cy.]q3)+A6b!q*Hc+#.t4f~vhUa~$^q", "output": "YES" }, { "input": ",)TH9N}'6t2+0Yg?S#6/{_.,!)9d}h'wG|sY&'Ul4D0l0", "output": "YES" }, { "input": "VXB&r9Z)IlKOJ:??KDA", "output": "YES" }, { "input": "\")1cL>{o\\dcYJzu?CefyN^bGRviOH&P7rJS3PT4:0V3F)%\\}L=AJouYsj_>j2|7^1NWu*%NbOP>ngv-ls<;b-4Sd3Na0R", "output": "YES" }, { "input": "2Y}\\A)>row{~c[g>:'.|ZC8%UTQ/jcdhK%6O)QRC.kd@%y}LJYk=V{G5pQK/yKJ%{G3C", "output": "YES" }, { "input": "O.&=qt(`z(", "output": "NO" }, { "input": "_^r6fyIc/~~;>l%9?aVEi7-{=,[<aMiB'-scSg$$|\"jAzY0N>QkHHGBZj2c\"=fhRlWd5;5K|GgU?7h]!;wl@", "output": "YES" }, { "input": "+/`sAd&eB29E=Nu87${.u6GY@$^a$,}s^!p!F}B-z8<<wORb<S7;HM1a,gp", "output": "YES" }, { "input": "U_ilyOGMT+QiW/M8/D(1=6a7)_FA,h4`8", "output": "YES" }, { "input": "!0WKT:$O", "output": "NO" }, { "input": "1EE*I%EQz6$~pPu7|(r7nyPQt4uGU@]~H'4uII?b1_Wn)K?ZRHrr0z&Kr;}aO3<mN=3:{}QgPxI|Ncm4#)", "output": "YES" }, { "input": "[u3\"$+!:/.<Dp1M7tH}:zxjt],^kv}qP;y12\"`^'/u*h%AFmPJ>e1#Yly", "output": "YES" }, { "input": "'F!_]tB<A&UO+p?7liE>(x&RFgG2~\\(", "output": "NO" }, { "input": "Qv)X8", "output": "YES" }, { "input": "aGv7,J@&g1(}E3g6[LuDZwZl2<v7IwQA%\"R(?ouBD>_=y\"3Kf%^>vON<a^T\\G^ootgE@whWmZo=[ex|F", "output": "YES" }, { "input": "e{}2vQ+/r@p0}cLKNe4MCk", "output": "YES" }, { "input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnkH", "output": "YES" }, { "input": "Qzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky", "output": "YES" }, { "input": "mzbmweyydiadtlcouegmdbyfwurpwb9uvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky", "output": "YES" }, { "input": "1H1", "output": "YES" }, { "input": "+Q", "output": "YES" }, { "input": "1ab", "output": "NO" }, { "input": "!", "output": "NO" }, { "input": "0+", "output": "NO" }, { "input": "+H", "output": "YES" }, { "input": "cH", "output": "YES" }, { "input": "+8", "output": "NO" }, { "input": "8+", "output": "NO" }, { "input": "++++++++++++++++++++++++++", "output": "NO" }, { "input": "(+)", "output": "NO" }, { "input": "H+", "output": "YES" }, { "input": "a!", "output": "NO" }, { "input": "++++++++++++++", "output": "NO" }, { "input": "+++++++++++++++++++++++++++++++++++++++++++++++++++++++++", "output": "NO" }, { "input": "8", "output": "NO" }, { "input": "3", "output": "NO" }, { "input": "HQ9", "output": "YES" }, { "input": "+++H", "output": "YES" }, { "input": "++++++++++", "output": "NO" }, { "input": "HHHHHHH", "output": "YES" }, { "input": "abacabaH", "output": "YES" }, { "input": "+G", "output": "NO" } ]
1,686,590,829
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
2
122
0
print('YES' if set('HQ9+')& set(input()) else'NO')
Title: HQ9+ Time Limit: None seconds Memory Limit: None megabytes Problem Description: HQ9+ is a joke programming language which has only four one-character instructions: - "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator. Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored. You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output. Input Specification: The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive. Output Specification: Output "YES", if executing the program will produce any output, and "NO" otherwise. Demo Input: ['Hi!\n', 'Codeforces\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first case the program contains only one instruction — "H", which prints "Hello, World!". In the second case none of the program characters are language instructions.
```python print('YES' if set('HQ9+')& set(input()) else'NO') ```
0
446
A
DZY Loves Sequences
PROGRAMMING
1,600
[ "dp", "implementation", "two pointers" ]
null
null
DZY has a sequence *a*, consisting of *n* integers. We'll call a sequence *a**i*,<=*a**i*<=+<=1,<=...,<=*a**j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) a subsegment of the sequence *a*. The value (*j*<=-<=*i*<=+<=1) denotes the length of the subsegment. Your task is to find the longest subsegment of *a*, such that it is possible to change at most one number (change one number to any integer you want) from the subsegment to make the subsegment strictly increasing. You only need to output the length of the subsegment you find.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
In a single line print the answer to the problem — the maximum length of the required subsegment.
[ "6\n7 2 3 1 5 6\n" ]
[ "5\n" ]
You can choose subsegment *a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">4</sub>, *a*<sub class="lower-index">5</sub>, *a*<sub class="lower-index">6</sub> and change its 3rd element (that is *a*<sub class="lower-index">4</sub>) to 4.
500
[ { "input": "6\n7 2 3 1 5 6", "output": "5" }, { "input": "10\n424238336 649760493 681692778 714636916 719885387 804289384 846930887 957747794 596516650 189641422", "output": "9" }, { "input": "50\n804289384 846930887 681692778 714636916 957747794 424238336 719885387 649760493 596516650 189641422 25202363 350490028 783368691 102520060 44897764 967513927 365180541 540383427 304089173 303455737 35005212 521595369 294702568 726956430 336465783 861021531 59961394 89018457 101513930 125898168 131176230 145174068 233665124 278722863 315634023 369133070 468703136 628175012 635723059 653377374 656478043 801979803 859484422 914544920 608413785 756898538 734575199 973594325 149798316 38664371", "output": "19" }, { "input": "1\n1", "output": "1" }, { "input": "2\n1000000000 1000000000", "output": "2" }, { "input": "5\n1 2 3 4 1", "output": "5" }, { "input": "10\n1 2 3 4 5 5 6 7 8 9", "output": "6" }, { "input": "5\n1 1 1 1 1", "output": "2" }, { "input": "5\n1 1 2 3 4", "output": "5" }, { "input": "5\n1 2 3 1 6", "output": "5" }, { "input": "1\n42", "output": "1" }, { "input": "5\n1 2 42 3 4", "output": "4" }, { "input": "5\n1 5 9 6 10", "output": "4" }, { "input": "5\n5 2 3 4 5", "output": "5" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "5\n1 2 3 3 4", "output": "4" }, { "input": "8\n1 2 3 4 1 5 6 7", "output": "5" }, { "input": "1\n3", "output": "1" }, { "input": "3\n5 1 2", "output": "3" }, { "input": "4\n1 4 3 4", "output": "4" }, { "input": "6\n7 2 12 4 5 6", "output": "5" }, { "input": "6\n7 2 3 1 4 5", "output": "4" }, { "input": "6\n2 3 5 5 6 7", "output": "6" }, { "input": "5\n2 4 7 6 8", "output": "5" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n1 1 2", "output": "3" }, { "input": "2\n1 2", "output": "2" }, { "input": "5\n4 1 2 3 4", "output": "5" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6", "output": "7" }, { "input": "4\n1 2 1 3", "output": "3" }, { "input": "4\n4 3 1 2", "output": "3" }, { "input": "6\n1 2 2 3 4 5", "output": "5" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "4\n5 1 2 3", "output": "4" }, { "input": "5\n9 1 2 3 4", "output": "5" }, { "input": "2\n1 1", "output": "2" }, { "input": "5\n1 3 2 4 5", "output": "4" }, { "input": "6\n1 2 1 2 4 5", "output": "5" }, { "input": "10\n1 1 5 3 2 9 9 7 7 6", "output": "3" }, { "input": "6\n1 2 3 100000 100 101", "output": "6" }, { "input": "4\n3 3 3 4", "output": "3" }, { "input": "3\n4 3 5", "output": "3" }, { "input": "5\n1 3 2 3 4", "output": "4" }, { "input": "10\n1 2 3 4 5 10 10 11 12 13", "output": "10" }, { "input": "7\n11 2 1 2 13 4 14", "output": "5" }, { "input": "3\n5 1 3", "output": "3" }, { "input": "4\n1 5 3 4", "output": "4" }, { "input": "10\n1 2 3 4 100 6 7 8 9 10", "output": "10" }, { "input": "3\n5 3 5", "output": "3" }, { "input": "5\n100 100 7 8 9", "output": "4" }, { "input": "5\n1 2 3 4 5", "output": "5" }, { "input": "5\n1 2 4 4 5", "output": "5" }, { "input": "6\n7 4 5 6 7 8", "output": "6" }, { "input": "9\n3 4 1 6 3 4 5 6 7", "output": "7" }, { "input": "3\n1000 1 2", "output": "3" }, { "input": "3\n20 1 9", "output": "3" }, { "input": "6\n7 2 3 1 4 6", "output": "4" }, { "input": "3\n100 5 10", "output": "3" }, { "input": "4\n2 2 2 3", "output": "3" }, { "input": "6\n4 2 8 1 2 5", "output": "4" }, { "input": "3\n25 1 6", "output": "3" }, { "input": "10\n17 99 23 72 78 36 5 43 95 9", "output": "5" }, { "input": "7\n21 16 22 21 11 13 19", "output": "4" }, { "input": "5\n1 2 5 3 4", "output": "4" }, { "input": "6\n2 2 2 3 4 5", "output": "5" }, { "input": "5\n1 3 1 2 3", "output": "4" }, { "input": "3\n81 33 64", "output": "3" }, { "input": "7\n14 3 3 19 13 19 15", "output": "4" }, { "input": "9\n1 2 3 4 5 42 7 8 9", "output": "9" }, { "input": "5\n2 3 7 5 6", "output": "5" }, { "input": "5\n1 3 3 4 5", "output": "5" }, { "input": "6\n1 5 4 3 4 5", "output": "4" } ]
1,681,393,501
2,147,483,647
Python 3
OK
TESTS
92
249
8,396,800
n = int(input()) data = list(map(int, input().split())) l = [1] * n r = [1] * n for i in range(1, n): if data[i - 1] < data[i]: l[i] += l[i - 1] for i in range(n - 2, 0, -1): if data[i + 1] > data[i]: r[i] += r[i + 1] ans = max(max(l), max(r)) if ans < n: ans += 1 for i in range(1, n - 1): if data[i - 1] + 1 < data[i + 1]: ans = max(ans, l[i - 1] + r[i + 1] + 1) print(ans)
Title: DZY Loves Sequences Time Limit: None seconds Memory Limit: None megabytes Problem Description: DZY has a sequence *a*, consisting of *n* integers. We'll call a sequence *a**i*,<=*a**i*<=+<=1,<=...,<=*a**j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) a subsegment of the sequence *a*. The value (*j*<=-<=*i*<=+<=1) denotes the length of the subsegment. Your task is to find the longest subsegment of *a*, such that it is possible to change at most one number (change one number to any integer you want) from the subsegment to make the subsegment strictly increasing. You only need to output the length of the subsegment you find. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). Output Specification: In a single line print the answer to the problem — the maximum length of the required subsegment. Demo Input: ['6\n7 2 3 1 5 6\n'] Demo Output: ['5\n'] Note: You can choose subsegment *a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">4</sub>, *a*<sub class="lower-index">5</sub>, *a*<sub class="lower-index">6</sub> and change its 3rd element (that is *a*<sub class="lower-index">4</sub>) to 4.
```python n = int(input()) data = list(map(int, input().split())) l = [1] * n r = [1] * n for i in range(1, n): if data[i - 1] < data[i]: l[i] += l[i - 1] for i in range(n - 2, 0, -1): if data[i + 1] > data[i]: r[i] += r[i + 1] ans = max(max(l), max(r)) if ans < n: ans += 1 for i in range(1, n - 1): if data[i - 1] + 1 < data[i + 1]: ans = max(ans, l[i - 1] + r[i + 1] + 1) print(ans) ```
3
217
A
Ice Skating
PROGRAMMING
1,200
[ "brute force", "dfs and similar", "dsu", "graphs" ]
null
null
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created. We assume that Bajtek can only heap up snow drifts at integer coordinates.
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift. Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
[ "2\n2 1\n1 2\n", "2\n2 1\n4 1\n" ]
[ "1\n", "0\n" ]
none
500
[ { "input": "2\n2 1\n1 2", "output": "1" }, { "input": "2\n2 1\n4 1", "output": "0" }, { "input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459", "output": "21" }, { "input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815", "output": "16" }, { "input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663", "output": "10" }, { "input": "1\n321 88", "output": "0" }, { "input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689", "output": "7" }, { "input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510", "output": "6" }, { "input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888", "output": "5" }, { "input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802", "output": "13" }, { "input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662", "output": "11" }, { "input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786", "output": "38" }, { "input": "3\n175 201\n907 909\n388 360", "output": "2" }, { "input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86", "output": "6" }, { "input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820", "output": "16" }, { "input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901", "output": "31" }, { "input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210", "output": "29" }, { "input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894", "output": "29" }, { "input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823", "output": "13" }, { "input": "5\n175 158\n16 2\n397 381\n668 686\n957 945", "output": "4" }, { "input": "5\n312 284\n490 509\n730 747\n504 497\n782 793", "output": "4" }, { "input": "2\n802 903\n476 348", "output": "1" }, { "input": "4\n325 343\n425 442\n785 798\n275 270", "output": "3" }, { "input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653", "output": "25" }, { "input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124", "output": "34" }, { "input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255", "output": "29" }, { "input": "5\n664 666\n951 941\n739 742\n844 842\n2 2", "output": "4" }, { "input": "3\n939 867\n411 427\n757 708", "output": "2" }, { "input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636", "output": "34" }, { "input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195", "output": "28" }, { "input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488", "output": "22" }, { "input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235", "output": "8" }, { "input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621", "output": "22" }, { "input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461", "output": "22" }, { "input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924", "output": "6" }, { "input": "3\n1 1\n2 1\n2 2", "output": "0" }, { "input": "4\n1 1\n1 2\n2 1\n2 2", "output": "0" }, { "input": "5\n1 1\n1 2\n2 2\n3 1\n3 3", "output": "0" }, { "input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3", "output": "0" }, { "input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10", "output": "1" }, { "input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11", "output": "1" }, { "input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11", "output": "3" }, { "input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25", "output": "7" }, { "input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28", "output": "5" }, { "input": "3\n1 2\n2 1\n2 2", "output": "0" }, { "input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1", "output": "0" }, { "input": "4\n1 1\n1 2\n2 1\n2 2", "output": "0" }, { "input": "3\n1 1\n2 2\n1 2", "output": "0" }, { "input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4", "output": "1" }, { "input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100", "output": "6" }, { "input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4", "output": "0" }, { "input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3", "output": "0" }, { "input": "4\n3 1\n2 1\n2 2\n1 2", "output": "0" }, { "input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3", "output": "0" }, { "input": "3\n1 2\n1 3\n1 4", "output": "0" }, { "input": "4\n1 1\n2 2\n1 2\n2 1", "output": "0" }, { "input": "4\n1 3\n2 1\n3 2\n3 1", "output": "1" }, { "input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4", "output": "0" }, { "input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700", "output": "2" }, { "input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9", "output": "1" }, { "input": "4\n1 1\n2 2\n3 2\n3 1", "output": "0" }, { "input": "3\n1 2\n3 4\n3 2", "output": "0" }, { "input": "3\n1 1\n1 2\n2 2", "output": "0" }, { "input": "4\n5 5\n5 4\n6 3\n6 4", "output": "0" }, { "input": "3\n1 1\n2 2\n2 1", "output": "0" } ]
1,603,461,459
2,147,483,647
PyPy 3
OK
TESTS
76
310
1,638,400
n = int(input()) x,y = [],[] visited = [0]*n ans= -1 # doing first data structure question on codeforces def dfs(x,y,v,j): v[j] = 1 for i in range(n): if v[i]==0 and(x[i]==x[j] or y[i]==y[j]): dfs(x,y,v,i) for i in range(n): a,b = list(map(int,input().split())) x.append(a) y.append(b) for i in range(n): if visited[i]==0 : dfs(x,y,visited ,i) ans+=1 print(ans)
Title: Ice Skating Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created. We assume that Bajtek can only heap up snow drifts at integer coordinates. Input Specification: The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift. Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct. Output Specification: Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one. Demo Input: ['2\n2 1\n1 2\n', '2\n2 1\n4 1\n'] Demo Output: ['1\n', '0\n'] Note: none
```python n = int(input()) x,y = [],[] visited = [0]*n ans= -1 # doing first data structure question on codeforces def dfs(x,y,v,j): v[j] = 1 for i in range(n): if v[i]==0 and(x[i]==x[j] or y[i]==y[j]): dfs(x,y,v,i) for i in range(n): a,b = list(map(int,input().split())) x.append(a) y.append(b) for i in range(n): if visited[i]==0 : dfs(x,y,visited ,i) ans+=1 print(ans) ```
3
318
A
Even Odds
PROGRAMMING
900
[ "math" ]
null
null
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Print the number that will stand at the position number *k* after Volodya's manipulations.
[ "10 3\n", "7 7\n" ]
[ "5", "6" ]
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
500
[ { "input": "10 3", "output": "5" }, { "input": "7 7", "output": "6" }, { "input": "7 1", "output": "1" }, { "input": "7 2", "output": "3" }, { "input": "8 5", "output": "2" }, { "input": "8 3", "output": "5" }, { "input": "8 4", "output": "7" }, { "input": "1000000000000 500000000001", "output": "2" }, { "input": "999999999997 499999999999", "output": "999999999997" }, { "input": "999999999999 999999999999", "output": "999999999998" }, { "input": "1000000000000 1", "output": "1" }, { "input": "999999999999 1", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "1000000000000 1000000000000", "output": "1000000000000" }, { "input": "1000000000000 500000000000", "output": "999999999999" }, { "input": "1000000000000 499999999999", "output": "999999999997" }, { "input": "999999999997 499999999998", "output": "999999999995" }, { "input": "619234238 556154835", "output": "493075432" }, { "input": "38151981 36650624", "output": "35149266" }, { "input": "680402465 442571217", "output": "204739968" }, { "input": "109135284 9408714", "output": "18817427" }, { "input": "603701841 56038951", "output": "112077901" }, { "input": "356764822 321510177", "output": "286255532" }, { "input": "284911189 142190783", "output": "284381565" }, { "input": "91028405 61435545", "output": "31842684" } ]
1,691,657,822
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
60
0
whole_stuff =input().split(" ") k=int(whole_stuff[1]) n=int(whole_stuff[0]) if n%2==1: state=n//2+1 else : state = n // 2 print(str(state)) if state==k or k<state: print(str(k*2-1 )) else : print(str((k-state)*2))
Title: Even Odds Time Limit: None seconds Memory Limit: None megabytes Problem Description: Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*. Input Specification: The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Output Specification: Print the number that will stand at the position number *k* after Volodya's manipulations. Demo Input: ['10 3\n', '7 7\n'] Demo Output: ['5', '6'] Note: In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
```python whole_stuff =input().split(" ") k=int(whole_stuff[1]) n=int(whole_stuff[0]) if n%2==1: state=n//2+1 else : state = n // 2 print(str(state)) if state==k or k<state: print(str(k*2-1 )) else : print(str((k-state)*2)) ```
0
385
A
Bear and Raspberry
PROGRAMMING
1,000
[ "brute force", "greedy", "implementation" ]
null
null
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry. Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=&lt;<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel. The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel. The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
Print a single integer — the answer to the problem.
[ "5 1\n5 10 7 3 20\n", "6 2\n100 1 10 40 10 40\n", "3 0\n1 2 3\n" ]
[ "3\n", "97\n", "0\n" ]
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3. In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
500
[ { "input": "5 1\n5 10 7 3 20", "output": "3" }, { "input": "6 2\n100 1 10 40 10 40", "output": "97" }, { "input": "3 0\n1 2 3", "output": "0" }, { "input": "2 0\n2 1", "output": "1" }, { "input": "10 5\n10 1 11 2 12 3 13 4 14 5", "output": "4" }, { "input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77", "output": "87" }, { "input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93", "output": "84" }, { "input": "6 100\n10 9 8 7 6 5", "output": "0" }, { "input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46", "output": "78" }, { "input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44", "output": "0" }, { "input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62", "output": "4" }, { "input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71", "output": "0" }, { "input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1", "output": "0" }, { "input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27", "output": "63" }, { "input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22", "output": "38" }, { "input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83", "output": "91" }, { "input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14", "output": "79" }, { "input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24", "output": "91" }, { "input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49", "output": "83" }, { "input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70", "output": "94" }, { "input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42", "output": "43" }, { "input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0", "output": "100" }, { "input": "3 1\n1 2 3", "output": "0" }, { "input": "3 2\n3 3 3", "output": "0" }, { "input": "3 3\n3 2 1", "output": "0" }, { "input": "3 100\n1 2 3", "output": "0" }, { "input": "2 100\n0 0", "output": "0" }, { "input": "2 90\n10 5", "output": "0" }, { "input": "2 5\n5 4", "output": "0" }, { "input": "3 1\n19 20 1", "output": "18" }, { "input": "5 1\n5 10 7 4 20", "output": "2" }, { "input": "5 1\n1 2 3 4 5", "output": "0" } ]
1,630,621,909
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
31
6,963,200
n,c = map(int,input().split()) l = list(map(int,input().split())) l1 = [] for i in range(len(l)-1): x = l[i]-l[i+1] l1.append(x) print(l1) x = max(l1) - c if x>0: print(x) else: print(0)
Title: Bear and Raspberry Time Limit: None seconds Memory Limit: None megabytes Problem Description: The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry. Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=&lt;<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel. The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan. Input Specification: The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel. The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n'] Demo Output: ['3\n', '97\n', '0\n'] Note: In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3. In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
```python n,c = map(int,input().split()) l = list(map(int,input().split())) l1 = [] for i in range(len(l)-1): x = l[i]-l[i+1] l1.append(x) print(l1) x = max(l1) - c if x>0: print(x) else: print(0) ```
0
31
B
Sysadmin Bob
PROGRAMMING
1,500
[ "greedy", "implementation", "strings" ]
B. Sysadmin Bob
0
256
Email address in Berland is a string of the form *A*@*B*, where *A* and *B* are arbitrary strings consisting of small Latin letters. Bob is a system administrator in «Bersoft» company. He keeps a list of email addresses of the company's staff. This list is as a large string, where all addresses are written in arbitrary order, separated by commas. The same address can be written more than once. Suddenly, because of unknown reasons, all commas in Bob's list disappeared. Now Bob has a string, where all addresses are written one after another without any separators, and there is impossible to determine, where the boundaries between addresses are. Unfortunately, on the same day his chief asked him to bring the initial list of addresses. Now Bob wants to disjoin addresses in some valid way. Help him to do that.
The first line contains the list of addresses without separators. The length of this string is between 1 and 200, inclusive. The string consists only from small Latin letters and characters «@».
If there is no list of the valid (according to the Berland rules) email addresses such that after removing all commas it coincides with the given string, output No solution. In the other case, output the list. The same address can be written in this list more than once. If there are several solutions, output any of them.
[ "a@aa@a\n", "a@a@a\n", "@aa@a\n" ]
[ "a@a,a@a\n", "No solution\n", "No solution\n" ]
none
1,000
[ { "input": "a@aa@a", "output": "a@a,a@a" }, { "input": "a@a@a", "output": "No solution" }, { "input": "@aa@a", "output": "No solution" }, { "input": "aba@caba@daba", "output": "aba@c,aba@daba" }, { "input": "asd@qwasd@qwasd@qwasd@qwasd@qw", "output": "asd@q,wasd@q,wasd@q,wasd@q,wasd@qw" }, { "input": "qwer@ty", "output": "qwer@ty" }, { "input": "@", "output": "No solution" }, { "input": "g", "output": "No solution" }, { "input": "@@", "output": "No solution" }, { "input": "@@@", "output": "No solution" }, { "input": "r@@", "output": "No solution" }, { "input": "@@r", "output": "No solution" }, { "input": "@r@", "output": "No solution" }, { "input": "w@", "output": "No solution" }, { "input": "@e", "output": "No solution" }, { "input": "jj", "output": "No solution" }, { "input": "@gh", "output": "No solution" }, { "input": "n@m", "output": "n@m" }, { "input": "kl@", "output": "No solution" }, { "input": "fpm", "output": "No solution" }, { "input": "@@@@", "output": "No solution" }, { "input": "q@@@", "output": "No solution" }, { "input": "@d@@", "output": "No solution" }, { "input": "@@v@", "output": "No solution" }, { "input": "@@@c", "output": "No solution" }, { "input": "@@zx", "output": "No solution" }, { "input": "@x@a", "output": "No solution" }, { "input": "@pq@", "output": "No solution" }, { "input": "w@@e", "output": "No solution" }, { "input": "e@s@", "output": "No solution" }, { "input": "ec@@", "output": "No solution" }, { "input": "@hjk", "output": "No solution" }, { "input": "e@vb", "output": "e@vb" }, { "input": "tg@q", "output": "tg@q" }, { "input": "jkl@", "output": "No solution" }, { "input": "werb", "output": "No solution" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "No solution" }, { "input": "@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@", "output": "No solution" }, { "input": "duk@rufrxjzqbwkfrzf@sjp@mdpyrokdfmcmexxtjqaalruvtzwfsqabi@tjkxilrhkwzfeuqm@lpwnxgebirdvwplsvrtxvhmzv", "output": "duk@r,ufrxjzqbwkfrzf@s,jp@m,dpyrokdfmcmexxtjqaalruvtzwfsqabi@t,jkxilrhkwzfeuqm@lpwnxgebirdvwplsvrtxvhmzv" }, { "input": "umegsn@qlmkpkyrmuclefdpfhzuhyjcoqthnvpwzhkwrdvlzfbrqpzlg@ebzycyaofyyetwcepe@nxjwyeaqbuxxbohfzrnmebuy", "output": "umegsn@q,lmkpkyrmuclefdpfhzuhyjcoqthnvpwzhkwrdvlzfbrqpzlg@e,bzycyaofyyetwcepe@nxjwyeaqbuxxbohfzrnmebuy" }, { "input": "l@snuoytgflrtuexpx@txzhhdwbakfhfro@syxistypegfvdmurvuubrj@grsznzhcotagqueuxtnjgfaywzkbglwwiptjyocxcs", "output": "l@s,nuoytgflrtuexpx@t,xzhhdwbakfhfro@s,yxistypegfvdmurvuubrj@grsznzhcotagqueuxtnjgfaywzkbglwwiptjyocxcs" }, { "input": "crvjlke@yqsdofatzuuspt@@uumdkiwhtg@crxiabnujfmcquylyklxaedniwnq@@f@@rfnsjtylurexmdaaykvxmgeij@jkjsyi", "output": "No solution" }, { "input": "ukpcivvjubgalr@bdxangokpaxzxuxe@qlemwpvywfudffafsqlmmhhalaaolktmgmhmrwvkdcvwxcfbytnz@jgmbhpwqcmecnxc", "output": "ukpcivvjubgalr@b,dxangokpaxzxuxe@q,lemwpvywfudffafsqlmmhhalaaolktmgmhmrwvkdcvwxcfbytnz@jgmbhpwqcmecnxc" }, { "input": "mehxghlvnnazggvpnjdbchdolqguiurrfghwxpwhphdbhloltwnnqovsnsdmfevlikmrlvwvkcqysefvoraorhamchghqaooxaxz", "output": "No solution" }, { "input": "whazbewtogyre@wqlsswhygx@osevwzytuaukqpp@gfjbtwnhpnlxwci@ovaaat@ookd@@o@bss@wyrrwzysubw@utyltkk@hlkx", "output": "No solution" }, { "input": "vpulcessdotvylvmkeonzbpncjxaaigotkyvngsbkicomikyavpsjcphlznjtdmvbqiroxvfcmcczfmqbyedujvrupzlaswbzanv", "output": "No solution" }, { "input": "mhxapzklriiincpnysmegjzaxdngifbowkzivvgisqbekprdmdoqezdsrsrwwmht@hwywjqflvqdevpqisncwbftlttfkgsyetop", "output": "mhxapzklriiincpnysmegjzaxdngifbowkzivvgisqbekprdmdoqezdsrsrwwmht@hwywjqflvqdevpqisncwbftlttfkgsyetop" }, { "input": "dxzqftcghawwcwh@iepanbiclstbsxbrsoep@@jwhrptgiu@zfykoravtaykvkzseqfnlsbvjnsgiajgjtgucvewlpxmqwvkghlo", "output": "No solution" }, { "input": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtgh@", "output": "No solution" }, { "input": "@rierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "No solution" }, { "input": "e@ierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "e@ierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd" }, { "input": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtg@d", "output": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtg@d" }, { "input": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjt@h@", "output": "No solution" }, { "input": "@r@erjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "No solution" }, { "input": "e@i@rjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "No solution" }, { "input": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierj@g@d", "output": "No solution" }, { "input": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtg@@", "output": "No solution" }, { "input": "@@ierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "No solution" }, { "input": "e@@erjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "No solution" }, { "input": "erierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjt@@d", "output": "No solution" }, { "input": "erierjtghderierjtghderierj@@dderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghd", "output": "No solution" }, { "input": "a@rierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderirjtghderierjtghderierjtghderierjthderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtgh@a", "output": "a@r,ierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderirjtghderierjtghderierjtghderierjthderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtghderierjtgh@a" }, { "input": "d@nt@om@zz@ut@tr@ta@ap@ou@sy@sv@fg@el@rp@qr@nl@j", "output": "d@n,t@o,m@z,z@u,t@t,r@t,a@a,p@o,u@s,y@s,v@f,g@e,l@r,p@q,r@n,l@j" }, { "input": "a@mc@ks@gu@rl@gq@zq@iz@da@uq@mi@nf@zs@hi@we@ej@ke@vb@az@yz@yl@rr@gh@um@nv@qe@qq@de@dy@op@gt@vx@ak@q", "output": "a@m,c@k,s@g,u@r,l@g,q@z,q@i,z@d,a@u,q@m,i@n,f@z,s@h,i@w,e@e,j@k,e@v,b@a,z@y,z@y,l@r,r@g,h@u,m@n,v@q,e@q,q@d,e@d,y@o,p@g,t@v,x@a,k@q" }, { "input": "c@ir@xf@ap@fk@sp@wm@ec@qw@vg@by@iu@tr@wu@pv@lj@dd@tc@qj@ok@hm@bs@ul@ez@cg@ht@xf@ag@tr@hz@ap@tx@ly@dg@hu@nd@uv@il@ii@cn@nc@nb@cy@kp@dk@xa@da@ta@yr@yv@qg@db@je@wz@rn@yh@xi@mj@kc@uj@yu@cf@ps@ao@fo@le@d", "output": "c@i,r@x,f@a,p@f,k@s,p@w,m@e,c@q,w@v,g@b,y@i,u@t,r@w,u@p,v@l,j@d,d@t,c@q,j@o,k@h,m@b,s@u,l@e,z@c,g@h,t@x,f@a,g@t,r@h,z@a,p@t,x@l,y@d,g@h,u@n,d@u,v@i,l@i,i@c,n@n,c@n,b@c,y@k,p@d,k@x,a@d,a@t,a@y,r@y,v@q,g@d,b@j,e@w,z@r,n@y,h@x,i@m,j@k,c@u,j@y,u@c,f@p,s@a,o@f,o@l,e@d" }, { "input": "m@us@ru@mg@rq@ed@ot@gt@fo@gs@lm@cx@au@rq@zt@zk@jr@xd@oa@py@kf@lk@zr@ko@lj@wv@fl@yl@gk@cx@px@kl@ic@sr@xn@hm@xs@km@tk@ui@ya@pa@xx@ze@py@ir@xj@cr@dq@lr@cm@zu@lt@bx@kq@kx@fr@lu@vb@rz@hg@iw@dl@pf@pl@wv@z", "output": "m@u,s@r,u@m,g@r,q@e,d@o,t@g,t@f,o@g,s@l,m@c,x@a,u@r,q@z,t@z,k@j,r@x,d@o,a@p,y@k,f@l,k@z,r@k,o@l,j@w,v@f,l@y,l@g,k@c,x@p,x@k,l@i,c@s,r@x,n@h,m@x,s@k,m@t,k@u,i@y,a@p,a@x,x@z,e@p,y@i,r@x,j@c,r@d,q@l,r@c,m@z,u@l,t@b,x@k,q@k,x@f,r@l,u@v,b@r,z@h,g@i,w@d,l@p,f@p,l@w,v@z" }, { "input": "gjkjqjrks@eyqiia@qfijelnmigoditxjrtuhukalfl@nmwancimlqtfekzkxgjioedhtdivqajwbmu@hpdxuiwurpgenxaiqaqkcqimcvitljuisfiojlylveie@neqdjzeqdbiatjpuhujgykl@gmmlrhnlghsoeyrccygigtkjrjxdwmnkouaiaqpquluwcdqlxqb", "output": "gjkjqjrks@e,yqiia@q,fijelnmigoditxjrtuhukalfl@n,mwancimlqtfekzkxgjioedhtdivqajwbmu@h,pdxuiwurpgenxaiqaqkcqimcvitljuisfiojlylveie@n,eqdjzeqdbiatjpuhujgykl@gmmlrhnlghsoeyrccygigtkjrjxdwmnkouaiaqpquluwcdqlxqb" }, { "input": "uakh@chpowdmvdywosakyyknpriverjjgklmdrgwufpawgvhabjbnemimjktgbkx@fzvqcodbceqnihl@kpsslhwwndad@@yavjafrwkqyt@urhnwgnqamn@xkc@vngzlssmtheuxkpzjlbbjq@mwiojmvpilm@hlrmxheszskhxritsieubjjazrngxlqeedfkiuwny", "output": "No solution" }, { "input": "usmjophufnkamnvowbauu@wfoyceknkgeaejlbbqhtucbl@wurukjezj@irhdgrfhyfkz@fbmqgxvtxcebztirvwjf@fnav@@f@paookujny@z@fmcxgvab@@kpqbwuxxwxhsrbivlbunmdjzk@afjznrjjtkq@cafetoinfleecjqvlzpkqlspoufwmidvoblti@jbg", "output": "No solution" }, { "input": "axkxcgcmlxq@v@ynnjximcujikloyls@lqvxiyca@feimaioavacmquasneqbrqftknpbrzpahtcc@ijwqmyzsuidqkm@dffuiitpugbvty@izbnqxhdjasihhlt@gjrol@vy@vnqpxuqbofzzwl@toywomxopbuttczszx@fuowtjmtqy@gypx@la@@tweln@jgyktb", "output": "No solution" }, { "input": "mplxc@crww@gllecngcsbmxmksrgcb@lbrcnkwxclkcgvfeqeoymproppxhxbgm@q@bfxxvuymnnjolqklabcinwpdlxj@jcevvilhmpyiwggvlmdanfhhlgbkobnmei@bvqtdq@osijfdsuouvcqpcjxjqiuhgts@xapp@cpqvlhlfrxtgunbbjwhuafovbcbqyhmlu", "output": "No solution" }, { "input": "aglvesxsmivijisod@mxcnbfcfgqfwjouidlsueaswf@obehqpvbkmukxkicyoknkbol@kutunggpoxxfpbe@qkhv@llddqqoyjeex@byvtlhbifqmvlukmrvgvpwrscwfhpuwyknwchqhrdqgarmnsdlqgf@lseltghg@bhuwbfjpsvayzk@fvwow@zapklumefauly", "output": "aglvesxsmivijisod@m,xcnbfcfgqfwjouidlsueaswf@o,behqpvbkmukxkicyoknkbol@k,utunggpoxxfpbe@q,khv@l,lddqqoyjeex@b,yvtlhbifqmvlukmrvgvpwrscwfhpuwyknwchqhrdqgarmnsdlqgf@l,seltghg@b,huwbfjpsvayzk@f,vwow@zapklumefauly" }, { "input": "gbllovyerhudm@aluhtnstcp@uwgvejnmqpt@nez@ltzqjrcgwkkpzicb@ihh@wldhvjbrl@efbdzbeg@zyovsta@n@c@jutail@nclsbcihabzr@snowxeyl@jewen@aduffvhr@ifufzzt@i@kptygveumwaknmrn@edsapqpcwsqypmutggztum@ewzakeamobzxt", "output": "No solution" }, { "input": "dokshhqwmtbefrynupvusfxroggoqkjqfyabzkbccjmavumncorbcoairybeknhnpnwftrlbopsvqlgjbrowmfmoeebqseneabvgbcxmujmcqomoawrooixmqmyspfgafudfdfyrnujhgnbtsehgsnvdztjdpnskyquwdtkbfjtvrfjcqzmourvqsnfgjfqjgndydpch", "output": "No solution" }, { "input": "jrlhtwmotdhtgcqokodparuqypwlkbhfsxvmdpfiraokekrolwtlsqjzcuvjfnvblznyngasauzln@gjypvjcwljnotgjlxketfgtntbotwjehea@vppouyoujujlhjrxbhvltfdslaqwynwjefbdbnuehmipqmtsrivlnippgftgnkhdgqiqbfvgrtoxrznncncqcvf", "output": "jrlhtwmotdhtgcqokodparuqypwlkbhfsxvmdpfiraokekrolwtlsqjzcuvjfnvblznyngasauzln@g,jypvjcwljnotgjlxketfgtntbotwjehea@vppouyoujujlhjrxbhvltfdslaqwynwjefbdbnuehmipqmtsrivlnippgftgnkhdgqiqbfvgrtoxrznncncqcvf" }, { "input": "oxkvgnggznlfhminxkkhictpiaokdsfrewnxiujpjpstlyxovfwugrsqnpooalknjnfugxojozizlicwvnbflhdevpvnvwztnfiapairpigexbaeshondqdecduewmfrxunphikvlfwmrpsxrhxyjlsgqfiaqnwzlzxcyuudhzr@twllmhyfclybxqazhrmxdtokxawc", "output": "oxkvgnggznlfhminxkkhictpiaokdsfrewnxiujpjpstlyxovfwugrsqnpooalknjnfugxojozizlicwvnbflhdevpvnvwztnfiapairpigexbaeshondqdecduewmfrxunphikvlfwmrpsxrhxyjlsgqfiaqnwzlzxcyuudhzr@twllmhyfclybxqazhrmxdtokxawc" } ]
1,595,855,860
2,147,483,647
Python 3
OK
TESTS
76
109
6,656,000
# -*- coding: utf-8 -*- s = input().split('@') n = len(s) - 1 for i in range(1, n): if len(s[i]) < 2: s = False; break s[i] = s[i][0] + ',' + s[i][1:] if n > 0 and s and s[0] and s[n]: print('@'.join(s)) else: print('No solution')
Title: Sysadmin Bob Time Limit: 0 seconds Memory Limit: 256 megabytes Problem Description: Email address in Berland is a string of the form *A*@*B*, where *A* and *B* are arbitrary strings consisting of small Latin letters. Bob is a system administrator in «Bersoft» company. He keeps a list of email addresses of the company's staff. This list is as a large string, where all addresses are written in arbitrary order, separated by commas. The same address can be written more than once. Suddenly, because of unknown reasons, all commas in Bob's list disappeared. Now Bob has a string, where all addresses are written one after another without any separators, and there is impossible to determine, where the boundaries between addresses are. Unfortunately, on the same day his chief asked him to bring the initial list of addresses. Now Bob wants to disjoin addresses in some valid way. Help him to do that. Input Specification: The first line contains the list of addresses without separators. The length of this string is between 1 and 200, inclusive. The string consists only from small Latin letters and characters «@». Output Specification: If there is no list of the valid (according to the Berland rules) email addresses such that after removing all commas it coincides with the given string, output No solution. In the other case, output the list. The same address can be written in this list more than once. If there are several solutions, output any of them. Demo Input: ['a@aa@a\n', 'a@a@a\n', '@aa@a\n'] Demo Output: ['a@a,a@a\n', 'No solution\n', 'No solution\n'] Note: none
```python # -*- coding: utf-8 -*- s = input().split('@') n = len(s) - 1 for i in range(1, n): if len(s[i]) < 2: s = False; break s[i] = s[i][0] + ',' + s[i][1:] if n > 0 and s and s[0] and s[n]: print('@'.join(s)) else: print('No solution') ```
3
519
B
A and B and Compilation Errors
PROGRAMMING
1,100
[ "data structures", "implementation", "sortings" ]
null
null
A and B are preparing themselves for programming contests. B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code. Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake. However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change. Can you help B find out exactly what two errors he corrected?
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time. The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one. The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.
Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.
[ "5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n", "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n" ]
[ "8\n123\n", "1\n3\n" ]
In the first test sample B first corrects the error number 8, then the error number 123. In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
1,000
[ { "input": "5\n1 5 8 123 7\n123 7 5 1\n5 1 7", "output": "8\n123" }, { "input": "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5", "output": "1\n3" }, { "input": "3\n1 2 3\n3 2\n2", "output": "1\n3" }, { "input": "10\n460626451 802090732 277246428 661369649 388684428 784303821 376287098 656422756 9301599 25720377\n277246428 388684428 661369649 460626451 656422756 802090732 9301599 784303821 376287098\n376287098 802090732 388684428 9301599 656422756 784303821 460626451 277246428", "output": "25720377\n661369649" }, { "input": "3\n796067435 964699482 819602309\n964699482 796067435\n964699482", "output": "819602309\n796067435" }, { "input": "3\n374054998 726316780 902899520\n902899520 726316780\n726316780", "output": "374054998\n902899520" }, { "input": "3\n168638990 939116221 323703261\n168638990 323703261\n168638990", "output": "939116221\n323703261" }, { "input": "3\n77 77 77\n77 77\n77", "output": "77\n77" }, { "input": "3\n84 30 9\n9 84\n9", "output": "30\n84" }, { "input": "6\n5 4 3 3 5 5\n3 5 5 4 3\n3 5 4 3", "output": "5\n5" }, { "input": "4\n1 5 7 8\n1 5 7\n1 5", "output": "8\n7" } ]
1,672,936,958
2,147,483,647
PyPy 3-64
OK
TESTS
33
186
25,702,400
n=int(input()) a=[int(i) for i in input().split()] b=[int(i) for i in input().split()] c=[int(i) for i in input().split()] d1={} for z in a: if z not in d1.keys(): d1[z]=1 else : d1[z]+=1 d2={} for z in b: if z not in d2.keys(): d2[z]=1 else : d2[z]+=1 for z in a: if z not in d2.keys(): print(z) break elif d1[z]!=d2[z]: print(z) break d3={} for z in c: if z not in d3.keys(): d3[z]=1 else : d3[z]+=1 for z in b: if z not in d3.keys(): print(z) break elif d2[z]!=d3[z]: print(z) break
Title: A and B and Compilation Errors Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code. Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake. However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change. Can you help B find out exactly what two errors he corrected? Input Specification: The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time. The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one. The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one. Output Specification: Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively. Demo Input: ['5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n', '6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n'] Demo Output: ['8\n123\n', '1\n3\n'] Note: In the first test sample B first corrects the error number 8, then the error number 123. In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
```python n=int(input()) a=[int(i) for i in input().split()] b=[int(i) for i in input().split()] c=[int(i) for i in input().split()] d1={} for z in a: if z not in d1.keys(): d1[z]=1 else : d1[z]+=1 d2={} for z in b: if z not in d2.keys(): d2[z]=1 else : d2[z]+=1 for z in a: if z not in d2.keys(): print(z) break elif d1[z]!=d2[z]: print(z) break d3={} for z in c: if z not in d3.keys(): d3[z]=1 else : d3[z]+=1 for z in b: if z not in d3.keys(): print(z) break elif d2[z]!=d3[z]: print(z) break ```
3
20
B
Equation
PROGRAMMING
2,000
[ "math" ]
B. Equation
1
256
You are given an equation: Your task is to find the number of distinct roots of the equation and print all of them in ascending order.
The first line contains three integer numbers *A*,<=*B* and *C* (<=-<=105<=≤<=*A*,<=*B*,<=*C*<=≤<=105). Any coefficient may be equal to 0.
In case of infinite root count print the only integer -1. In case of no roots print the only integer 0. In other cases print the number of root on the first line and the roots on the following lines in the ascending order. Print roots with at least 5 digits after the decimal point.
[ "1 -5 6\n" ]
[ "2\n2.0000000000\n3.0000000000" ]
none
1,000
[ { "input": "1 -5 6", "output": "2\n2.0000000000\n3.0000000000" }, { "input": "1 1 1", "output": "0" }, { "input": "1 2 1", "output": "1\n-1.0000000000" }, { "input": "0 0 0", "output": "-1" }, { "input": "0 -2 1", "output": "1\n0.5000000000" }, { "input": "0 -2 0", "output": "1\n0.0000000000" }, { "input": "0 0 1", "output": "0" }, { "input": "0 0 -100000", "output": "0" }, { "input": "0 10000 -100000", "output": "1\n10.0000000000" }, { "input": "1 100000 -100000", "output": "2\n-100000.9999900002\n0.9999900002" }, { "input": "0 3431 43123", "output": "1\n-12.5686388808" }, { "input": "100 200 100", "output": "1\n-1.0000000000" }, { "input": "50000 100000 50000", "output": "1\n-1.0000000000" }, { "input": "-1 10 20", "output": "2\n-1.7082039325\n11.7082039325" }, { "input": "-50000 100000 -50000", "output": "1\n1.0000000000" }, { "input": "1 -2 1", "output": "1\n1.0000000000" }, { "input": "1000 -5000 6000", "output": "2\n2.0000000000\n3.0000000000" }, { "input": "0 -100000 0", "output": "1\n0.0000000000" }, { "input": "1 -100000 0", "output": "2\n0.0000000000\n100000.0000000000" }, { "input": "1223 -23532 1232", "output": "2\n0.0524974745\n19.1887126645" }, { "input": "-1 -2 -1", "output": "1\n-1.0000000000" }, { "input": "1 0 0", "output": "1\n0.0000000000" }, { "input": "0 1 0", "output": "1\n-0.0000000000" }, { "input": "0 0 1", "output": "0" }, { "input": "0 1 -1", "output": "1\n1.0000000000" }, { "input": "5 0 5", "output": "0" }, { "input": "-2 -5 0", "output": "2\n-2.5000000000\n-0.0000000000" }, { "input": "-2 -4 0", "output": "2\n-2.0000000000\n-0.0000000000" }, { "input": "-2 0 0", "output": "1\n-0.0000000000" }, { "input": "0 -4 -4", "output": "1\n-1.0000000000" }, { "input": "1 1 0", "output": "2\n-1.0000000000\n0.0000000000" }, { "input": "1 0 1", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "0 0 0", "output": "-1" } ]
1,529,101,535
2,147,483,647
Python 3
OK
TESTS
34
93
0
#!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Created on Sat Jun 16 03:38:40 2018 @author: anshul """ from math import sqrt a,b,c=list(map(int,input().split())) if a==0 and b==0 and c==0: print(-1) elif a==0 and b==0: print(0) elif a==0: print(1) ans=(-1*c)/b print(ans) else: d = b*b - 4*a*c if d<0: print(0) elif d>0: print(2) d=sqrt(d) ans1=(-b-d)/(2*a) ans2=(-b+d)/(2*a) if ans1<ans2: ans1,ans2=ans2,ans1 print(ans2) print(ans1) else: print(1) ans=(-b)/(2*a) print(ans)
Title: Equation Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: You are given an equation: Your task is to find the number of distinct roots of the equation and print all of them in ascending order. Input Specification: The first line contains three integer numbers *A*,<=*B* and *C* (<=-<=105<=≤<=*A*,<=*B*,<=*C*<=≤<=105). Any coefficient may be equal to 0. Output Specification: In case of infinite root count print the only integer -1. In case of no roots print the only integer 0. In other cases print the number of root on the first line and the roots on the following lines in the ascending order. Print roots with at least 5 digits after the decimal point. Demo Input: ['1 -5 6\n'] Demo Output: ['2\n2.0000000000\n3.0000000000'] Note: none
```python #!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Created on Sat Jun 16 03:38:40 2018 @author: anshul """ from math import sqrt a,b,c=list(map(int,input().split())) if a==0 and b==0 and c==0: print(-1) elif a==0 and b==0: print(0) elif a==0: print(1) ans=(-1*c)/b print(ans) else: d = b*b - 4*a*c if d<0: print(0) elif d>0: print(2) d=sqrt(d) ans1=(-b-d)/(2*a) ans2=(-b+d)/(2*a) if ans1<ans2: ans1,ans2=ans2,ans1 print(ans2) print(ans1) else: print(1) ans=(-b)/(2*a) print(ans) ```
3.9535
45
A
Codecraft III
PROGRAMMING
900
[ "implementation" ]
A. Codecraft III
2
256
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that. All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
[ "November\n3\n", "May\n24\n" ]
[ "February\n", "May\n" ]
none
0
[ { "input": "November\n3", "output": "February" }, { "input": "May\n24", "output": "May" }, { "input": "April\n0", "output": "April" }, { "input": "September\n0", "output": "September" }, { "input": "August\n0", "output": "August" }, { "input": "June\n1", "output": "July" }, { "input": "July\n2", "output": "September" }, { "input": "September\n3", "output": "December" }, { "input": "July\n4", "output": "November" }, { "input": "August\n24", "output": "August" }, { "input": "May\n48", "output": "May" }, { "input": "November\n47", "output": "October" }, { "input": "December\n49", "output": "January" }, { "input": "June\n99", "output": "September" }, { "input": "March\n100", "output": "July" }, { "input": "December\n1", "output": "January" }, { "input": "January\n11", "output": "December" }, { "input": "December\n0", "output": "December" }, { "input": "January\n0", "output": "January" }, { "input": "July\n77", "output": "December" }, { "input": "February\n11", "output": "January" }, { "input": "February\n22", "output": "December" }, { "input": "July\n33", "output": "April" }, { "input": "May\n44", "output": "January" }, { "input": "June\n97", "output": "July" } ]
1,659,695,118
2,147,483,647
Python 3
OK
TESTS
25
92
0
s=input() n=int(input()) l=['January','February','March','April','May','June', 'July', 'August', 'September', 'October', 'November', 'December'] print(l[(l.index(s) + n) % 12])
Title: Codecraft III Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that. All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December. Input Specification: The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III. Output Specification: Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December. Demo Input: ['November\n3\n', 'May\n24\n'] Demo Output: ['February\n', 'May\n'] Note: none
```python s=input() n=int(input()) l=['January','February','March','April','May','June', 'July', 'August', 'September', 'October', 'November', 'December'] print(l[(l.index(s) + n) % 12]) ```
3.977
507
B
Amr and Pins
PROGRAMMING
1,400
[ "geometry", "math" ]
null
null
Amr loves Geometry. One day he came up with a very interesting problem. Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*'). In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin. Help Amr to achieve his goal in minimum number of steps.
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
[ "2 0 0 0 4\n", "1 1 1 4 4\n", "4 5 6 5 6\n" ]
[ "1\n", "3\n", "0\n" ]
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter). <img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
1,000
[ { "input": "2 0 0 0 4", "output": "1" }, { "input": "1 1 1 4 4", "output": "3" }, { "input": "4 5 6 5 6", "output": "0" }, { "input": "10 20 0 40 0", "output": "1" }, { "input": "9 20 0 40 0", "output": "2" }, { "input": "5 -1 -6 -5 1", "output": "1" }, { "input": "99125 26876 -21414 14176 17443", "output": "1" }, { "input": "8066 7339 19155 -90534 -60666", "output": "8" }, { "input": "100000 -100000 -100000 100000 100000", "output": "2" }, { "input": "10 20 0 41 0", "output": "2" }, { "input": "25 -64 -6 -56 64", "output": "2" }, { "input": "125 455 450 439 721", "output": "2" }, { "input": "5 6 3 7 2", "output": "1" }, { "input": "24 130 14786 3147 2140", "output": "271" }, { "input": "125 -363 176 93 330", "output": "2" }, { "input": "1 14 30 30 14", "output": "12" }, { "input": "25 96 13 7 2", "output": "2" }, { "input": "4 100000 -100000 100000 -100000", "output": "0" }, { "input": "1 3 4 2 5", "output": "1" }, { "input": "1 -3 3 2 6", "output": "3" }, { "input": "2 7 20 13 -5", "output": "7" }, { "input": "1 1 1 1 4", "output": "2" }, { "input": "249 -54242 -30537 -45023 -89682", "output": "121" }, { "input": "4 100000 -100000 100000 -99999", "output": "1" }, { "input": "97741 23818 78751 97583 26933", "output": "1" }, { "input": "56767 -29030 51625 79823 -56297", "output": "2" }, { "input": "98260 13729 74998 23701 9253", "output": "1" }, { "input": "67377 -80131 -90254 -57320 14102", "output": "1" }, { "input": "1 100000 100000 100000 -100000", "output": "100000" }, { "input": "19312 19470 82059 58064 62231", "output": "2" }, { "input": "67398 -68747 -79056 -34193 29400", "output": "1" }, { "input": "91099 37184 -71137 75650 -3655", "output": "1" }, { "input": "46456 -2621 -23623 -98302 -99305", "output": "2" }, { "input": "100 100000 -100000 100000 -99999", "output": "1" }, { "input": "1 100000 -100000 100000 -100000", "output": "0" }, { "input": "8 0 0 0 32", "output": "2" }, { "input": "100000 100000 1 -100000 0", "output": "2" } ]
1,591,100,891
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
77
0
import math r,x1,y1,x2,y2=map(int,input().split()) k=math.sqrt((x2-x1)**2+(y2-y1)**2) print(math.ceil(k//(2*r)))
Title: Amr and Pins Time Limit: None seconds Memory Limit: None megabytes Problem Description: Amr loves Geometry. One day he came up with a very interesting problem. Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*'). In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin. Help Amr to achieve his goal in minimum number of steps. Input Specification: Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively. Output Specification: Output a single integer — minimum number of steps required to move the center of the circle to the destination point. Demo Input: ['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n'] Demo Output: ['1\n', '3\n', '0\n'] Note: In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter). <img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python import math r,x1,y1,x2,y2=map(int,input().split()) k=math.sqrt((x2-x1)**2+(y2-y1)**2) print(math.ceil(k//(2*r))) ```
0
551
A
GukiZ and Contest
PROGRAMMING
800
[ "brute force", "implementation", "sortings" ]
null
null
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
[ "3\n1 3 3\n", "1\n1\n", "5\n3 5 3 4 5\n" ]
[ "3 1 1\n", "1\n", "4 1 4 3 1\n" ]
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
500
[ { "input": "3\n1 3 3", "output": "3 1 1" }, { "input": "1\n1", "output": "1" }, { "input": "5\n3 5 3 4 5", "output": "4 1 4 3 1" }, { "input": "7\n1 3 5 4 2 2 1", "output": "6 3 1 2 4 4 6" }, { "input": "11\n5 6 4 2 9 7 6 6 6 6 7", "output": "9 4 10 11 1 2 4 4 4 4 2" }, { "input": "1\n2000", "output": "1" }, { "input": "2\n2000 2000", "output": "1 1" }, { "input": "3\n500 501 502", "output": "3 2 1" }, { "input": "10\n105 106 1 1 1 11 1000 999 1000 999", "output": "6 5 8 8 8 7 1 3 1 3" }, { "input": "6\n1 2 3 4 5 6", "output": "6 5 4 3 2 1" }, { "input": "7\n6 5 4 3 2 1 1", "output": "1 2 3 4 5 6 6" }, { "input": "8\n153 100 87 14 10 8 6 5", "output": "1 2 3 4 5 6 7 8" }, { "input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10", "output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63" }, { "input": "5\n1 2000 1 1 2000", "output": "3 1 3 3 1" } ]
1,548,915,866
2,147,483,647
Python 3
OK
TESTS
36
997
512,000
n=int(input()) ls=list(map(int,input().split())) #print(ls[::-1]) for x in ls: print(sorted(ls)[::-1].index(x)+1,end=" ")
Title: GukiZ and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*). Output Specification: In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input. Demo Input: ['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n'] Demo Output: ['3 1 1\n', '1\n', '4 1 4 3 1\n'] Note: In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
```python n=int(input()) ls=list(map(int,input().split())) #print(ls[::-1]) for x in ls: print(sorted(ls)[::-1].index(x)+1,end=" ") ```
3
842
A
Kirill And The Game
PROGRAMMING
1,200
[ "brute force", "two pointers" ]
null
null
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number. For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions). Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise. You can output each of the letters in any register.
[ "1 10 1 10 1\n", "1 5 6 10 1\n" ]
[ "YES", "NO" ]
none
500
[ { "input": "1 10 1 10 1", "output": "YES" }, { "input": "1 5 6 10 1", "output": "NO" }, { "input": "1 1 1 1 1", "output": "YES" }, { "input": "1 1 1 1 2", "output": "NO" }, { "input": "1 100000 1 100000 100000", "output": "YES" }, { "input": "1 100000 1 100000 100001", "output": "NO" }, { "input": "25 10000 200 10000 5", "output": "YES" }, { "input": "1 100000 10 100000 50000", "output": "NO" }, { "input": "91939 94921 10197 89487 1", "output": "NO" }, { "input": "30518 58228 74071 77671 1", "output": "NO" }, { "input": "46646 79126 78816 91164 5", "output": "NO" }, { "input": "30070 83417 92074 99337 2", "output": "NO" }, { "input": "13494 17544 96820 99660 6", "output": "NO" }, { "input": "96918 97018 10077 86510 9", "output": "YES" }, { "input": "13046 45594 14823 52475 1", "output": "YES" }, { "input": "29174 40572 95377 97669 4", "output": "NO" }, { "input": "79894 92433 8634 86398 4", "output": "YES" }, { "input": "96022 98362 13380 94100 6", "output": "YES" }, { "input": "79446 95675 93934 96272 3", "output": "NO" }, { "input": "5440 46549 61481 99500 10", "output": "NO" }, { "input": "21569 53580 74739 87749 3", "output": "NO" }, { "input": "72289 78297 79484 98991 7", "output": "NO" }, { "input": "88417 96645 92742 98450 5", "output": "NO" }, { "input": "71841 96625 73295 77648 8", "output": "NO" }, { "input": "87969 99230 78041 94736 4", "output": "NO" }, { "input": "4 4 1 2 3", "output": "NO" }, { "input": "150 150 1 2 100", "output": "NO" }, { "input": "99 100 1 100 50", "output": "YES" }, { "input": "7 7 3 6 2", "output": "NO" }, { "input": "10 10 1 10 1", "output": "YES" }, { "input": "36 36 5 7 6", "output": "YES" }, { "input": "73 96 1 51 51", "output": "NO" }, { "input": "3 3 1 3 2", "output": "NO" }, { "input": "10000000 10000000 1 100000 10000000", "output": "YES" }, { "input": "9222174 9829060 9418763 9955619 9092468", "output": "NO" }, { "input": "70 70 1 2 50", "output": "NO" }, { "input": "100 200 1 20 5", "output": "YES" }, { "input": "1 200000 65536 65536 65537", "output": "NO" }, { "input": "15 15 1 100 1", "output": "YES" }, { "input": "10000000 10000000 1 10000000 100000", "output": "YES" }, { "input": "10 10 2 5 4", "output": "NO" }, { "input": "67 69 7 7 9", "output": "NO" }, { "input": "100000 10000000 1 10000000 100000", "output": "YES" }, { "input": "9 12 1 2 7", "output": "NO" }, { "input": "5426234 6375745 2636512 8492816 4409404", "output": "NO" }, { "input": "6134912 6134912 10000000 10000000 999869", "output": "NO" }, { "input": "3 3 1 100 1", "output": "YES" }, { "input": "10000000 10000000 10 10000000 100000", "output": "YES" }, { "input": "4 4 1 100 2", "output": "YES" }, { "input": "8 13 1 4 7", "output": "NO" }, { "input": "10 10 100000 10000000 10000000", "output": "NO" }, { "input": "5 6 1 4 2", "output": "YES" }, { "input": "1002 1003 1 2 1000", "output": "NO" }, { "input": "4 5 1 2 2", "output": "YES" }, { "input": "5 6 1 5 1", "output": "YES" }, { "input": "15 21 2 4 7", "output": "YES" }, { "input": "4 5 3 7 1", "output": "YES" }, { "input": "15 15 3 4 4", "output": "NO" }, { "input": "3 6 1 2 2", "output": "YES" }, { "input": "2 10 3 6 3", "output": "YES" }, { "input": "1 10000000 1 10000000 100000", "output": "YES" }, { "input": "8 13 1 2 7", "output": "NO" }, { "input": "98112 98112 100000 100000 128850", "output": "NO" }, { "input": "2 2 1 2 1", "output": "YES" }, { "input": "8 8 3 4 2", "output": "YES" }, { "input": "60 60 2 3 25", "output": "NO" }, { "input": "16 17 2 5 5", "output": "NO" }, { "input": "2 4 1 3 1", "output": "YES" }, { "input": "4 5 1 2 3", "output": "NO" }, { "input": "10 10 3 4 3", "output": "NO" }, { "input": "10 10000000 999999 10000000 300", "output": "NO" }, { "input": "100 120 9 11 10", "output": "YES" }, { "input": "8 20 1 3 4", "output": "YES" }, { "input": "10 14 2 3 4", "output": "YES" }, { "input": "2000 2001 1 3 1000", "output": "YES" }, { "input": "12 13 2 3 5", "output": "NO" }, { "input": "7 7 2 3 3", "output": "NO" }, { "input": "5 8 1 10000000 4", "output": "YES" }, { "input": "5 5 1 1 4", "output": "NO" }, { "input": "5 5 1 6 2", "output": "NO" }, { "input": "200 300 4000381 4000382 4000381", "output": "NO" }, { "input": "11 17 2 5 2", "output": "NO" }, { "input": "9999999 10000000 1 10000000 999997", "output": "NO" }, { "input": "7 8 2 3 3", "output": "NO" }, { "input": "7 7 3 3 2", "output": "NO" }, { "input": "15 15 2 3 7", "output": "NO" }, { "input": "65408 65408 859 859 10000000", "output": "NO" }, { "input": "1000000 10000000 1 100000 1", "output": "NO" }, { "input": "6 12 2 3 2", "output": "YES" }, { "input": "7 8 1 3 3", "output": "NO" }, { "input": "4 4 1 2 2", "output": "YES" }, { "input": "2 3 1 2 2", "output": "YES" }, { "input": "11 14 2 3 5", "output": "NO" }, { "input": "7 7 1 10 3", "output": "NO" }, { "input": "49 50 1 2 27", "output": "NO" }, { "input": "1 10000000 1 10000000 123456", "output": "YES" }, { "input": "100000 10000000 100 10000000 100000", "output": "YES" }, { "input": "17 19 2 3 8", "output": "NO" }, { "input": "4 6 3 9 1", "output": "YES" }, { "input": "19 20 6 7 3", "output": "NO" }, { "input": "5000000 10000000 1 4999999 1", "output": "NO" } ]
1,552,816,333
2,147,483,647
Python 3
OK
TESTS
101
1,388
0
def play(l,r,x,y,k): for i in range(x,y+1): if l<=i*k<=r: return "YES" return "NO" l,r,x,y,k=map(int,input().split()) print(play(l,r,x,y,k))
Title: Kirill And The Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number. For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions). Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this? Input Specification: First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107). Output Specification: Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise. You can output each of the letters in any register. Demo Input: ['1 10 1 10 1\n', '1 5 6 10 1\n'] Demo Output: ['YES', 'NO'] Note: none
```python def play(l,r,x,y,k): for i in range(x,y+1): if l<=i*k<=r: return "YES" return "NO" l,r,x,y,k=map(int,input().split()) print(play(l,r,x,y,k)) ```
3
505
B
Mr. Kitayuta's Colorful Graph
PROGRAMMING
1,400
[ "dfs and similar", "dp", "dsu", "graphs" ]
null
null
Mr. Kitayuta has just bought an undirected graph consisting of *n* vertices and *m* edges. The vertices of the graph are numbered from 1 to *n*. Each edge, namely edge *i*, has a color *c**i*, connecting vertex *a**i* and *b**i*. Mr. Kitayuta wants you to process the following *q* queries. In the *i*-th query, he gives you two integers — *u**i* and *v**i*. Find the number of the colors that satisfy the following condition: the edges of that color connect vertex *u**i* and vertex *v**i* directly or indirectly.
The first line of the input contains space-separated two integers — *n* and *m* (2<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100), denoting the number of the vertices and the number of the edges, respectively. The next *m* lines contain space-separated three integers — *a**i*, *b**i* (1<=≤<=*a**i*<=&lt;<=*b**i*<=≤<=*n*) and *c**i* (1<=≤<=*c**i*<=≤<=*m*). Note that there can be multiple edges between two vertices. However, there are no multiple edges of the same color between two vertices, that is, if *i*<=≠<=*j*, (*a**i*,<=*b**i*,<=*c**i*)<=≠<=(*a**j*,<=*b**j*,<=*c**j*). The next line contains a integer — *q* (1<=≤<=*q*<=≤<=100), denoting the number of the queries. Then follows *q* lines, containing space-separated two integers — *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*). It is guaranteed that *u**i*<=≠<=*v**i*.
For each query, print the answer in a separate line.
[ "4 5\n1 2 1\n1 2 2\n2 3 1\n2 3 3\n2 4 3\n3\n1 2\n3 4\n1 4\n", "5 7\n1 5 1\n2 5 1\n3 5 1\n4 5 1\n1 2 2\n2 3 2\n3 4 2\n5\n1 5\n5 1\n2 5\n1 5\n1 4\n" ]
[ "2\n1\n0\n", "1\n1\n1\n1\n2\n" ]
Let's consider the first sample. - Vertex 1 and vertex 2 are connected by color 1 and 2. - Vertex 3 and vertex 4 are connected by color 3. - Vertex 1 and vertex 4 are not connected by any single color.
1,000
[ { "input": "4 5\n1 2 1\n1 2 2\n2 3 1\n2 3 3\n2 4 3\n3\n1 2\n3 4\n1 4", "output": "2\n1\n0" }, { "input": "5 7\n1 5 1\n2 5 1\n3 5 1\n4 5 1\n1 2 2\n2 3 2\n3 4 2\n5\n1 5\n5 1\n2 5\n1 5\n1 4", "output": "1\n1\n1\n1\n2" }, { "input": "2 1\n1 2 1\n1\n1 2", "output": "1" }, { "input": "2 3\n1 2 3\n1 2 2\n1 2 1\n1\n1 2", "output": "3" }, { "input": "2 5\n1 2 1\n1 2 2\n1 2 3\n1 2 4\n1 2 5\n1\n1 2", "output": "5" } ]
1,602,786,882
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
170
2,252,800
import sys, os.path from collections import* from copy import* import math mod=10**9+7 if(os.path.exists('input.txt')): sys.stdin = open("input.txt","r") sys.stdout = open("output.txt","w") def dfs(x,y,z): vis[x]=1 if(x==y): return for v in adj[x]: if(vis[v[0]]): continue if(v[1]==z): dfs(v[0],y,z) adj=defaultdict(list) n,m=map(int,input().split()) s=set() for i in range(m): a,b,c=map(int,input().split()) adj[a].append((b,c)) adj[b].append((a,c)) s.add(c) for i in adj: print(i,adj[i]) print(s) q=int(input()) for i in range(q): x,y=map(int,input().split()) count=0 for j in s: vis=[0 for i in range(n+1)] dfs(x,y,j) if(vis[y]): count+=1 print(count)
Title: Mr. Kitayuta's Colorful Graph Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Kitayuta has just bought an undirected graph consisting of *n* vertices and *m* edges. The vertices of the graph are numbered from 1 to *n*. Each edge, namely edge *i*, has a color *c**i*, connecting vertex *a**i* and *b**i*. Mr. Kitayuta wants you to process the following *q* queries. In the *i*-th query, he gives you two integers — *u**i* and *v**i*. Find the number of the colors that satisfy the following condition: the edges of that color connect vertex *u**i* and vertex *v**i* directly or indirectly. Input Specification: The first line of the input contains space-separated two integers — *n* and *m* (2<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100), denoting the number of the vertices and the number of the edges, respectively. The next *m* lines contain space-separated three integers — *a**i*, *b**i* (1<=≤<=*a**i*<=&lt;<=*b**i*<=≤<=*n*) and *c**i* (1<=≤<=*c**i*<=≤<=*m*). Note that there can be multiple edges between two vertices. However, there are no multiple edges of the same color between two vertices, that is, if *i*<=≠<=*j*, (*a**i*,<=*b**i*,<=*c**i*)<=≠<=(*a**j*,<=*b**j*,<=*c**j*). The next line contains a integer — *q* (1<=≤<=*q*<=≤<=100), denoting the number of the queries. Then follows *q* lines, containing space-separated two integers — *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*). It is guaranteed that *u**i*<=≠<=*v**i*. Output Specification: For each query, print the answer in a separate line. Demo Input: ['4 5\n1 2 1\n1 2 2\n2 3 1\n2 3 3\n2 4 3\n3\n1 2\n3 4\n1 4\n', '5 7\n1 5 1\n2 5 1\n3 5 1\n4 5 1\n1 2 2\n2 3 2\n3 4 2\n5\n1 5\n5 1\n2 5\n1 5\n1 4\n'] Demo Output: ['2\n1\n0\n', '1\n1\n1\n1\n2\n'] Note: Let's consider the first sample. - Vertex 1 and vertex 2 are connected by color 1 and 2. - Vertex 3 and vertex 4 are connected by color 3. - Vertex 1 and vertex 4 are not connected by any single color.
```python import sys, os.path from collections import* from copy import* import math mod=10**9+7 if(os.path.exists('input.txt')): sys.stdin = open("input.txt","r") sys.stdout = open("output.txt","w") def dfs(x,y,z): vis[x]=1 if(x==y): return for v in adj[x]: if(vis[v[0]]): continue if(v[1]==z): dfs(v[0],y,z) adj=defaultdict(list) n,m=map(int,input().split()) s=set() for i in range(m): a,b,c=map(int,input().split()) adj[a].append((b,c)) adj[b].append((a,c)) s.add(c) for i in adj: print(i,adj[i]) print(s) q=int(input()) for i in range(q): x,y=map(int,input().split()) count=0 for j in s: vis=[0 for i in range(n+1)] dfs(x,y,j) if(vis[y]): count+=1 print(count) ```
0
559
A
Gerald's Hexagon
PROGRAMMING
1,600
[ "brute force", "geometry", "math" ]
null
null
Gerald got a very curious hexagon for his birthday. The boy found out that all the angles of the hexagon are equal to . Then he measured the length of its sides, and found that each of them is equal to an integer number of centimeters. There the properties of the hexagon ended and Gerald decided to draw on it. He painted a few lines, parallel to the sides of the hexagon. The lines split the hexagon into regular triangles with sides of 1 centimeter. Now Gerald wonders how many triangles he has got. But there were so many of them that Gerald lost the track of his counting. Help the boy count the triangles.
The first and the single line of the input contains 6 space-separated integers *a*1,<=*a*2,<=*a*3,<=*a*4,<=*a*5 and *a*6 (1<=≤<=*a**i*<=≤<=1000) — the lengths of the sides of the hexagons in centimeters in the clockwise order. It is guaranteed that the hexagon with the indicated properties and the exactly such sides exists.
Print a single integer — the number of triangles with the sides of one 1 centimeter, into which the hexagon is split.
[ "1 1 1 1 1 1\n", "1 2 1 2 1 2\n" ]
[ "6\n", "13\n" ]
This is what Gerald's hexagon looks like in the first sample: <img class="tex-graphics" src="https://espresso.codeforces.com/84d193e27b02c38eb1eadc536602a2ec0b9f9519.png" style="max-width: 100.0%;max-height: 100.0%;"/> And that's what it looks like in the second sample: <img class="tex-graphics" src="https://espresso.codeforces.com/e29076a96da8ca864654cc6195654d9bf07d31ce.png" style="max-width: 100.0%;max-height: 100.0%;"/>
500
[ { "input": "1 1 1 1 1 1", "output": "6" }, { "input": "1 2 1 2 1 2", "output": "13" }, { "input": "2 4 5 3 3 6", "output": "83" }, { "input": "45 19 48 18 46 21", "output": "6099" }, { "input": "66 6 65 6 66 5", "output": "5832" }, { "input": "7 5 4 8 4 5", "output": "175" }, { "input": "3 2 1 4 1 2", "output": "25" }, { "input": "7 1 7 3 5 3", "output": "102" }, { "input": "9 2 9 3 8 3", "output": "174" }, { "input": "1 6 1 5 2 5", "output": "58" }, { "input": "41 64 48 61 44 68", "output": "17488" }, { "input": "1 59 2 59 1 60", "output": "3838" }, { "input": "30 36 36 32 34 38", "output": "7052" }, { "input": "50 40 46 38 52 34", "output": "11176" }, { "input": "4 60 4 60 4 60", "output": "4576" }, { "input": "718 466 729 470 714 481", "output": "2102808" }, { "input": "131 425 143 461 95 473", "output": "441966" }, { "input": "125 7 128 8 124 11", "output": "20215" }, { "input": "677 303 685 288 692 296", "output": "1365807" }, { "input": "1 577 7 576 2 582", "output": "342171" }, { "input": "1000 1000 1000 1000 1000 1000", "output": "6000000" }, { "input": "1 1 1000 1 1 1000", "output": "4002" }, { "input": "1000 1000 1 1000 1000 1", "output": "2004000" }, { "input": "1000 1 1000 999 2 999", "output": "2003997" }, { "input": "1 1000 1 1 1000 1", "output": "4002" }, { "input": "888 888 888 887 889 887", "output": "4729487" } ]
1,624,108,323
2,147,483,647
PyPy 3
OK
TESTS
26
93
0
a,b,c,d,e,f=map(int,input().split()) g,h,i,j,k,l=1,1,1,1,1,1 ans=6 ans=ans+(a-g)*(h+i)*2 j=g=a ans=ans+(b-h)*(j+i)*2 k=h=b ans=ans+(c-i)*(j+k)*2 l=i=c if e<b: x=b-1 while(x>=e): ans+=2*x+1 x-=1 elif e>b: x=b while(x<e): ans-=2*x+1 x+=1 print(ans)
Title: Gerald's Hexagon Time Limit: None seconds Memory Limit: None megabytes Problem Description: Gerald got a very curious hexagon for his birthday. The boy found out that all the angles of the hexagon are equal to . Then he measured the length of its sides, and found that each of them is equal to an integer number of centimeters. There the properties of the hexagon ended and Gerald decided to draw on it. He painted a few lines, parallel to the sides of the hexagon. The lines split the hexagon into regular triangles with sides of 1 centimeter. Now Gerald wonders how many triangles he has got. But there were so many of them that Gerald lost the track of his counting. Help the boy count the triangles. Input Specification: The first and the single line of the input contains 6 space-separated integers *a*1,<=*a*2,<=*a*3,<=*a*4,<=*a*5 and *a*6 (1<=≤<=*a**i*<=≤<=1000) — the lengths of the sides of the hexagons in centimeters in the clockwise order. It is guaranteed that the hexagon with the indicated properties and the exactly such sides exists. Output Specification: Print a single integer — the number of triangles with the sides of one 1 centimeter, into which the hexagon is split. Demo Input: ['1 1 1 1 1 1\n', '1 2 1 2 1 2\n'] Demo Output: ['6\n', '13\n'] Note: This is what Gerald's hexagon looks like in the first sample: <img class="tex-graphics" src="https://espresso.codeforces.com/84d193e27b02c38eb1eadc536602a2ec0b9f9519.png" style="max-width: 100.0%;max-height: 100.0%;"/> And that's what it looks like in the second sample: <img class="tex-graphics" src="https://espresso.codeforces.com/e29076a96da8ca864654cc6195654d9bf07d31ce.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python a,b,c,d,e,f=map(int,input().split()) g,h,i,j,k,l=1,1,1,1,1,1 ans=6 ans=ans+(a-g)*(h+i)*2 j=g=a ans=ans+(b-h)*(j+i)*2 k=h=b ans=ans+(c-i)*(j+k)*2 l=i=c if e<b: x=b-1 while(x>=e): ans+=2*x+1 x-=1 elif e>b: x=b while(x<e): ans-=2*x+1 x+=1 print(ans) ```
3
771
A
Bear and Friendship Condition
PROGRAMMING
1,500
[ "dfs and similar", "dsu", "graphs" ]
null
null
Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures). There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves. Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z. For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well. Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes.
The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends. The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input.
If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes).
[ "4 3\n1 3\n3 4\n1 4\n", "4 4\n3 1\n2 3\n3 4\n1 2\n", "10 4\n4 3\n5 10\n8 9\n1 2\n", "3 2\n1 2\n2 3\n" ]
[ "YES\n", "NO\n", "YES\n", "NO\n" ]
The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not.
250
[ { "input": "4 3\n1 3\n3 4\n1 4", "output": "YES" }, { "input": "4 4\n3 1\n2 3\n3 4\n1 2", "output": "NO" }, { "input": "10 4\n4 3\n5 10\n8 9\n1 2", "output": "YES" }, { "input": "3 2\n1 2\n2 3", "output": "NO" }, { "input": "3 0", "output": "YES" }, { "input": "15 42\n8 1\n3 14\n7 14\n12 3\n7 9\n6 7\n6 12\n14 12\n3 10\n10 14\n6 3\n3 13\n13 10\n7 12\n7 2\n6 10\n11 4\n9 3\n8 4\n7 3\n2 3\n2 10\n9 13\n2 14\n6 14\n13 2\n1 4\n13 6\n7 10\n13 14\n12 10\n13 7\n12 2\n9 10\n13 12\n2 6\n9 14\n6 9\n12 9\n11 1\n2 9\n11 8", "output": "YES" }, { "input": "20 80\n17 4\n10 1\n11 10\n17 7\n15 10\n14 15\n13 1\n18 13\n3 13\n12 7\n9 13\n10 12\n14 12\n18 11\n4 7\n10 13\n11 3\n19 8\n14 7\n10 17\n14 3\n7 11\n11 14\n19 5\n10 14\n15 17\n3 1\n9 10\n11 1\n4 1\n11 4\n9 1\n12 3\n13 7\n1 14\n11 12\n7 1\n9 12\n18 15\n17 3\n7 15\n4 10\n7 18\n7 9\n12 17\n14 18\n3 18\n18 17\n9 15\n14 4\n14 9\n9 18\n12 4\n7 10\n15 4\n4 18\n15 13\n1 12\n7 3\n13 11\n4 13\n5 8\n12 18\n12 15\n17 9\n11 15\n3 10\n18 10\n4 3\n15 3\n13 12\n9 4\n9 11\n14 17\n13 17\n3 9\n13 14\n1 17\n15 1\n17 11", "output": "NO" }, { "input": "99 26\n64 17\n48 70\n71 50\n3 50\n9 60\n61 64\n53 50\n25 12\n3 71\n71 53\n3 53\n65 70\n9 25\n9 12\n59 56\n39 60\n64 69\n65 94\n70 94\n25 60\n60 12\n94 48\n17 69\n61 17\n65 48\n61 69", "output": "NO" }, { "input": "3 1\n1 2", "output": "YES" }, { "input": "3 2\n3 2\n1 3", "output": "NO" }, { "input": "3 3\n2 3\n1 2\n1 3", "output": "YES" }, { "input": "4 2\n4 1\n2 1", "output": "NO" }, { "input": "4 3\n3 1\n2 1\n3 2", "output": "YES" }, { "input": "5 9\n1 2\n5 1\n3 1\n1 4\n2 4\n5 3\n5 4\n2 3\n5 2", "output": "NO" }, { "input": "10 5\n9 5\n1 2\n6 8\n6 3\n10 6", "output": "NO" }, { "input": "10 8\n10 7\n9 7\n5 7\n6 8\n3 5\n8 10\n3 4\n7 8", "output": "NO" }, { "input": "10 20\n8 2\n8 3\n1 8\n9 5\n2 4\n10 1\n10 5\n7 5\n7 8\n10 7\n6 5\n3 7\n1 9\n9 8\n7 2\n2 10\n2 1\n6 4\n9 7\n4 3", "output": "NO" }, { "input": "150000 10\n62562 50190\n48849 60549\n139470 18456\n21436 25159\n66845 120884\n99972 114453\n11631 99153\n62951 134848\n78114 146050\n136760 131762", "output": "YES" }, { "input": "150000 0", "output": "YES" }, { "input": "4 4\n1 2\n2 3\n3 4\n1 4", "output": "NO" }, { "input": "30 73\n25 2\n2 16\n20 12\n16 20\n7 18\n11 15\n13 11\n30 29\n16 12\n12 25\n2 1\n18 14\n9 8\n28 16\n2 9\n22 21\n1 25\n12 28\n14 7\n4 9\n26 7\n14 27\n12 2\n29 22\n1 9\n13 15\n3 10\n1 12\n8 20\n30 24\n25 20\n4 1\n4 12\n20 1\n8 4\n2 28\n25 16\n16 8\n20 4\n9 12\n21 30\n23 11\n19 6\n28 4\n29 21\n9 28\n30 10\n22 24\n25 8\n27 26\n25 4\n28 20\n9 25\n24 29\n20 9\n18 26\n1 28\n30 22\n23 15\n28 27\n8 2\n23 13\n12 8\n14 26\n16 4\n28 25\n8 1\n4 2\n9 16\n20 2\n18 27\n28 8\n27 7", "output": "NO" }, { "input": "5 4\n1 2\n2 5\n3 4\n4 5", "output": "NO" }, { "input": "4 4\n1 2\n2 3\n3 4\n4 1", "output": "NO" }, { "input": "6 6\n1 2\n2 4\n4 3\n1 5\n5 6\n6 3", "output": "NO" }, { "input": "3 2\n1 2\n1 3", "output": "NO" }, { "input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n1 6", "output": "NO" }, { "input": "4 4\n1 2\n1 3\n2 4\n3 4", "output": "NO" }, { "input": "6 9\n1 4\n1 5\n1 6\n2 4\n2 5\n2 6\n3 4\n3 5\n3 6", "output": "NO" }, { "input": "4 3\n1 2\n1 3\n3 4", "output": "NO" }, { "input": "4 3\n1 2\n1 3\n2 4", "output": "NO" }, { "input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n6 1", "output": "NO" }, { "input": "4 3\n1 2\n1 3\n1 4", "output": "NO" }, { "input": "150000 3\n150000 149999\n149998 149999\n149998 150000", "output": "YES" }, { "input": "10 15\n1 2\n1 3\n2 4\n2 5\n3 4\n3 5\n4 5\n1 6\n6 7\n6 8\n7 9\n7 10\n8 9\n8 10\n9 10", "output": "NO" }, { "input": "5 5\n1 2\n2 3\n3 4\n4 5\n5 1", "output": "NO" }, { "input": "5 4\n1 2\n1 3\n1 4\n1 5", "output": "NO" }, { "input": "9 9\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 1", "output": "NO" }, { "input": "4 5\n1 2\n1 3\n1 4\n2 3\n3 4", "output": "NO" }, { "input": "4 4\n1 2\n1 3\n4 2\n4 3", "output": "NO" }, { "input": "5 5\n1 4\n5 3\n5 1\n2 3\n4 5", "output": "NO" }, { "input": "4 5\n1 2\n1 3\n2 3\n1 4\n2 4", "output": "NO" }, { "input": "4 5\n1 2\n1 3\n1 4\n2 3\n2 4", "output": "NO" }, { "input": "6 12\n1 2\n1 4\n1 5\n1 6\n2 3\n2 5\n2 6\n3 4\n3 5\n3 6\n4 5\n4 6", "output": "NO" }, { "input": "1000 4\n100 132\n100 164\n196 132\n196 164", "output": "NO" } ]
1,630,356,518
2,147,483,647
PyPy 3
OK
TESTS
96
623
62,054,400
from sys import stdin from collections import deque def main(): input = stdin.readline n,m = [int(i) for i in input().split()] graph = {i+1:set() for i in range(n)} for _ in range(m): a,b = [int(i) for i in input().split()] graph[a].add(b) graph[b].add(a) seen = set() for i in range(1,n+1): if i in seen: continue seen_i = {i} que = deque([i]) while que: cur = que.popleft() for nxt in graph[cur]: if nxt not in seen_i: seen_i.add(nxt) que.append(nxt) total_edges = 0 for i in seen_i: total_edges += len(graph[i]) total_edges //= 2 if total_edges != len(seen_i) * (len(seen_i)-1) // 2: print("NO") exit() seen |= seen_i print("Yes") if __name__ == '__main__': main()
Title: Bear and Friendship Condition Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures). There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves. Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z. For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well. Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes. Input Specification: The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends. The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input. Output Specification: If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes). Demo Input: ['4 3\n1 3\n3 4\n1 4\n', '4 4\n3 1\n2 3\n3 4\n1 2\n', '10 4\n4 3\n5 10\n8 9\n1 2\n', '3 2\n1 2\n2 3\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n', 'NO\n'] Note: The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not.
```python from sys import stdin from collections import deque def main(): input = stdin.readline n,m = [int(i) for i in input().split()] graph = {i+1:set() for i in range(n)} for _ in range(m): a,b = [int(i) for i in input().split()] graph[a].add(b) graph[b].add(a) seen = set() for i in range(1,n+1): if i in seen: continue seen_i = {i} que = deque([i]) while que: cur = que.popleft() for nxt in graph[cur]: if nxt not in seen_i: seen_i.add(nxt) que.append(nxt) total_edges = 0 for i in seen_i: total_edges += len(graph[i]) total_edges //= 2 if total_edges != len(seen_i) * (len(seen_i)-1) // 2: print("NO") exit() seen |= seen_i print("Yes") if __name__ == '__main__': main() ```
3
803
C
Maximal GCD
PROGRAMMING
1,900
[ "constructive algorithms", "greedy", "math" ]
null
null
You are given positive integer number *n*. You should create such strictly increasing sequence of *k* positive numbers *a*1,<=*a*2,<=...,<=*a**k*, that their sum is equal to *n* and greatest common divisor is maximal. Greatest common divisor of sequence is maximum of such numbers that every element of sequence is divisible by them. If there is no possible sequence then output -1.
The first line consists of two numbers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1010).
If the answer exists then output *k* numbers — resulting sequence. Otherwise output -1. If there are multiple answers, print any of them.
[ "6 3\n", "8 2\n", "5 3\n" ]
[ "1 2 3\n", "2 6\n", "-1\n" ]
none
0
[ { "input": "6 3", "output": "1 2 3" }, { "input": "8 2", "output": "2 6" }, { "input": "5 3", "output": "-1" }, { "input": "1 1", "output": "1" }, { "input": "1 2", "output": "-1" }, { "input": "2 1", "output": "2" }, { "input": "2 10000000000", "output": "-1" }, { "input": "5 1", "output": "5" }, { "input": "6 2", "output": "2 4" }, { "input": "24 2", "output": "8 16" }, { "input": "24 3", "output": "4 8 12" }, { "input": "24 4", "output": "2 4 6 12" }, { "input": "24 5", "output": "1 2 3 4 14" }, { "input": "479001600 2", "output": "159667200 319334400" }, { "input": "479001600 3", "output": "79833600 159667200 239500800" }, { "input": "479001600 4", "output": "47900160 95800320 143700480 191600640" }, { "input": "479001600 5", "output": "31933440 63866880 95800320 127733760 159667200" }, { "input": "479001600 6", "output": "22809600 45619200 68428800 91238400 114048000 136857600" }, { "input": "3000000021 1", "output": "3000000021" }, { "input": "3000000021 2", "output": "1000000007 2000000014" }, { "input": "3000000021 3", "output": "3 6 3000000012" }, { "input": "3000000021 4", "output": "3 6 9 3000000003" }, { "input": "3000000021 50000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "3000000021 100000", "output": "-1" }, { "input": "10000000000 100", "output": "1953125 3906250 5859375 7812500 9765625 11718750 13671875 15625000 17578125 19531250 21484375 23437500 25390625 27343750 29296875 31250000 33203125 35156250 37109375 39062500 41015625 42968750 44921875 46875000 48828125 50781250 52734375 54687500 56640625 58593750 60546875 62500000 64453125 66406250 68359375 70312500 72265625 74218750 76171875 78125000 80078125 82031250 83984375 85937500 87890625 89843750 91796875 93750000 95703125 97656250 99609375 101562500 103515625 105468750 107421875 109375000 1113281..." }, { "input": "10000000000 2000", "output": "4000 8000 12000 16000 20000 24000 28000 32000 36000 40000 44000 48000 52000 56000 60000 64000 68000 72000 76000 80000 84000 88000 92000 96000 100000 104000 108000 112000 116000 120000 124000 128000 132000 136000 140000 144000 148000 152000 156000 160000 164000 168000 172000 176000 180000 184000 188000 192000 196000 200000 204000 208000 212000 216000 220000 224000 228000 232000 236000 240000 244000 248000 252000 256000 260000 264000 268000 272000 276000 280000 284000 288000 292000 296000 300000 304000 30800..." }, { "input": "10000000000 5000", "output": "640 1280 1920 2560 3200 3840 4480 5120 5760 6400 7040 7680 8320 8960 9600 10240 10880 11520 12160 12800 13440 14080 14720 15360 16000 16640 17280 17920 18560 19200 19840 20480 21120 21760 22400 23040 23680 24320 24960 25600 26240 26880 27520 28160 28800 29440 30080 30720 31360 32000 32640 33280 33920 34560 35200 35840 36480 37120 37760 38400 39040 39680 40320 40960 41600 42240 42880 43520 44160 44800 45440 46080 46720 47360 48000 48640 49280 49920 50560 51200 51840 52480 53120 53760 54400 55040 55680 56320..." }, { "input": "10000000000 100000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 100000000", "output": "-1" }, { "input": "10000000000 10000000000", "output": "-1" }, { "input": "10000000000 100001", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "1 4000000000", "output": "-1" }, { "input": "4294967296 4294967296", "output": "-1" }, { "input": "71227122 9603838834", "output": "-1" }, { "input": "10000000000 9603838835", "output": "-1" }, { "input": "5 5999999999", "output": "-1" }, { "input": "2 9324327498", "output": "-1" }, { "input": "9 2", "output": "3 6" }, { "input": "10000000000 4294967296", "output": "-1" }, { "input": "1 3500000000", "output": "-1" }, { "input": "10000000000 4000000000", "output": "-1" }, { "input": "2000 9324327498", "output": "-1" }, { "input": "10000000000 8589934592", "output": "-1" }, { "input": "5000150001 100001", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 3037000500", "output": "-1" }, { "input": "9400000000 9324327498", "output": "-1" }, { "input": "10000000000 3307000500", "output": "-1" }, { "input": "2 4000000000", "output": "-1" }, { "input": "1000 4294967295", "output": "-1" }, { "input": "36 3", "output": "6 12 18" }, { "input": "2147483648 4294967296", "output": "-1" }, { "input": "999 4294967295", "output": "-1" }, { "input": "10000000000 130000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 140000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 6074001000", "output": "-1" }, { "input": "12344321 1", "output": "12344321" }, { "input": "2 2", "output": "-1" }, { "input": "28 7", "output": "1 2 3 4 5 6 7" }, { "input": "1 1", "output": "1" }, { "input": "1 2", "output": "-1" }, { "input": "1 3", "output": "-1" }, { "input": "1 4", "output": "-1" }, { "input": "1 5", "output": "-1" }, { "input": "1 6", "output": "-1" }, { "input": "1 7", "output": "-1" }, { "input": "1 8", "output": "-1" }, { "input": "1 9", "output": "-1" }, { "input": "1 10", "output": "-1" }, { "input": "2 1", "output": "2" }, { "input": "2 2", "output": "-1" }, { "input": "2 3", "output": "-1" }, { "input": "2 4", "output": "-1" }, { "input": "2 5", "output": "-1" }, { "input": "2 6", "output": "-1" }, { "input": "2 7", "output": "-1" }, { "input": "2 8", "output": "-1" }, { "input": "2 9", "output": "-1" }, { "input": "2 10", "output": "-1" }, { "input": "3 1", "output": "3" }, { "input": "3 2", "output": "1 2" }, { "input": "3 3", "output": "-1" }, { "input": "3 4", "output": "-1" }, { "input": "3 5", "output": "-1" }, { "input": "3 6", "output": "-1" }, { "input": "3 7", "output": "-1" }, { "input": "3 8", "output": "-1" }, { "input": "3 9", "output": "-1" }, { "input": "3 10", "output": "-1" }, { "input": "4 1", "output": "4" }, { "input": "4 2", "output": "1 3" }, { "input": "4 3", "output": "-1" }, { "input": "4 4", "output": "-1" }, { "input": "4 5", "output": "-1" }, { "input": "4 6", "output": "-1" }, { "input": "4 7", "output": "-1" }, { "input": "4 8", "output": "-1" }, { "input": "4 9", "output": "-1" }, { "input": "4 10", "output": "-1" }, { "input": "5 1", "output": "5" }, { "input": "5 2", "output": "1 4" }, { "input": "5 3", "output": "-1" }, { "input": "5 4", "output": "-1" }, { "input": "5 5", "output": "-1" }, { "input": "5 6", "output": "-1" }, { "input": "5 7", "output": "-1" }, { "input": "5 8", "output": "-1" }, { "input": "5 9", "output": "-1" }, { "input": "5 10", "output": "-1" }, { "input": "6 1", "output": "6" }, { "input": "6 2", "output": "2 4" }, { "input": "6 3", "output": "1 2 3" }, { "input": "6 4", "output": "-1" }, { "input": "6 5", "output": "-1" }, { "input": "6 6", "output": "-1" }, { "input": "6 7", "output": "-1" }, { "input": "6 8", "output": "-1" }, { "input": "6 9", "output": "-1" }, { "input": "6 10", "output": "-1" }, { "input": "7 1", "output": "7" }, { "input": "7 2", "output": "1 6" }, { "input": "7 3", "output": "1 2 4" }, { "input": "7 4", "output": "-1" }, { "input": "7 5", "output": "-1" }, { "input": "7 6", "output": "-1" }, { "input": "7 7", "output": "-1" }, { "input": "7 8", "output": "-1" }, { "input": "7 9", "output": "-1" }, { "input": "7 10", "output": "-1" }, { "input": "8 1", "output": "8" }, { "input": "8 2", "output": "2 6" }, { "input": "8 3", "output": "1 2 5" }, { "input": "8 4", "output": "-1" }, { "input": "8 5", "output": "-1" }, { "input": "8 6", "output": "-1" }, { "input": "8 7", "output": "-1" }, { "input": "8 8", "output": "-1" }, { "input": "8 9", "output": "-1" }, { "input": "8 10", "output": "-1" } ]
1,564,559,004
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
12
109
0
import math n, k = map(int, input().split()) Ans = [] d = (k+1)*k//2 if n < d: print(-1) elif n == d: for x in range(1, k): Ans.append(x) d -= x Ans.append(d) print(*Ans) else: if d >= int(math.sqrt(n)): for i in range(int(math.sqrt(n)), n): if n % i == 0: l = i nod = n//i if l >= d: for x in range(1, k): Ans.append(nod*x) l -= x Ans.append(l*nod) break else: for i in range(1, int(math.sqrt(n))): if n % i == 0: l = i nod = n//i if l >= d: for x in range(1, k): Ans.append(nod*x) l -= x Ans.append(l*nod) break if len(Ans) != 0: print(*Ans) else: print(-1)
Title: Maximal GCD Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given positive integer number *n*. You should create such strictly increasing sequence of *k* positive numbers *a*1,<=*a*2,<=...,<=*a**k*, that their sum is equal to *n* and greatest common divisor is maximal. Greatest common divisor of sequence is maximum of such numbers that every element of sequence is divisible by them. If there is no possible sequence then output -1. Input Specification: The first line consists of two numbers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1010). Output Specification: If the answer exists then output *k* numbers — resulting sequence. Otherwise output -1. If there are multiple answers, print any of them. Demo Input: ['6 3\n', '8 2\n', '5 3\n'] Demo Output: ['1 2 3\n', '2 6\n', '-1\n'] Note: none
```python import math n, k = map(int, input().split()) Ans = [] d = (k+1)*k//2 if n < d: print(-1) elif n == d: for x in range(1, k): Ans.append(x) d -= x Ans.append(d) print(*Ans) else: if d >= int(math.sqrt(n)): for i in range(int(math.sqrt(n)), n): if n % i == 0: l = i nod = n//i if l >= d: for x in range(1, k): Ans.append(nod*x) l -= x Ans.append(l*nod) break else: for i in range(1, int(math.sqrt(n))): if n % i == 0: l = i nod = n//i if l >= d: for x in range(1, k): Ans.append(nod*x) l -= x Ans.append(l*nod) break if len(Ans) != 0: print(*Ans) else: print(-1) ```
0
385
B
Bear and Strings
PROGRAMMING
1,200
[ "brute force", "greedy", "implementation", "math", "strings" ]
null
null
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring. String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*. Help the bear cope with the given problem.
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Print a single number — the answer to the problem.
[ "bearbtear\n", "bearaabearc\n" ]
[ "6\n", "20\n" ]
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9). In the second sample, the following pairs (*i*, *j*) match: (1,  4), (1,  5), (1,  6), (1,  7), (1,  8), (1,  9), (1,  10), (1,  11), (2,  10), (2,  11), (3,  10), (3,  11), (4,  10), (4,  11), (5,  10), (5,  11), (6,  10), (6,  11), (7,  10), (7,  11).
1,000
[ { "input": "bearbtear", "output": "6" }, { "input": "bearaabearc", "output": "20" }, { "input": "pbearbearhbearzqbearjkterasjhy", "output": "291" }, { "input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb", "output": "4419" }, { "input": "bear", "output": "1" }, { "input": "a", "output": "0" }, { "input": "be", "output": "0" } ]
1,608,195,501
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
#include <vector> #include <iostream> #include <algorithm> #include <climits> #include <numeric> #define ll long long using namespace std; int main(){ string s; cin>>s; int cnt=0; for(int i=0;i<s.length();i++){ vector<char> got; int present=0; for(int j=i;j<s.length();j++){ if(present)cnt++; else{ got.push_back(s[j]); if(got.size()>=4){ int n=got.size(); if(got[n-4]=='b' and got[n-3]=='e' and got[n-2]=='a' and got[n-1]=='r'){ present=true; cnt++; } } } } } cout<<cnt<<endl; }
Title: Bear and Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring. String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*. Help the bear cope with the given problem. Input Specification: The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters. Output Specification: Print a single number — the answer to the problem. Demo Input: ['bearbtear\n', 'bearaabearc\n'] Demo Output: ['6\n', '20\n'] Note: In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9). In the second sample, the following pairs (*i*, *j*) match: (1,  4), (1,  5), (1,  6), (1,  7), (1,  8), (1,  9), (1,  10), (1,  11), (2,  10), (2,  11), (3,  10), (3,  11), (4,  10), (4,  11), (5,  10), (5,  11), (6,  10), (6,  11), (7,  10), (7,  11).
```python #include <vector> #include <iostream> #include <algorithm> #include <climits> #include <numeric> #define ll long long using namespace std; int main(){ string s; cin>>s; int cnt=0; for(int i=0;i<s.length();i++){ vector<char> got; int present=0; for(int j=i;j<s.length();j++){ if(present)cnt++; else{ got.push_back(s[j]); if(got.size()>=4){ int n=got.size(); if(got[n-4]=='b' and got[n-3]=='e' and got[n-2]=='a' and got[n-1]=='r'){ present=true; cnt++; } } } } } cout<<cnt<<endl; } ```
-1
339
A
Helpful Maths
PROGRAMMING
800
[ "greedy", "implementation", "sortings", "strings" ]
null
null
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation. The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3. You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Print the new sum that Xenia can count.
[ "3+2+1\n", "1+1+3+1+3\n", "2\n" ]
[ "1+2+3\n", "1+1+1+3+3\n", "2\n" ]
none
500
[ { "input": "3+2+1", "output": "1+2+3" }, { "input": "1+1+3+1+3", "output": "1+1+1+3+3" }, { "input": "2", "output": "2" }, { "input": "2+2+1+1+3", "output": "1+1+2+2+3" }, { "input": "2+1+2+2+2+3+1+3+1+2", "output": "1+1+1+2+2+2+2+2+3+3" }, { "input": "1+2+1+2+2+2+2+1+3+3", "output": "1+1+1+2+2+2+2+2+3+3" }, { "input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1", "output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3" }, { "input": "1", "output": "1" }, { "input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1", "output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3" }, { "input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2", "output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3" }, { "input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3", "output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3" }, { "input": "3", "output": "3" }, { "input": "1+1", "output": "1+1" }, { "input": "1+2", "output": "1+2" }, { "input": "1+3", "output": "1+3" }, { "input": "2+1", "output": "1+2" }, { "input": "2+2", "output": "2+2" }, { "input": "2+3", "output": "2+3" }, { "input": "3+1", "output": "1+3" }, { "input": "3+2", "output": "2+3" }, { "input": "3+3", "output": "3+3" } ]
1,698,474,644
2,147,483,647
Python 3
OK
TESTS
21
92
0
s=input().split("+") sort=sorted(s) new="+".join(sort) print(new)
Title: Helpful Maths Time Limit: None seconds Memory Limit: None megabytes Problem Description: Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation. The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3. You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum. Input Specification: The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long. Output Specification: Print the new sum that Xenia can count. Demo Input: ['3+2+1\n', '1+1+3+1+3\n', '2\n'] Demo Output: ['1+2+3\n', '1+1+1+3+3\n', '2\n'] Note: none
```python s=input().split("+") sort=sorted(s) new="+".join(sort) print(new) ```
3
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output one number — the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,607,426,586
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
122
0
M = input() N = input() M = int (M) N = int(N) s = M * N if s % 2 != 0: s = s - 1 print(s / 2)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). Output Specification: Output one number — the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python M = input() N = input() M = int (M) N = int(N) s = M * N if s % 2 != 0: s = s - 1 print(s / 2) ```
-1
659
A
Round House
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Vasya lives in a round building, whose entrances are numbered sequentially by integers from 1 to *n*. Entrance *n* and entrance 1 are adjacent. Today Vasya got bored and decided to take a walk in the yard. Vasya lives in entrance *a* and he decided that during his walk he will move around the house *b* entrances in the direction of increasing numbers (in this order entrance *n* should be followed by entrance 1). The negative value of *b* corresponds to moving |*b*| entrances in the order of decreasing numbers (in this order entrance 1 is followed by entrance *n*). If *b*<==<=0, then Vasya prefers to walk beside his entrance. Help Vasya to determine the number of the entrance, near which he will be at the end of his walk.
The single line of the input contains three space-separated integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*a*<=≤<=*n*,<=<=-<=100<=≤<=*b*<=≤<=100) — the number of entrances at Vasya's place, the number of his entrance and the length of his walk, respectively.
Print a single integer *k* (1<=≤<=*k*<=≤<=*n*) — the number of the entrance where Vasya will be at the end of his walk.
[ "6 2 -5\n", "5 1 3\n", "3 2 7\n" ]
[ "3\n", "4\n", "3\n" ]
The first example is illustrated by the picture in the statements.
500
[ { "input": "6 2 -5", "output": "3" }, { "input": "5 1 3", "output": "4" }, { "input": "3 2 7", "output": "3" }, { "input": "1 1 0", "output": "1" }, { "input": "1 1 -1", "output": "1" }, { "input": "1 1 1", "output": "1" }, { "input": "100 1 -1", "output": "100" }, { "input": "100 54 100", "output": "54" }, { "input": "100 37 -100", "output": "37" }, { "input": "99 41 0", "output": "41" }, { "input": "97 37 -92", "output": "42" }, { "input": "99 38 59", "output": "97" }, { "input": "35 34 1", "output": "35" }, { "input": "48 1 -1", "output": "48" }, { "input": "87 65 -76", "output": "76" }, { "input": "76 26 29", "output": "55" }, { "input": "100 65 0", "output": "65" }, { "input": "2 1 100", "output": "1" }, { "input": "3 2 -100", "output": "1" }, { "input": "1 1 100", "output": "1" }, { "input": "1 1 -100", "output": "1" }, { "input": "3 1 -100", "output": "3" }, { "input": "4 3 -100", "output": "3" }, { "input": "3 2 -12", "output": "2" }, { "input": "2 2 -100", "output": "2" }, { "input": "3 2 -90", "output": "2" }, { "input": "6 2 -10", "output": "4" }, { "input": "3 3 -100", "output": "2" }, { "input": "5 2 4", "output": "1" }, { "input": "6 4 5", "output": "3" }, { "input": "3 2 -6", "output": "2" }, { "input": "5 1 -99", "output": "2" }, { "input": "6 2 5", "output": "1" }, { "input": "10 1 -100", "output": "1" }, { "input": "2 2 1", "output": "1" }, { "input": "3 3 1", "output": "1" }, { "input": "6 4 4", "output": "2" }, { "input": "17 17 2", "output": "2" }, { "input": "6 6 1", "output": "1" }, { "input": "5 3 -2", "output": "1" }, { "input": "6 2 -100", "output": "4" }, { "input": "5 3 -100", "output": "3" }, { "input": "5 4 3", "output": "2" }, { "input": "3 2 2", "output": "1" }, { "input": "5 5 2", "output": "2" }, { "input": "3 2 5", "output": "1" }, { "input": "5 5 -1", "output": "4" }, { "input": "5 3 3", "output": "1" }, { "input": "4 2 3", "output": "1" }, { "input": "88 76 74", "output": "62" } ]
1,493,422,547
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
61
4,608,000
n,a,b=map(int,input().split(' ')) if(b>0): print((a+b)%6) if(b<0): print(-(a+b)%6)
Title: Round House Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya lives in a round building, whose entrances are numbered sequentially by integers from 1 to *n*. Entrance *n* and entrance 1 are adjacent. Today Vasya got bored and decided to take a walk in the yard. Vasya lives in entrance *a* and he decided that during his walk he will move around the house *b* entrances in the direction of increasing numbers (in this order entrance *n* should be followed by entrance 1). The negative value of *b* corresponds to moving |*b*| entrances in the order of decreasing numbers (in this order entrance 1 is followed by entrance *n*). If *b*<==<=0, then Vasya prefers to walk beside his entrance. Help Vasya to determine the number of the entrance, near which he will be at the end of his walk. Input Specification: The single line of the input contains three space-separated integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*a*<=≤<=*n*,<=<=-<=100<=≤<=*b*<=≤<=100) — the number of entrances at Vasya's place, the number of his entrance and the length of his walk, respectively. Output Specification: Print a single integer *k* (1<=≤<=*k*<=≤<=*n*) — the number of the entrance where Vasya will be at the end of his walk. Demo Input: ['6 2 -5\n', '5 1 3\n', '3 2 7\n'] Demo Output: ['3\n', '4\n', '3\n'] Note: The first example is illustrated by the picture in the statements.
```python n,a,b=map(int,input().split(' ')) if(b>0): print((a+b)%6) if(b<0): print(-(a+b)%6) ```
0
190
B
Surrounded
PROGRAMMING
1,800
[ "geometry" ]
null
null
So, the Berland is at war with its eternal enemy Flatland again, and Vasya, an accountant, was assigned to fulfil his duty to the nation. Right now the situation in Berland is dismal — their both cities are surrounded! The armies of flatlanders stand on the borders of circles, the circles' centers are in the surrounded cities. At any moment all points of the flatland ring can begin to move quickly in the direction of the city — that's the strategy the flatlanders usually follow when they besiege cities. The berlanders are sure that they can repel the enemy's attack if they learn the exact time the attack starts. For that they need to construct a radar that would register any movement at the distance of at most *r* from it. Thus, we can install a radar at such point, that at least one point of the enemy ring will be in its detecting range (that is, at a distance of at most *r*). Then the radar can immediately inform about the enemy's attack. Due to the newest technologies, we can place a radar at any point without any problems. But the problem is that the berlanders have the time to make only one radar. Besides, the larger the detection radius (*r*) is, the more the radar costs. That's why Vasya's task (that is, your task) is to find the minimum possible detection radius for the radar. In other words, your task is to find the minimum radius *r* (*r*<=≥<=0) such, that a radar with radius *r* can be installed at some point and it can register the start of the movements of both flatland rings from that point. In this problem you can consider the cities as material points, the attacking enemy rings - as circles with centers in the cities, the radar's detection range — as a disk (including the border) with the center at the point where the radar is placed.
The input files consist of two lines. Each line represents the city and the flatland ring that surrounds it as three space-separated integers *x**i*, *y**i*, *r**i* (|*x**i*|,<=|*y**i*|<=≤<=104; 1<=≤<=*r**i*<=≤<=104) — the city's coordinates and the distance from the city to the flatlanders, correspondingly. It is guaranteed that the cities are located at different points.
Print a single real number — the minimum detection radius of the described radar. The answer is considered correct if the absolute or relative error does not exceed 10<=-<=6.
[ "0 0 1\n6 0 3\n", "-10 10 3\n10 -10 3\n" ]
[ "1.000000000000000", "11.142135623730951" ]
The figure below shows the answer to the first sample. In this sample the best decision is to put the radar at point with coordinates (2, 0). The figure below shows the answer for the second sample. In this sample the best decision is to put the radar at point with coordinates (0, 0).
1,000
[ { "input": "0 0 1\n6 0 3", "output": "1.000000000000000" }, { "input": "-10 10 3\n10 -10 3", "output": "11.142135623730951" }, { "input": "2 1 3\n8 9 5", "output": "1.000000000000000" }, { "input": "0 0 1\n-10 -10 9", "output": "2.071067811865475" }, { "input": "10000 -9268 1\n-9898 9000 10", "output": "13500.519287710202000" }, { "input": "10000 10000 1\n-10000 -10000 1", "output": "14141.135623730950000" }, { "input": "123 21 50\n10 100 1000", "output": "406.061621719103360" }, { "input": "0 3278 2382\n2312 1 1111", "output": "258.747677968983450" }, { "input": "3 4 5\n5 12 13", "output": "0.000000000000000" }, { "input": "-2 7 5\n4 0 6", "output": "0.000000000000000" }, { "input": "4 0 2\n6 -1 10", "output": "2.881966011250105" }, { "input": "41 17 3\n71 -86 10", "output": "47.140003728560643" }, { "input": "761 641 6\n506 -293 5", "output": "478.592191632957450" }, { "input": "-5051 -7339 9\n-9030 755 8", "output": "4501.080828635849700" }, { "input": "0 5 2\n8 -4 94", "output": "39.979202710603850" }, { "input": "83 -64 85\n27 80 89", "output": "0.000000000000000" }, { "input": "-655 -750 68\n905 -161 68", "output": "765.744715125679250" }, { "input": "1055 -5271 60\n-2992 8832 38", "output": "7287.089182936641900" }, { "input": "4 0 201\n-6 4 279", "output": "33.614835192865499" }, { "input": "-34 -5 836\n52 -39 706", "output": "18.761487913212431" }, { "input": "659 -674 277\n-345 -556 127", "output": "303.455240352694320" }, { "input": "4763 2945 956\n3591 9812 180", "output": "2915.147750239716500" }, { "input": "3 -7 5749\n1 -6 9750", "output": "1999.381966011250100" }, { "input": "28 -63 2382\n43 -83 1364", "output": "496.500000000000000" }, { "input": "315 -532 7813\n407 -157 2121", "output": "2652.939776235497000" }, { "input": "-9577 9051 5276\n-4315 -1295 8453", "output": "0.000000000000000" }, { "input": "-7 -10 1\n-4 3 1", "output": "5.670832032063167" }, { "input": "-74 27 535\n18 84 1", "output": "212.886692948961240" }, { "input": "-454 -721 72\n-33 279 911", "output": "51.003686623418254" }, { "input": "-171 762 304\n-428 -85 523", "output": "29.065814314662131" }, { "input": "192 -295 1386\n-54 -78 1", "output": "528.483994683445640" }, { "input": "-5134 -9860 5513\n6291 -855 9034", "output": "0.093506651303098" }, { "input": "6651 8200 610\n-9228 9387 10000", "output": "2656.651995660197400" }, { "input": "6370 7728 933\n4595 3736 2748", "output": "343.915768575204200" }, { "input": "-6 3 8\n7 2 1", "output": "2.019202405202649" }, { "input": "0 -1 1\n1 -1 1", "output": "0.000000000000000" }, { "input": "0 1 3\n1 -1 1", "output": "0.000000000000000" }, { "input": "-2 0 1\n3 -2 1", "output": "1.692582403567252" }, { "input": "-10000 42 10000\n10000 43 10000", "output": "0.000012499999992" }, { "input": "103 104 5\n97 96 5", "output": "0.000000000000000" }, { "input": "2587 4850 3327\n3278 -204 1774", "output": "0.009605941526345" }, { "input": "826 4417 2901\n833 -2286 3802", "output": "0.001827539409235" }, { "input": "1003 -5005 3399\n-6036 -1729 4365", "output": "0.000032199896827" } ]
1,535,198,806
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
#include<stdio.h> #include<string.h> #include<string> #include<stdlib.h> #include<math.h> #include<algorithm> #include<queue> #include<stack> #include<set> #include<map> #include<vector> #include<iostream> using namespace std; #define ll long long int main() { ll a,b,r,x,y,e; scanf("%I64d%I64d%I64d%I64d%I64d%I64d",&a,&b,&r,&x,&y,&e); double z=sqrt(((double)a-x)*(a-x)+((double)b-y)*(b-y)); if(r>e) swap(r,e); if(z>r+e) printf("%.10f\n",(z-r-e)/2); else if(z<r+e&&z<e-r) printf("%.10f\n",(e-z-r)/2); else puts("0.000000000000000"); return 0; }
Title: Surrounded Time Limit: None seconds Memory Limit: None megabytes Problem Description: So, the Berland is at war with its eternal enemy Flatland again, and Vasya, an accountant, was assigned to fulfil his duty to the nation. Right now the situation in Berland is dismal — their both cities are surrounded! The armies of flatlanders stand on the borders of circles, the circles' centers are in the surrounded cities. At any moment all points of the flatland ring can begin to move quickly in the direction of the city — that's the strategy the flatlanders usually follow when they besiege cities. The berlanders are sure that they can repel the enemy's attack if they learn the exact time the attack starts. For that they need to construct a radar that would register any movement at the distance of at most *r* from it. Thus, we can install a radar at such point, that at least one point of the enemy ring will be in its detecting range (that is, at a distance of at most *r*). Then the radar can immediately inform about the enemy's attack. Due to the newest technologies, we can place a radar at any point without any problems. But the problem is that the berlanders have the time to make only one radar. Besides, the larger the detection radius (*r*) is, the more the radar costs. That's why Vasya's task (that is, your task) is to find the minimum possible detection radius for the radar. In other words, your task is to find the minimum radius *r* (*r*<=≥<=0) such, that a radar with radius *r* can be installed at some point and it can register the start of the movements of both flatland rings from that point. In this problem you can consider the cities as material points, the attacking enemy rings - as circles with centers in the cities, the radar's detection range — as a disk (including the border) with the center at the point where the radar is placed. Input Specification: The input files consist of two lines. Each line represents the city and the flatland ring that surrounds it as three space-separated integers *x**i*, *y**i*, *r**i* (|*x**i*|,<=|*y**i*|<=≤<=104; 1<=≤<=*r**i*<=≤<=104) — the city's coordinates and the distance from the city to the flatlanders, correspondingly. It is guaranteed that the cities are located at different points. Output Specification: Print a single real number — the minimum detection radius of the described radar. The answer is considered correct if the absolute or relative error does not exceed 10<=-<=6. Demo Input: ['0 0 1\n6 0 3\n', '-10 10 3\n10 -10 3\n'] Demo Output: ['1.000000000000000', '11.142135623730951'] Note: The figure below shows the answer to the first sample. In this sample the best decision is to put the radar at point with coordinates (2, 0). The figure below shows the answer for the second sample. In this sample the best decision is to put the radar at point with coordinates (0, 0).
```python #include<stdio.h> #include<string.h> #include<string> #include<stdlib.h> #include<math.h> #include<algorithm> #include<queue> #include<stack> #include<set> #include<map> #include<vector> #include<iostream> using namespace std; #define ll long long int main() { ll a,b,r,x,y,e; scanf("%I64d%I64d%I64d%I64d%I64d%I64d",&a,&b,&r,&x,&y,&e); double z=sqrt(((double)a-x)*(a-x)+((double)b-y)*(b-y)); if(r>e) swap(r,e); if(z>r+e) printf("%.10f\n",(z-r-e)/2); else if(z<r+e&&z<e-r) printf("%.10f\n",(e-z-r)/2); else puts("0.000000000000000"); return 0; } ```
-1
475
B
Strongly Connected City
PROGRAMMING
1,400
[ "brute force", "dfs and similar", "graphs", "implementation" ]
null
null
Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection. The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern.
The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets. The second line contains a string of length *n*, made of characters '&lt;' and '&gt;', denoting direction of each horizontal street. If the *i*-th character is equal to '&lt;', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south. The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east.
If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO".
[ "3 3\n&gt;&lt;&gt;\nv^v\n", "4 6\n&lt;&gt;&lt;&gt;\nv^v^v^\n" ]
[ "NO\n", "YES\n" ]
The figure above shows street directions in the second sample test case.
1,000
[ { "input": "3 3\n><>\nv^v", "output": "NO" }, { "input": "4 6\n<><>\nv^v^v^", "output": "YES" }, { "input": "2 2\n<>\nv^", "output": "YES" }, { "input": "2 2\n>>\n^v", "output": "NO" }, { "input": "3 3\n>><\n^^v", "output": "YES" }, { "input": "3 4\n>><\n^v^v", "output": "YES" }, { "input": "3 8\n>><\nv^^^^^^^", "output": "NO" }, { "input": "7 2\n<><<<<>\n^^", "output": "NO" }, { "input": "4 5\n><<<\n^^^^v", "output": "YES" }, { "input": "2 20\n><\n^v^^v^^v^^^v^vv^vv^^", "output": "NO" }, { "input": "2 20\n<>\nv^vv^v^^vvv^^^v^vvv^", "output": "YES" }, { "input": "20 2\n<><<><<>><<<>><><<<<\n^^", "output": "NO" }, { "input": "20 2\n><>><>><>><<<><<><><\n^v", "output": "YES" }, { "input": "11 12\n><<<><><<>>\nvv^^^^vvvvv^", "output": "NO" }, { "input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^", "output": "YES" }, { "input": "16 11\n<<<<>><><<<<<><<\nvv^v^vvvv^v", "output": "NO" }, { "input": "14 7\n><<<<>>>>>>><<\nvv^^^vv", "output": "NO" }, { "input": "5 14\n<<><>\nv^vv^^vv^v^^^v", "output": "NO" }, { "input": "8 18\n>>>><>>>\nv^vv^v^^^^^vvv^^vv", "output": "NO" }, { "input": "18 18\n<<><>><<>><>><><<<\n^^v^v^vvvv^v^vv^vv", "output": "NO" }, { "input": "4 18\n<<<>\n^^^^^vv^vv^^vv^v^v", "output": "NO" }, { "input": "19 18\n><><>>><<<<<>>><<<>\n^^v^^v^^v^vv^v^vvv", "output": "NO" }, { "input": "14 20\n<<<><><<>><><<\nvvvvvvv^v^vvvv^^^vv^", "output": "NO" }, { "input": "18 18\n><>>><<<>><><>>>><\nvv^^^^v^v^^^^v^v^^", "output": "NO" }, { "input": "8 18\n<><<<>>>\n^^^^^^v^^^vv^^vvvv", "output": "NO" }, { "input": "11 12\n><><><<><><\n^^v^^^^^^^^v", "output": "YES" }, { "input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^", "output": "YES" }, { "input": "16 11\n>><<><<<<>>><><<\n^^^^vvvv^vv", "output": "YES" }, { "input": "14 7\n<><><<<>>>><>>\nvv^^v^^", "output": "YES" }, { "input": "5 14\n>>>><\n^v^v^^^vv^vv^v", "output": "YES" }, { "input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^", "output": "YES" }, { "input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v", "output": "YES" }, { "input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^", "output": "YES" }, { "input": "19 18\n>>>><><<>>><<<><<<<\n^v^^^^vv^^v^^^^v^v", "output": "YES" }, { "input": "14 20\n<>><<<><<>>>>>\nvv^^v^^^^v^^vv^^vvv^", "output": "YES" }, { "input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v", "output": "YES" }, { "input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^", "output": "YES" }, { "input": "20 19\n<><>>>>><<<<<><<>>>>\nv^vv^^vvvvvv^vvvv^v", "output": "NO" }, { "input": "20 19\n<<<><<<>><<<>><><><>\nv^v^vvv^vvv^^^vvv^^", "output": "YES" }, { "input": "19 20\n<><<<><><><<<<<<<<>\n^v^^^^v^^vvvv^^^^vvv", "output": "NO" }, { "input": "19 20\n>>>>>>>><>>><><<<><\n^v^v^^^vvv^^^v^^vvvv", "output": "YES" }, { "input": "20 20\n<<<>>>><>><<>><<>>>>\n^vvv^^^^vv^^^^^v^^vv", "output": "NO" }, { "input": "20 20\n>>><><<><<<<<<<><<><\nvv^vv^vv^^^^^vv^^^^^", "output": "NO" }, { "input": "20 20\n><<><<<<<<<>>><>>><<\n^^^^^^^^vvvv^vv^vvvv", "output": "YES" }, { "input": "20 20\n<>>>>>>>><>>><>><<<>\nvv^^vv^^^^v^vv^v^^^^", "output": "YES" }, { "input": "20 20\n><>><<>><>>>>>>>><<>\n^^v^vv^^^vvv^v^^^vv^", "output": "NO" }, { "input": "20 20\n<<<<><<>><><<<>><<><\nv^^^^vvv^^^vvvv^v^vv", "output": "NO" }, { "input": "20 20\n><<<><<><>>><><<<<<<\nvv^^vvv^^v^^v^vv^vvv", "output": "NO" }, { "input": "20 20\n<<>>><>>>><<<<>>><<>\nv^vv^^^^^vvv^^v^^v^v", "output": "NO" }, { "input": "20 20\n><<><<><<<<<<>><><>>\nv^^^v^vv^^v^^vvvv^vv", "output": "NO" }, { "input": "20 20\n<<<<<<<<><>><><>><<<\n^vvv^^^v^^^vvv^^^^^v", "output": "NO" }, { "input": "20 20\n>>><<<<<>>><><><<><<\n^^^vvv^^^v^^v^^v^vvv", "output": "YES" }, { "input": "20 20\n<><<<><><>><><><<<<>\n^^^vvvv^vv^v^^^^v^vv", "output": "NO" }, { "input": "20 20\n>>>>>>>>>><>>><>><>>\n^vvv^^^vv^^^^^^vvv^v", "output": "NO" }, { "input": "20 20\n<><>><><<<<<>><<>>><\nv^^^v^v^v^vvvv^^^vv^", "output": "NO" }, { "input": "20 20\n><<<><<<><<<><>>>><<\nvvvv^^^^^vv^v^^vv^v^", "output": "NO" }, { "input": "20 20\n<<><<<<<<>>>>><<<>>>\nvvvvvv^v^vvv^^^^^^^^", "output": "YES" }, { "input": "20 20\n><<><<>>>>><><>><>>>\nv^^^^vvv^^^^^v^v^vv^", "output": "NO" }, { "input": "20 20\n<<>>><>><<>>>><<<><<\n^^vvv^^vvvv^vv^^v^v^", "output": "NO" }, { "input": "20 20\n><<>><>>>><<><>><><<\n^v^^^^^^vvvv^v^v^v^^", "output": "NO" }, { "input": "20 20\n<<><<<<><><<>>><>>>>\n^^vvvvv^v^^^^^^^vvv^", "output": "NO" }, { "input": "20 20\n>><<<<<<><>>>><>>><>\n^^^v^v^vv^^vv^vvv^^^", "output": "NO" }, { "input": "20 20\n>>>>>>>>>>>>>>>>>>>>\nvvvvvvvvvvvvvvvvvvvv", "output": "NO" }, { "input": "2 2\n><\nv^", "output": "NO" }, { "input": "2 2\n<>\n^v", "output": "NO" }, { "input": "3 3\n>><\nvvv", "output": "NO" }, { "input": "2 3\n<>\nv^^", "output": "YES" }, { "input": "4 4\n>>><\nvvv^", "output": "NO" }, { "input": "20 20\n<><><><><><><><><><>\nvvvvvvvvvvvvvvvvvvvv", "output": "NO" }, { "input": "4 4\n<>>>\nv^^^", "output": "YES" }, { "input": "20 20\n<><><><><><><><><><>\nv^v^v^v^v^v^v^v^v^v^", "output": "YES" }, { "input": "2 3\n<>\n^v^", "output": "NO" }, { "input": "4 3\n<><>\n^vv", "output": "NO" }, { "input": "3 3\n<<>\nvv^", "output": "YES" }, { "input": "2 3\n><\nvv^", "output": "NO" }, { "input": "7 6\n>>><>><\n^vv^vv", "output": "YES" }, { "input": "2 2\n<<\nv^", "output": "NO" }, { "input": "3 3\n>><\n^^^", "output": "NO" }, { "input": "3 3\n<><\nv^v", "output": "NO" }, { "input": "20 20\n><><><><><><><><><><\n^v^v^v^v^v^v^v^v^v^v", "output": "YES" }, { "input": "4 4\n<>>>\nvvv^", "output": "YES" } ]
1,412,524,038
10,038
Python 3
WRONG_ANSWER
TESTS
7
62
0
n, m = list(map(int, input().split())) hor = input() ver = input() a = [False] * m * n b = [False] * m * n g = [[] for i in range(m * n)] h = [[] for i in range(m * n)] t = [] for i in range(m): if ver[i] == 'v': for y in range(n - 1): g[y * m + i].append((y + 1) * m + i) h[(y + 1) * m + i].append(y * m + i) if ver[i] == '^': for y in range(1, n): g[y * m + i].append((y - 1) * m + i) h[(y - 1) * m + i].append(y * m + i) for i in range(n): if hor[i] == '>': for x in range(m - 1): g[i * m + x].append(i * m + x + 1) h[i * m + x + 1].append(i * m + x) if hor[i] == '<': for x in range(1, m): g[i * m + x].append(i * m + x - 1) h[i * m + x - 1].append(i * m + x) def dfs(a, g, t, v): a[v] = True for c in g[v]: if not a[c]: dfs(a, g, t, c) t.append(v) def sfd(b, h, v): t = 1 b[v] = True for c in h[v]: if not b[c]: t += sfd(b, h, c) return t for i in range(n * m): if not a[i]: dfs(a, g, t, i) if sfd(b, h, 0) == n * m: print('YES') else: print('NO')
Title: Strongly Connected City Time Limit: None seconds Memory Limit: None megabytes Problem Description: Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection. The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern. Input Specification: The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets. The second line contains a string of length *n*, made of characters '&lt;' and '&gt;', denoting direction of each horizontal street. If the *i*-th character is equal to '&lt;', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south. The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east. Output Specification: If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO". Demo Input: ['3 3\n&gt;&lt;&gt;\nv^v\n', '4 6\n&lt;&gt;&lt;&gt;\nv^v^v^\n'] Demo Output: ['NO\n', 'YES\n'] Note: The figure above shows street directions in the second sample test case.
```python n, m = list(map(int, input().split())) hor = input() ver = input() a = [False] * m * n b = [False] * m * n g = [[] for i in range(m * n)] h = [[] for i in range(m * n)] t = [] for i in range(m): if ver[i] == 'v': for y in range(n - 1): g[y * m + i].append((y + 1) * m + i) h[(y + 1) * m + i].append(y * m + i) if ver[i] == '^': for y in range(1, n): g[y * m + i].append((y - 1) * m + i) h[(y - 1) * m + i].append(y * m + i) for i in range(n): if hor[i] == '>': for x in range(m - 1): g[i * m + x].append(i * m + x + 1) h[i * m + x + 1].append(i * m + x) if hor[i] == '<': for x in range(1, m): g[i * m + x].append(i * m + x - 1) h[i * m + x - 1].append(i * m + x) def dfs(a, g, t, v): a[v] = True for c in g[v]: if not a[c]: dfs(a, g, t, c) t.append(v) def sfd(b, h, v): t = 1 b[v] = True for c in h[v]: if not b[c]: t += sfd(b, h, c) return t for i in range(n * m): if not a[i]: dfs(a, g, t, i) if sfd(b, h, 0) == n * m: print('YES') else: print('NO') ```
0
16
C
Monitor
PROGRAMMING
1,800
[ "binary search", "number theory" ]
C. Monitor
0
64
Reca company makes monitors, the most popular of their models is AB999 with the screen size *a*<=×<=*b* centimeters. Because of some production peculiarities a screen parameters are integer numbers. Recently the screen sides ratio *x*:<=*y* became popular with users. That's why the company wants to reduce monitor AB999 size so that its screen sides ratio becomes *x*:<=*y*, at the same time they want its total area to be maximal of all possible variants. Your task is to find the screen parameters of the reduced size model, or find out that such a reduction can't be performed.
The first line of the input contains 4 integers — *a*, *b*, *x* and *y* (1<=≤<=*a*,<=*b*,<=*x*,<=*y*<=≤<=2·109).
If the answer exists, output 2 positive integers — screen parameters of the reduced size model. Output 0 0 otherwise.
[ "800 600 4 3\n", "1920 1200 16 9\n", "1 1 1 2\n" ]
[ "800 600\n", "1920 1080\n", "0 0\n" ]
none
0
[ { "input": "800 600 4 3", "output": "800 600" }, { "input": "1920 1200 16 9", "output": "1920 1080" }, { "input": "1 1 1 2", "output": "0 0" }, { "input": "1002105126 227379125 179460772 1295256518", "output": "0 0" }, { "input": "625166755 843062051 1463070160 1958300154", "output": "0 0" }, { "input": "248228385 1458744978 824699604 1589655888", "output": "206174901 397413972" }, { "input": "186329049 1221011622 90104472 1769702163", "output": "60069648 1179801442" }, { "input": "511020182 242192314 394753578 198572007", "output": "394753578 198572007" }, { "input": "134081812 857875240 82707261 667398699", "output": "105411215 850606185" }, { "input": "721746595 799202881 143676564 380427290", "output": "287353128 760854580" }, { "input": "912724694 1268739154 440710604 387545692", "output": "881421208 775091384" }, { "input": "1103702793 1095784840 788679477 432619528", "output": "788679477 432619528" }, { "input": "548893795 861438648 131329677 177735812", "output": "525318708 710943248" }, { "input": "652586118 1793536161 127888702 397268645", "output": "511554808 1589074580" }, { "input": "756278440 578150025 96644319 26752094", "output": "676510233 187264658" }, { "input": "859970763 1510247537 37524734 97452508", "output": "562871010 1461787620" }, { "input": "547278097 1977241684 51768282 183174370", "output": "543566961 1923330885" }, { "input": "62256611 453071697 240966 206678", "output": "62169228 53322924" }, { "input": "1979767797 878430446 5812753 3794880", "output": "1342745943 876617280" }, { "input": "1143276347 1875662241 178868040 116042960", "output": "1140283755 739773870" }, { "input": "435954880 1740366589 19415065 185502270", "output": "182099920 1739883360" }, { "input": "664035593 983601098 4966148 2852768", "output": "664032908 381448928" }, { "input": "1461963719 350925487 135888396 83344296", "output": "572153868 350918568" }, { "input": "754199095 348965411 161206703 67014029", "output": "754119492 313489356" }, { "input": "166102153 494841162 14166516 76948872", "output": "91096406 494812252" }, { "input": "1243276346 1975662240 38441120 291740200", "output": "259477560 1969246350" }, { "input": "535954879 1840366588 26278959 73433046", "output": "535849118 1497358892" }, { "input": "764035592 1083601097 1192390 7267738", "output": "177777265 1083570463" }, { "input": "1561963718 450925486 475523188 136236856", "output": "1561914768 447486816" }, { "input": "854199094 448965410 364102983 125971431", "output": "853687785 295356745" }, { "input": "266102152 594841161 15854566 13392106", "output": "266043102 224722482" }, { "input": "1 1 2 1", "output": "0 0" }, { "input": "2000000000 2000000000 1 1999999999", "output": "1 1999999999" }, { "input": "2000000000 2000000000 1999999999 1", "output": "1999999999 1" }, { "input": "2000000000 2000000000 2 1999999999", "output": "2 1999999999" }, { "input": "1000000000 1000000000 999999999 2", "output": "999999999 2" }, { "input": "2000000000 2000000000 1999999999 2", "output": "1999999999 2" }, { "input": "2000000000 2000000000 1999999999 1999999998", "output": "1999999999 1999999998" }, { "input": "2000000000 2000000000 1999999998 1999999999", "output": "1999999998 1999999999" } ]
1,583,878,434
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
155
1,228,800
from fractions import Fraction a,b,x,y=list(map(int,input().split())) l=Fraction(x, y) x=l.numerator y=l.denominator if(a<b): a,b=b,a if(x<y): x,y=y,x maxm=-1 m,n=(a//x)*x,(a//x)*y if(m*n>maxm): one=m two=n s,d=(b//x)*x,(b//x)*y if(s*d>maxm): one=s two=d f,g=(a//y)*x,(a//y)*y if(f*g>maxm): one=f two=g sd,fg=(b//y)*x,(b//y)*y if(sd*fg>maxm): one=sd two=fg print(one,two)
Title: Monitor Time Limit: 0 seconds Memory Limit: 64 megabytes Problem Description: Reca company makes monitors, the most popular of their models is AB999 with the screen size *a*<=×<=*b* centimeters. Because of some production peculiarities a screen parameters are integer numbers. Recently the screen sides ratio *x*:<=*y* became popular with users. That's why the company wants to reduce monitor AB999 size so that its screen sides ratio becomes *x*:<=*y*, at the same time they want its total area to be maximal of all possible variants. Your task is to find the screen parameters of the reduced size model, or find out that such a reduction can't be performed. Input Specification: The first line of the input contains 4 integers — *a*, *b*, *x* and *y* (1<=≤<=*a*,<=*b*,<=*x*,<=*y*<=≤<=2·109). Output Specification: If the answer exists, output 2 positive integers — screen parameters of the reduced size model. Output 0 0 otherwise. Demo Input: ['800 600 4 3\n', '1920 1200 16 9\n', '1 1 1 2\n'] Demo Output: ['800 600\n', '1920 1080\n', '0 0\n'] Note: none
```python from fractions import Fraction a,b,x,y=list(map(int,input().split())) l=Fraction(x, y) x=l.numerator y=l.denominator if(a<b): a,b=b,a if(x<y): x,y=y,x maxm=-1 m,n=(a//x)*x,(a//x)*y if(m*n>maxm): one=m two=n s,d=(b//x)*x,(b//x)*y if(s*d>maxm): one=s two=d f,g=(a//y)*x,(a//y)*y if(f*g>maxm): one=f two=g sd,fg=(b//y)*x,(b//y)*y if(sd*fg>maxm): one=sd two=fg print(one,two) ```
0
337
A
Puzzles
PROGRAMMING
900
[ "greedy" ]
null
null
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Print a single integer — the least possible difference the teacher can obtain.
[ "4 6\n10 12 10 7 5 22\n" ]
[ "5\n" ]
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
500
[ { "input": "4 6\n10 12 10 7 5 22", "output": "5" }, { "input": "2 2\n4 4", "output": "0" }, { "input": "2 10\n4 5 6 7 8 9 10 11 12 12", "output": "0" }, { "input": "4 5\n818 136 713 59 946", "output": "759" }, { "input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903", "output": "13" }, { "input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94", "output": "3" }, { "input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190", "output": "31" }, { "input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997", "output": "0" }, { "input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176", "output": "412" }, { "input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886", "output": "938" }, { "input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993", "output": "937" }, { "input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7", "output": "0" }, { "input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19", "output": "12" }, { "input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "0" }, { "input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17", "output": "31" }, { "input": "2 2\n1000 4", "output": "996" }, { "input": "2 3\n4 502 1000", "output": "498" }, { "input": "3 3\n4 1000 4", "output": "996" } ]
1,698,176,710
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
3
154
3,276,800
n, m = map(int,input().split()) s = list(map(int,input().split())) s.sort() max = 0 for i in range(m): col = 0 for j in range(i+1,m): if s[i]==s[j]: col += 1 if col > max: max = col+1 pos = i+1 change = n - max raz_1 = 10000 raz_2 = 10000 if pos + max - 1 + change <= len(s): raz_1 = s[pos + max - 1 + change-1]-s[pos + max - 1-1] if pos - change > 0: raz_2 = s[pos-1] - s[pos - change-1] print(min(raz_1,raz_2))
Title: Puzzles Time Limit: None seconds Memory Limit: None megabytes Problem Description: The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. Input Specification: The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop. Output Specification: Print a single integer — the least possible difference the teacher can obtain. Demo Input: ['4 6\n10 12 10 7 5 22\n'] Demo Output: ['5\n'] Note: Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
```python n, m = map(int,input().split()) s = list(map(int,input().split())) s.sort() max = 0 for i in range(m): col = 0 for j in range(i+1,m): if s[i]==s[j]: col += 1 if col > max: max = col+1 pos = i+1 change = n - max raz_1 = 10000 raz_2 = 10000 if pos + max - 1 + change <= len(s): raz_1 = s[pos + max - 1 + change-1]-s[pos + max - 1-1] if pos - change > 0: raz_2 = s[pos-1] - s[pos - change-1] print(min(raz_1,raz_2)) ```
-1
12
A
Super Agent
PROGRAMMING
800
[ "implementation" ]
A. Super Agent
2
256
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base. Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9. Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
[ "XX.\n...\n.XX\n", "X.X\nX..\n...\n" ]
[ "YES\n", "NO\n" ]
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
0
[ { "input": "XX.\n...\n.XX", "output": "YES" }, { "input": ".X.\n.X.\n.X.", "output": "YES" }, { "input": "XXX\nXXX\nXXX", "output": "YES" }, { "input": "XXX\nX.X\nXXX", "output": "YES" }, { "input": "X..\n.X.\n..X", "output": "YES" }, { "input": "...\nX.X\nX..", "output": "NO" }, { "input": ".X.\nX.X\n.X.", "output": "YES" }, { "input": "X.X\n.X.\nX.X", "output": "YES" }, { "input": "...\n...\n..X", "output": "NO" }, { "input": "XXX\n...\nXXX", "output": "YES" }, { "input": "..X\nX..\n..X", "output": "NO" }, { "input": ".X.\n...\nX.X", "output": "NO" }, { "input": "X.X\nX.X\nX.X", "output": "YES" }, { "input": ".X.\nX.X\nXX.", "output": "NO" }, { "input": "...\nXXX\nXXX", "output": "NO" }, { "input": "XXX\n..X\nXXX", "output": "NO" }, { "input": "X..\nX.X\n.X.", "output": "NO" }, { "input": "...\n..X\nXXX", "output": "NO" }, { "input": "..X\nX.X\nX..", "output": "YES" }, { "input": "..X\n..X\nXXX", "output": "NO" }, { "input": "X..\nX..\nX..", "output": "NO" }, { "input": "XXX\n.X.\nXXX", "output": "YES" }, { "input": "..X\n...\nX..", "output": "YES" }, { "input": "...\n...\nX..", "output": "NO" }, { "input": "...\n...\n.X.", "output": "NO" }, { "input": "...\n...\n..X", "output": "NO" }, { "input": "...\n.X.\nX..", "output": "NO" } ]
1,646,834,345
2,147,483,647
Python 3
OK
TESTS
40
92
0
r=[list(input()) for _ in range(3)];print('NYOE S'[r[0][0]==r[2][2] and r[0][1]==r[2][1] and r[1][0]==r[1][2] and r[2][0]==r[0][2]::2])
Title: Super Agent Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base. Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9. Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations. Input Specification: Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.». Output Specification: Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise. Demo Input: ['XX.\n...\n.XX\n', 'X.X\nX..\n...\n'] Demo Output: ['YES\n', 'NO\n'] Note: If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
```python r=[list(input()) for _ in range(3)];print('NYOE S'[r[0][0]==r[2][2] and r[0][1]==r[2][1] and r[1][0]==r[1][2] and r[2][0]==r[0][2]::2]) ```
3.977
235
A
LCM Challenge
PROGRAMMING
1,600
[ "number theory" ]
null
null
Some days ago, I learned the concept of LCM (least common multiple). I've played with it for several times and I want to make a big number with it. But I also don't want to use many numbers, so I'll choose three positive integers (they don't have to be distinct) which are not greater than *n*. Can you help me to find the maximum possible least common multiple of these three integers?
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the *n* mentioned in the statement.
Print a single integer — the maximum possible LCM of three not necessarily distinct positive integers that are not greater than *n*.
[ "9\n", "7\n" ]
[ "504\n", "210\n" ]
The least common multiple of some positive integers is the least positive integer which is multiple for each of them. The result may become very large, 32-bit integer won't be enough. So using 64-bit integers is recommended. For the last example, we can chose numbers 7, 6, 5 and the LCM of them is 7·6·5 = 210. It is the maximum value we can get.
500
[ { "input": "9", "output": "504" }, { "input": "7", "output": "210" }, { "input": "1", "output": "1" }, { "input": "5", "output": "60" }, { "input": "6", "output": "60" }, { "input": "33", "output": "32736" }, { "input": "21", "output": "7980" }, { "input": "2", "output": "2" }, { "input": "41", "output": "63960" }, { "input": "29", "output": "21924" }, { "input": "117", "output": "1560780" }, { "input": "149", "output": "3241644" }, { "input": "733", "output": "392222436" }, { "input": "925", "output": "788888100" }, { "input": "509", "output": "131096004" }, { "input": "829", "output": "567662724" }, { "input": "117", "output": "1560780" }, { "input": "605", "output": "220348260" }, { "input": "245", "output": "14526540" }, { "input": "925", "output": "788888100" }, { "input": "213", "output": "9527916" }, { "input": "53", "output": "140556" }, { "input": "341", "output": "39303660" }, { "input": "21", "output": "7980" }, { "input": "605", "output": "220348260" }, { "input": "149", "output": "3241644" }, { "input": "733", "output": "392222436" }, { "input": "117", "output": "1560780" }, { "input": "53", "output": "140556" }, { "input": "245", "output": "14526540" }, { "input": "829", "output": "567662724" }, { "input": "924", "output": "783776526" }, { "input": "508", "output": "130065780" }, { "input": "700", "output": "341042100" }, { "input": "636", "output": "254839470" }, { "input": "20", "output": "6460" }, { "input": "604", "output": "218891412" }, { "input": "796", "output": "501826260" }, { "input": "732", "output": "389016270" }, { "input": "412", "output": "69256788" }, { "input": "700", "output": "341042100" }, { "input": "244", "output": "14289372" }, { "input": "828", "output": "563559150" }, { "input": "508", "output": "130065780" }, { "input": "796", "output": "501826260" }, { "input": "636", "output": "254839470" }, { "input": "924", "output": "783776526" }, { "input": "245", "output": "14526540" }, { "input": "828", "output": "563559150" }, { "input": "21", "output": "7980" }, { "input": "605", "output": "220348260" }, { "input": "636", "output": "254839470" }, { "input": "924", "output": "783776526" }, { "input": "116", "output": "1507420" }, { "input": "700", "output": "341042100" }, { "input": "732", "output": "389016270" }, { "input": "20", "output": "6460" }, { "input": "508", "output": "130065780" }, { "input": "148", "output": "3154620" }, { "input": "828", "output": "563559150" }, { "input": "763116", "output": "444394078546562430" }, { "input": "756604", "output": "433115377058855412" }, { "input": "447244", "output": "89460162932862372" }, { "input": "372636", "output": "51742503205363470" }, { "input": "546924", "output": "163597318076822526" }, { "input": "540412", "output": "157823524476316788" }, { "input": "714700", "output": "365063922340784100" }, { "input": "520731", "output": "141201007712496270" }, { "input": "695019", "output": "335728459024850814" }, { "input": "688507", "output": "326379736779169710" }, { "input": "862795", "output": "642275489615199390" }, { "input": "668827", "output": "299184742915995150" }, { "input": "810411", "output": "532248411551110590" }, { "input": "836603", "output": "585540171302562606" }, { "input": "978187", "output": "935975171582120670" }, { "input": "816923", "output": "545182335484592526" }, { "input": "958507", "output": "880611813728059710" }, { "input": "984699", "output": "954792870629291694" }, { "input": "642635", "output": "265393998349453470" }, { "input": "296604", "output": "26092892528622606" }, { "input": "1000000", "output": "999996000003000000" }, { "input": "8", "output": "280" }, { "input": "3", "output": "6" }, { "input": "4", "output": "12" }, { "input": "30", "output": "21924" }, { "input": "18", "output": "4080" }, { "input": "12", "output": "990" } ]
1,519,379,547
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
32
124
5,632,000
def gcd(x,y): if y==0: return x return gcd(y,x%y) def lcm(x,y): return (x*y)//gcd(x,y) n = int(input()) res = 0 for i in range(max(1, n-50), n-1): res = max(res, lcm(lcm(i,(i+1)),(i+2))) if n==1 or n==2: print(n) else: print(res)
Title: LCM Challenge Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some days ago, I learned the concept of LCM (least common multiple). I've played with it for several times and I want to make a big number with it. But I also don't want to use many numbers, so I'll choose three positive integers (they don't have to be distinct) which are not greater than *n*. Can you help me to find the maximum possible least common multiple of these three integers? Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the *n* mentioned in the statement. Output Specification: Print a single integer — the maximum possible LCM of three not necessarily distinct positive integers that are not greater than *n*. Demo Input: ['9\n', '7\n'] Demo Output: ['504\n', '210\n'] Note: The least common multiple of some positive integers is the least positive integer which is multiple for each of them. The result may become very large, 32-bit integer won't be enough. So using 64-bit integers is recommended. For the last example, we can chose numbers 7, 6, 5 and the LCM of them is 7·6·5 = 210. It is the maximum value we can get.
```python def gcd(x,y): if y==0: return x return gcd(y,x%y) def lcm(x,y): return (x*y)//gcd(x,y) n = int(input()) res = 0 for i in range(max(1, n-50), n-1): res = max(res, lcm(lcm(i,(i+1)),(i+2))) if n==1 or n==2: print(n) else: print(res) ```
0
71
A
Way Too Long Words
PROGRAMMING
800
[ "strings" ]
A. Way Too Long Words
1
256
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
[ "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n" ]
[ "word\nl10n\ni18n\np43s\n" ]
none
500
[ { "input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis", "output": "word\nl10n\ni18n\np43s" }, { "input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm", "output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m" }, { "input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd", "output": "n20n\nj27b\nk15d" }, { "input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt", "output": "t41t" }, { "input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings", "output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings" }, { "input": "1\na", "output": "a" }, { "input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz", "output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz" }, { "input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij", "output": "a98j" }, { "input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco", "output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco" }, { "input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt", "output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t" }, { "input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr", "output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr" } ]
1,696,914,902
2,147,483,647
PyPy 3-64
OK
TESTS
20
62
0
for i in range(int(input())): word = input() if len(word) > 10: print(word[0] + str(len(word[1:len(word)-1])) + word[-1]) else: print(word)
Title: Way Too Long Words Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. Output Specification: Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. Demo Input: ['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n'] Demo Output: ['word\nl10n\ni18n\np43s\n'] Note: none
```python for i in range(int(input())): word = input() if len(word) > 10: print(word[0] + str(len(word[1:len(word)-1])) + word[-1]) else: print(word) ```
3.969
940
A
Points on the line
PROGRAMMING
1,200
[ "brute force", "greedy", "sortings" ]
null
null
We've got no test cases. A big olympiad is coming up. But the problemsetters' number one priority should be adding another problem to the round. The diameter of a multiset of points on the line is the largest distance between two points from this set. For example, the diameter of the multiset {1,<=3,<=2,<=1} is 2. Diameter of multiset consisting of one point is 0. You are given *n* points on the line. What is the minimum number of points you have to remove, so that the diameter of the multiset of the remaining points will not exceed *d*?
The first line contains two integers *n* and *d* (1<=≤<=*n*<=≤<=100,<=0<=≤<=*d*<=≤<=100) — the amount of points and the maximum allowed diameter respectively. The second line contains *n* space separated integers (1<=≤<=*x**i*<=≤<=100) — the coordinates of the points.
Output a single integer — the minimum number of points you have to remove.
[ "3 1\n2 1 4\n", "3 0\n7 7 7\n", "6 3\n1 3 4 6 9 10\n" ]
[ "1\n", "0\n", "3\n" ]
In the first test case the optimal strategy is to remove the point with coordinate 4. The remaining points will have coordinates 1 and 2, so the diameter will be equal to 2 - 1 = 1. In the second test case the diameter is equal to 0, so its is unnecessary to remove any points. In the third test case the optimal strategy is to remove points with coordinates 1, 9 and 10. The remaining points will have coordinates 3, 4 and 6, so the diameter will be equal to 6 - 3 = 3.
500
[ { "input": "3 1\n2 1 4", "output": "1" }, { "input": "3 0\n7 7 7", "output": "0" }, { "input": "6 3\n1 3 4 6 9 10", "output": "3" }, { "input": "11 5\n10 11 12 13 14 15 16 17 18 19 20", "output": "5" }, { "input": "1 100\n1", "output": "0" }, { "input": "100 10\n22 75 26 45 72 81 47 29 97 2 75 25 82 84 17 56 32 2 28 37 57 39 18 11 79 6 40 68 68 16 40 63 93 49 91 10 55 68 31 80 57 18 34 28 76 55 21 80 22 45 11 67 67 74 91 4 35 34 65 80 21 95 1 52 25 31 2 53 96 22 89 99 7 66 32 2 68 33 75 92 84 10 94 28 54 12 9 80 43 21 51 92 20 97 7 25 67 17 38 100", "output": "84" }, { "input": "100 70\n22 75 26 45 72 81 47 29 97 2 75 25 82 84 17 56 32 2 28 37 57 39 18 11 79 6 40 68 68 16 40 63 93 49 91 10 55 68 31 80 57 18 34 28 76 55 21 80 22 45 11 67 67 74 91 4 35 34 65 80 21 95 1 52 25 31 2 53 96 22 89 99 7 66 32 2 68 33 75 92 84 10 94 28 54 12 9 80 43 21 51 92 20 97 7 25 67 17 38 100", "output": "27" }, { "input": "1 10\n25", "output": "0" }, { "input": "70 80\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70", "output": "0" }, { "input": "3 1\n25 26 27", "output": "1" }, { "input": "100 5\n51 56 52 60 52 53 52 60 56 54 55 50 53 51 57 53 52 54 54 52 51 55 50 56 60 51 58 50 60 59 50 54 60 55 55 57 54 59 59 55 55 52 56 57 59 54 53 57 52 50 50 55 59 54 54 56 51 58 52 51 56 56 58 56 54 54 57 52 51 58 56 57 54 59 58 53 50 52 50 60 57 51 54 59 54 54 52 55 53 55 51 53 52 54 51 56 55 53 58 56", "output": "34" }, { "input": "100 11\n44 89 57 64 94 96 73 96 55 52 91 73 73 93 51 62 63 85 43 75 60 78 98 55 80 84 65 75 61 88 62 71 53 57 94 85 60 96 66 96 61 72 97 64 51 44 63 82 67 86 60 57 74 85 57 79 61 94 86 78 84 56 60 75 91 91 92 62 89 85 79 57 76 97 65 56 46 78 51 69 50 52 85 80 76 71 81 51 90 71 77 60 63 62 84 59 79 84 69 81", "output": "70" }, { "input": "100 0\n22 75 26 45 72 81 47 29 97 2 75 25 82 84 17 56 32 2 28 37 57 39 18 11 79 6 40 68 68 16 40 63 93 49 91 10 55 68 31 80 57 18 34 28 76 55 21 80 22 45 11 67 67 74 91 4 35 34 65 80 21 95 1 52 25 31 2 53 96 22 89 99 7 66 32 2 68 33 75 92 84 10 94 28 54 12 9 80 43 21 51 92 20 97 7 25 67 17 38 100", "output": "96" }, { "input": "100 100\n22 75 26 45 72 81 47 29 97 2 75 25 82 84 17 56 32 2 28 37 57 39 18 11 79 6 40 68 68 16 40 63 93 49 91 10 55 68 31 80 57 18 34 28 76 55 21 80 22 45 11 67 67 74 91 4 35 34 65 80 21 95 1 52 25 31 2 53 96 22 89 99 7 66 32 2 68 33 75 92 84 10 94 28 54 12 9 80 43 21 51 92 20 97 7 25 67 17 38 100", "output": "0" }, { "input": "76 32\n50 53 69 58 55 39 40 42 40 55 58 73 55 72 75 44 45 55 46 60 60 42 41 64 77 39 68 51 61 49 38 41 56 57 64 43 78 36 39 63 40 66 52 76 39 68 39 73 40 68 54 60 35 67 69 52 58 52 38 63 69 38 69 60 73 64 65 41 59 55 37 57 40 34 35 35", "output": "13" }, { "input": "100 1\n22 75 26 45 72 81 47 29 97 2 75 25 82 84 17 56 32 2 28 37 57 39 18 11 79 6 40 68 68 16 40 63 93 49 91 10 55 68 31 80 57 18 34 28 76 55 21 80 22 45 11 67 67 74 91 4 35 34 65 80 21 95 1 52 25 31 2 53 96 22 89 99 7 66 32 2 68 33 75 92 84 10 94 28 54 12 9 80 43 21 51 92 20 97 7 25 67 17 38 100", "output": "93" }, { "input": "100 5\n22 75 26 45 72 81 47 29 97 2 75 25 82 84 17 56 32 2 28 37 57 39 18 11 79 6 40 68 68 16 40 63 93 49 91 10 55 68 31 80 57 18 34 28 76 55 21 80 22 45 11 67 67 74 91 4 35 34 65 80 21 95 1 52 25 31 2 53 96 22 89 99 7 66 32 2 68 33 75 92 84 10 94 28 54 12 9 80 43 21 51 92 20 97 7 25 67 17 38 100", "output": "89" }, { "input": "98 64\n2 29 36 55 58 15 25 33 7 16 61 1 4 24 63 26 36 16 16 3 57 39 56 7 11 24 20 12 22 10 56 5 11 39 61 52 27 54 21 6 61 36 40 52 54 5 15 52 58 23 45 39 65 16 27 40 13 64 47 24 51 29 9 18 49 49 8 47 2 64 7 63 49 10 20 26 34 3 45 66 8 46 16 32 16 38 3 6 15 17 35 48 36 5 57 29 61 15", "output": "1" }, { "input": "100 56\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "43" }, { "input": "100 0\n14 13 14 13 14 13 13 13 13 14 13 13 14 14 13 14 14 14 14 13 13 13 14 13 13 14 14 14 14 14 14 13 13 13 13 14 13 14 13 14 13 14 14 14 14 13 13 14 14 13 13 13 13 14 13 14 13 14 13 14 13 13 13 14 13 13 14 13 14 14 13 13 13 14 14 14 14 13 13 14 14 14 14 14 14 14 13 14 13 13 13 14 14 13 13 13 13 13 14 14", "output": "50" }, { "input": "100 0\n14 17 18 22 19 18 19 21 19 19 22 22 19 21 24 23 24 19 25 24 24 21 20 13 26 18 17 15 25 13 17 20 20 21 13 22 27 15 18 27 19 15 16 25 18 17 18 22 19 17 18 24 14 16 18 16 22 16 17 27 18 17 18 24 22 13 14 20 23 19 16 21 19 13 14 14 25 15 27 24 26 22 16 20 16 14 21 27 15 23 23 24 27 14 24 17 19 24 15 27", "output": "89" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "1 100\n22", "output": "0" }, { "input": "1 0\n22", "output": "0" }, { "input": "1 99\n99", "output": "0" }, { "input": "1 5\n6", "output": "0" }, { "input": "3 1\n10 20 30", "output": "2" }, { "input": "3 0\n1 2 3", "output": "2" }, { "input": "3 2\n1 50 99", "output": "2" }, { "input": "7 4\n1 3 4 9 10 11 12", "output": "3" }, { "input": "2 5\n67 23", "output": "1" }, { "input": "4 2\n1 4 7 9", "output": "2" }, { "input": "2 0\n1 2", "output": "1" }, { "input": "8 1\n3 3 3 5 5 5 5 5", "output": "3" }, { "input": "5 1\n3 5 5 5 6", "output": "1" } ]
1,665,656,217
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
31
0
n,d=map(int,input().split()) a=list(map(int,input().split())) a.sort() while a[len(a)-1]-a[0]>d: if a[len(a)-1]-a[1]< a[len(a)-2]-a[0]: a.pop(0) else: a.pop(len(a)-1) print(n-len(a))
Title: Points on the line Time Limit: None seconds Memory Limit: None megabytes Problem Description: We've got no test cases. A big olympiad is coming up. But the problemsetters' number one priority should be adding another problem to the round. The diameter of a multiset of points on the line is the largest distance between two points from this set. For example, the diameter of the multiset {1,<=3,<=2,<=1} is 2. Diameter of multiset consisting of one point is 0. You are given *n* points on the line. What is the minimum number of points you have to remove, so that the diameter of the multiset of the remaining points will not exceed *d*? Input Specification: The first line contains two integers *n* and *d* (1<=≤<=*n*<=≤<=100,<=0<=≤<=*d*<=≤<=100) — the amount of points and the maximum allowed diameter respectively. The second line contains *n* space separated integers (1<=≤<=*x**i*<=≤<=100) — the coordinates of the points. Output Specification: Output a single integer — the minimum number of points you have to remove. Demo Input: ['3 1\n2 1 4\n', '3 0\n7 7 7\n', '6 3\n1 3 4 6 9 10\n'] Demo Output: ['1\n', '0\n', '3\n'] Note: In the first test case the optimal strategy is to remove the point with coordinate 4. The remaining points will have coordinates 1 and 2, so the diameter will be equal to 2 - 1 = 1. In the second test case the diameter is equal to 0, so its is unnecessary to remove any points. In the third test case the optimal strategy is to remove points with coordinates 1, 9 and 10. The remaining points will have coordinates 3, 4 and 6, so the diameter will be equal to 6 - 3 = 3.
```python n,d=map(int,input().split()) a=list(map(int,input().split())) a.sort() while a[len(a)-1]-a[0]>d: if a[len(a)-1]-a[1]< a[len(a)-2]-a[0]: a.pop(0) else: a.pop(len(a)-1) print(n-len(a)) ```
0
709
A
Juicer
PROGRAMMING
900
[ "implementation" ]
null
null
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one. The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
Print one integer — the number of times Kolya will have to empty the waste section.
[ "2 7 10\n5 6\n", "1 5 10\n7\n", "3 10 10\n5 7 7\n", "1 1 1\n1\n" ]
[ "1\n", "0\n", "1\n", "0\n" ]
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards. In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
500
[ { "input": "2 7 10\n5 6", "output": "1" }, { "input": "1 5 10\n7", "output": "0" }, { "input": "3 10 10\n5 7 7", "output": "1" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "2 951637 951638\n44069 951637", "output": "1" }, { "input": "50 100 129\n55 130 91 19 116 3 63 52 104 76 75 27 151 99 149 147 39 148 84 9 132 49 40 112 124 141 144 93 36 32 146 74 48 38 150 55 94 32 107 69 77 81 33 57 62 98 78 127 154 126", "output": "12" }, { "input": "100 1000 1083\n992 616 818 359 609 783 263 989 501 929 362 394 919 1081 870 830 1097 975 62 346 531 367 323 457 707 360 949 334 867 116 478 417 961 963 1029 114 867 1008 988 916 983 1077 959 942 572 961 579 318 721 337 488 717 111 70 416 685 987 130 353 107 61 191 827 849 106 815 211 953 111 398 889 860 801 71 375 320 395 1059 116 222 931 444 582 74 677 655 88 173 686 491 661 186 114 832 615 814 791 464 517 850", "output": "36" }, { "input": "2 6 8\n2 1", "output": "0" }, { "input": "5 15 16\n7 11 5 12 8", "output": "2" }, { "input": "15 759966 759967\n890397 182209 878577 548548 759966 812923 759966 860479 200595 381358 299175 339368 759966 907668 69574", "output": "4" }, { "input": "5 234613 716125\n642626 494941 234613 234613 234613", "output": "0" }, { "input": "50 48547 567054\n529808 597004 242355 559114 78865 537318 631455 733020 655072 645093 309010 855034 306058 625046 524574 834944 27330 664392 443637 821584 338013 490702 289520 675471 885846 258814 134220 571301 84875 94132 200425 928833 375166 521232 317961 175315 947093 89971 322071 174033 48547 998535 954205 704114 943163 438900 48547 538422 48547 48547", "output": "0" }, { "input": "5 10 20\n10 10 10 10 1", "output": "1" }, { "input": "5 10 11\n10 10 10 10 1", "output": "2" }, { "input": "3 10 10\n4 3 3", "output": "0" }, { "input": "3 5 5\n5 5 5", "output": "1" }, { "input": "3 4 14\n5 5 5", "output": "0" }, { "input": "2 7 10\n1234 1234", "output": "0" }, { "input": "1 5 6\n10", "output": "0" }, { "input": "3 4 6\n1 2 3", "output": "0" }, { "input": "5 10 12\n13 13 13 13 13", "output": "0" }, { "input": "3 4 5\n5 7 9", "output": "0" }, { "input": "3 10 100\n5 5 5", "output": "0" }, { "input": "5 1 2\n2 2 2 2 2", "output": "0" }, { "input": "5 5 5\n5 5 5 5 5", "output": "2" }, { "input": "2 2 5\n5 5", "output": "0" }, { "input": "3 1 4\n2 2 2", "output": "0" } ]
1,677,746,633
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
93
7,065,600
# n -> # oranges, b -> size of juicer, d -> size of waste n, b, d = [int(i) for i in input().split()] # a -> list of sizes of oranges a = [int(i) for i in input().split()] if n == len(a): numEmpty = 0 j = 0 for s in a: if s <= b: j += b if j > d: numEmpty += 1 j = 0 print(numEmpty) else: print(f'Error: The number of oranges must be {n}')
Title: Juicer Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one. The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section? Input Specification: The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer. Output Specification: Print one integer — the number of times Kolya will have to empty the waste section. Demo Input: ['2 7 10\n5 6\n', '1 5 10\n7\n', '3 10 10\n5 7 7\n', '1 1 1\n1\n'] Demo Output: ['1\n', '0\n', '1\n', '0\n'] Note: In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards. In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
```python # n -> # oranges, b -> size of juicer, d -> size of waste n, b, d = [int(i) for i in input().split()] # a -> list of sizes of oranges a = [int(i) for i in input().split()] if n == len(a): numEmpty = 0 j = 0 for s in a: if s <= b: j += b if j > d: numEmpty += 1 j = 0 print(numEmpty) else: print(f'Error: The number of oranges must be {n}') ```
0
291
B
Command Line Arguments
PROGRAMMING
1,300
[ "*special", "implementation", "strings" ]
null
null
The problem describes the properties of a command line. The description somehow resembles the one you usually see in real operating systems. However, there are differences in the behavior. Please make sure you've read the statement attentively and use it as a formal document. In the Pindows operating system a strings are the lexemes of the command line — the first of them is understood as the name of the program to run and the following lexemes are its arguments. For example, as we execute the command " run.exe one, two . ", we give four lexemes to the Pindows command line: "run.exe", "one,", "two", ".". More formally, if we run a command that can be represented as string *s* (that has no quotes), then the command line lexemes are maximal by inclusion substrings of string *s* that contain no spaces. To send a string with spaces or an empty string as a command line lexeme, we can use double quotes. The block of characters that should be considered as one lexeme goes inside the quotes. Embedded quotes are prohibited — that is, for each occurrence of character """ we should be able to say clearly that the quotes are opening or closing. For example, as we run the command ""run.exe o" "" " ne, " two . " " ", we give six lexemes to the Pindows command line: "run.exe o", "" (an empty string), " ne, ", "two", ".", " " (a single space). It is guaranteed that each lexeme of the command line is either surrounded by spaces on both sides or touches the corresponding command border. One of its consequences is: the opening brackets are either the first character of the string or there is a space to the left of them. You have a string that consists of uppercase and lowercase English letters, digits, characters ".,?!"" and spaces. It is guaranteed that this string is a correct OS Pindows command line string. Print all lexemes of this command line string. Consider the character """ to be used only in order to denote a single block of characters into one command line lexeme. In particular, the consequence is that the given string has got an even number of such characters.
The single line contains a non-empty string *s*. String *s* consists of at most 105 characters. Each character is either an uppercase or a lowercase English letter, or a digit, or one of the ".,?!"" signs, or a space. It is guaranteed that the given string is some correct command line string of the OS Pindows. It is guaranteed that the given command line string contains at least one lexeme.
In the first line print the first lexeme, in the second line print the second one and so on. To make the output clearer, print the "&lt;" (less) character to the left of your lexemes and the "&gt;" (more) character to the right. Print the lexemes in the order in which they occur in the command. Please, follow the given output format strictly. For more clarifications on the output format see the test samples.
[ "\"RUn.exe O\" \"\" \" 2ne, \" two! . \" \"\n", "firstarg second \"\" \n" ]
[ "&lt;RUn.exe O&gt;\n&lt;&gt;\n&lt; 2ne, &gt;\n&lt;two!&gt;\n&lt;.&gt;\n&lt; &gt;\n", "&lt;firstarg&gt;\n&lt;second&gt;\n&lt;&gt;\n" ]
none
1,000
[ { "input": "\"RUn.exe O\" \"\" \" 2ne, \" two! . \" \"", "output": "<RUn.exe O>\n<>\n< 2ne, >\n<two!>\n<.>\n< >" }, { "input": " firstarg second \"\" ", "output": "<firstarg>\n<second>\n<>" }, { "input": " \" \" ", "output": "< >" }, { "input": " a \" \" a \"\" a ", "output": "<a>\n< >\n<a>\n<>\n<a>" }, { "input": "A", "output": "<A>" }, { "input": "\"\"", "output": "<>" }, { "input": "\" \"", "output": "< >" }, { "input": "\" \" \"wu\" \"\" \" \" \"\" \"\" \"\" ", "output": "< >\n<wu>\n<>\n< >\n<>\n<>\n<>" }, { "input": "\"7\" \"W \" \"\" \"\" \"a \" \"\" \"\" \"\" y ", "output": "<7>\n<W >\n<>\n<>\n<a >\n<>\n<>\n<>\n<y>" }, { "input": "\"\" \"\" \". \" \"A\" \"\" \"\" \"\" k \"\" ", "output": "<>\n<>\n<. >\n<A>\n<>\n<>\n<>\n<k>\n<>" }, { "input": " \"\" ZX \"\" \"\" \"b\" \"\" \" \" C \"\" \"\" \"\"", "output": "<>\n<ZX>\n<>\n<>\n<b>\n<>\n< >\n<C>\n<>\n<>\n<>" }, { "input": " \"\" N 3 \"\" \"4\" \"A\" \"k\" \" \" \"\" \"\" ", "output": "<>\n<N>\n<3>\n<>\n<4>\n<A>\n<k>\n< >\n<>\n<>" }, { "input": "B", "output": "<B>" }, { "input": "b ", "output": "<b>" }, { "input": "j ", "output": "<j>" }, { "input": " \"\"", "output": "<>" }, { "input": " Lii", "output": "<Lii>" }, { "input": " m Z \"\" \" p\"", "output": "<m>\n<Z>\n<>\n< p>" } ]
1,672,953,755
2,147,483,647
PyPy 3-64
OK
TESTS
30
857
11,366,400
import shlex for s in shlex.split(input()): print('<' + s + '>')
Title: Command Line Arguments Time Limit: None seconds Memory Limit: None megabytes Problem Description: The problem describes the properties of a command line. The description somehow resembles the one you usually see in real operating systems. However, there are differences in the behavior. Please make sure you've read the statement attentively and use it as a formal document. In the Pindows operating system a strings are the lexemes of the command line — the first of them is understood as the name of the program to run and the following lexemes are its arguments. For example, as we execute the command " run.exe one, two . ", we give four lexemes to the Pindows command line: "run.exe", "one,", "two", ".". More formally, if we run a command that can be represented as string *s* (that has no quotes), then the command line lexemes are maximal by inclusion substrings of string *s* that contain no spaces. To send a string with spaces or an empty string as a command line lexeme, we can use double quotes. The block of characters that should be considered as one lexeme goes inside the quotes. Embedded quotes are prohibited — that is, for each occurrence of character """ we should be able to say clearly that the quotes are opening or closing. For example, as we run the command ""run.exe o" "" " ne, " two . " " ", we give six lexemes to the Pindows command line: "run.exe o", "" (an empty string), " ne, ", "two", ".", " " (a single space). It is guaranteed that each lexeme of the command line is either surrounded by spaces on both sides or touches the corresponding command border. One of its consequences is: the opening brackets are either the first character of the string or there is a space to the left of them. You have a string that consists of uppercase and lowercase English letters, digits, characters ".,?!"" and spaces. It is guaranteed that this string is a correct OS Pindows command line string. Print all lexemes of this command line string. Consider the character """ to be used only in order to denote a single block of characters into one command line lexeme. In particular, the consequence is that the given string has got an even number of such characters. Input Specification: The single line contains a non-empty string *s*. String *s* consists of at most 105 characters. Each character is either an uppercase or a lowercase English letter, or a digit, or one of the ".,?!"" signs, or a space. It is guaranteed that the given string is some correct command line string of the OS Pindows. It is guaranteed that the given command line string contains at least one lexeme. Output Specification: In the first line print the first lexeme, in the second line print the second one and so on. To make the output clearer, print the "&lt;" (less) character to the left of your lexemes and the "&gt;" (more) character to the right. Print the lexemes in the order in which they occur in the command. Please, follow the given output format strictly. For more clarifications on the output format see the test samples. Demo Input: ['"RUn.exe O" "" " 2ne, " two! . " "\n', 'firstarg second "" \n'] Demo Output: ['&lt;RUn.exe O&gt;\n&lt;&gt;\n&lt; 2ne, &gt;\n&lt;two!&gt;\n&lt;.&gt;\n&lt; &gt;\n', '&lt;firstarg&gt;\n&lt;second&gt;\n&lt;&gt;\n'] Note: none
```python import shlex for s in shlex.split(input()): print('<' + s + '>') ```
3
757
A
Gotta Catch Em' All!
PROGRAMMING
1,000
[ "implementation" ]
null
null
Bash wants to become a Pokemon master one day. Although he liked a lot of Pokemon, he has always been fascinated by Bulbasaur the most. Soon, things started getting serious and his fascination turned into an obsession. Since he is too young to go out and catch Bulbasaur, he came up with his own way of catching a Bulbasaur. Each day, he takes the front page of the newspaper. He cuts out the letters one at a time, from anywhere on the front page of the newspaper to form the word "Bulbasaur" (without quotes) and sticks it on his wall. Bash is very particular about case — the first letter of "Bulbasaur" must be upper case and the rest must be lower case. By doing this he thinks he has caught one Bulbasaur. He then repeats this step on the left over part of the newspaper. He keeps doing this until it is not possible to form the word "Bulbasaur" from the newspaper. Given the text on the front page of the newspaper, can you tell how many Bulbasaurs he will catch today? Note: uppercase and lowercase letters are considered different.
Input contains a single line containing a string *s* (1<=<=≤<=<=|*s*|<=<=≤<=<=105) — the text on the front page of the newspaper without spaces and punctuation marks. |*s*| is the length of the string *s*. The string *s* contains lowercase and uppercase English letters, i.e. .
Output a single integer, the answer to the problem.
[ "Bulbbasaur\n", "F\n", "aBddulbasaurrgndgbualdBdsagaurrgndbb\n" ]
[ "1\n", "0\n", "2\n" ]
In the first case, you could pick: Bulbbasaur. In the second case, there is no way to pick even a single Bulbasaur. In the third case, you can rearrange the string to BulbasaurBulbasauraddrgndgddgargndbb to get two words "Bulbasaur".
500
[ { "input": "Bulbbasaur", "output": "1" }, { "input": "F", "output": "0" }, { "input": "aBddulbasaurrgndgbualdBdsagaurrgndbb", "output": "2" }, { "input": "BBBBBBBBBBbbbbbbbbbbuuuuuuuuuullllllllllssssssssssaaaaaaaaaarrrrrrrrrr", "output": "5" }, { "input": "BBBBBBBBBBbbbbbbbbbbbbbbbbbbbbuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuussssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "BBBBBBBBBBssssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaarrrrrrrrrr", "output": "0" }, { "input": "BBBBBBBBBBbbbbbbbbbbbbbbbbbbbbuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuullllllllllllllllllllssssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaarrrrrrrrrrrrrrrrrrrr", "output": "10" }, { "input": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBbbbbbbbbbbbbbbbbbbbbuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuullllllllllllllllllllssssssssssssssssssssaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaarrrrrrrrrrrrrrrrrrrrrrrrrrrrrr", "output": "20" }, { "input": "CeSlSwec", "output": "0" }, { "input": "PnMrWPBGzVcmRcO", "output": "0" }, { "input": "hHPWBQeEmCuhdCnzrqYtuFtwxokGhdGkFtsFICVqYfJeUrSBtSxEbzMCblOgqOvjXURhSKivPcseqgiNuUgIboEYMvVeRBbpzCGCfVydDvZNFGSFidwUtNbmPSfSYdMNmHgchIsiVswzFsGQewlMVEzicOagpWMdCWrCdPmexfnM", "output": "0" }, { "input": "BBBBBBBBBBbbbbbbbbbbbbuuuuuuuuuuuullllllllllllssssssssssssaaaaaaaaaaaarrrrrrrrrrrrZBphUC", "output": "6" }, { "input": "bulsar", "output": "0" }, { "input": "Bblsar", "output": "0" }, { "input": "Bbusar", "output": "0" }, { "input": "Bbular", "output": "0" }, { "input": "Bbulsr", "output": "0" }, { "input": "Bbulsa", "output": "0" }, { "input": "Bbulsar", "output": "0" }, { "input": "Bbulsar", "output": "0" }, { "input": "CaQprCjTiQACZjUJjSmMHVTDorSUugvTtksEjptVzNLhClWaVVWszIixBlqFkvjDmbRjarQoUWhXHoCgYNNjvEgRTgKpbdEMFsmqcTyvJzupKgYiYMtrZWXIAGVhmDURtddbBZIMgIgXqQUmXpssLSaVCDGZDHimNthwiAWabjtcraAQugMCpBPQZbBGZyqUZmzDVSvJZmDWfZEUHGJVtiJANAIbvjTxtvvTbjWRpNQZlxAqpLCLRVwYWqLaHOTvzgeNGdxiBwsAVKKsewXMTwZUUfxYwrwsiaRBwEdvDDoPsQUtinvajBoRzLBUuQekhjsfDAOQzIABSVPitRuhvvqeAahsSELTGbCPh", "output": "2" }, { "input": "Bulbasaur", "output": "1" }, { "input": "BulbasaurBulbasaur", "output": "2" }, { "input": "Bulbbasar", "output": "0" }, { "input": "Bulbasur", "output": "0" }, { "input": "Bulbsaur", "output": "0" }, { "input": "BulbsurBulbsurBulbsurBulbsur", "output": "0" }, { "input": "Blbbasar", "output": "0" }, { "input": "Bulbasar", "output": "0" }, { "input": "BBullllbbaassaauurr", "output": "1" }, { "input": "BulbasaurBulbasar", "output": "1" }, { "input": "BulbasaurBulbsaur", "output": "1" }, { "input": "Bubasaur", "output": "0" }, { "input": "ulbasaurulbasaur", "output": "0" }, { "input": "Bulbasr", "output": "0" }, { "input": "BBBuuulllbbbaaasssaaauuurrr", "output": "3" }, { "input": "BBuuuullbbaaaassrr", "output": "2" }, { "input": "BBBBBBBuuuuuuuullllllllllllbbbbaaaaaassssssssssssssssaaaaauuuuuuuuuuuuurrrrrrrrrrrrrrrr", "output": "4" }, { "input": "BBuullbbaassaarr", "output": "1" }, { "input": "Bulbasau", "output": "0" }, { "input": "BBuullbbaassaauurr", "output": "2" }, { "input": "BulbasauBulbasauBulbasauBulbasauBulbasauBulbasauBulbasauBulbasau", "output": "0" }, { "input": "Blbasaur", "output": "0" }, { "input": "BulbasaurBulbasaurd", "output": "2" }, { "input": "ulbasaur", "output": "0" }, { "input": "Bulbaaur", "output": "0" }, { "input": "BBuuuullbbbbbbbbbbbbbbbaassrr", "output": "1" }, { "input": "Bulbasua", "output": "0" }, { "input": "Bubbasaur", "output": "0" }, { "input": "BulbasauBulbasauBulbasauBulbasauBulbasauBulbasaurrr", "output": "3" }, { "input": "BulbasaurBubasaur", "output": "1" }, { "input": "Baab", "output": "0" }, { "input": "BulbasaurBulbasau", "output": "1" }, { "input": "Bulbasauu", "output": "0" }, { "input": "BulbasauBulbasau", "output": "0" }, { "input": "BBBBBBBBBBB", "output": "0" }, { "input": "Bulbbasau", "output": "0" }, { "input": "BulbbasaurBulbbasar", "output": "1" }, { "input": "Bulaaaasaur", "output": "0" }, { "input": "BulbasaurBulbasauBulbasauBulbasau", "output": "1" } ]
1,688,265,312
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
9
46
307,200
from collections import Counter s = Counter(input()) res = min(s["B"], s["u"] // 2, s["l"], s["b"], s["a"] // 2, s["r"]) print(res)
Title: Gotta Catch Em' All! Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bash wants to become a Pokemon master one day. Although he liked a lot of Pokemon, he has always been fascinated by Bulbasaur the most. Soon, things started getting serious and his fascination turned into an obsession. Since he is too young to go out and catch Bulbasaur, he came up with his own way of catching a Bulbasaur. Each day, he takes the front page of the newspaper. He cuts out the letters one at a time, from anywhere on the front page of the newspaper to form the word "Bulbasaur" (without quotes) and sticks it on his wall. Bash is very particular about case — the first letter of "Bulbasaur" must be upper case and the rest must be lower case. By doing this he thinks he has caught one Bulbasaur. He then repeats this step on the left over part of the newspaper. He keeps doing this until it is not possible to form the word "Bulbasaur" from the newspaper. Given the text on the front page of the newspaper, can you tell how many Bulbasaurs he will catch today? Note: uppercase and lowercase letters are considered different. Input Specification: Input contains a single line containing a string *s* (1<=<=≤<=<=|*s*|<=<=≤<=<=105) — the text on the front page of the newspaper without spaces and punctuation marks. |*s*| is the length of the string *s*. The string *s* contains lowercase and uppercase English letters, i.e. . Output Specification: Output a single integer, the answer to the problem. Demo Input: ['Bulbbasaur\n', 'F\n', 'aBddulbasaurrgndgbualdBdsagaurrgndbb\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first case, you could pick: Bulbbasaur. In the second case, there is no way to pick even a single Bulbasaur. In the third case, you can rearrange the string to BulbasaurBulbasauraddrgndgddgargndbb to get two words "Bulbasaur".
```python from collections import Counter s = Counter(input()) res = min(s["B"], s["u"] // 2, s["l"], s["b"], s["a"] // 2, s["r"]) print(res) ```
0
723
A
The New Year: Meeting Friends
PROGRAMMING
800
[ "implementation", "math", "sortings" ]
null
null
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer.
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Print one integer — the minimum total distance the friends need to travel in order to meet together.
[ "7 1 4\n", "30 20 10\n" ]
[ "6\n", "20\n" ]
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
500
[ { "input": "7 1 4", "output": "6" }, { "input": "30 20 10", "output": "20" }, { "input": "1 4 100", "output": "99" }, { "input": "100 1 91", "output": "99" }, { "input": "1 45 100", "output": "99" }, { "input": "1 2 3", "output": "2" }, { "input": "71 85 88", "output": "17" }, { "input": "30 38 99", "output": "69" }, { "input": "23 82 95", "output": "72" }, { "input": "22 41 47", "output": "25" }, { "input": "9 94 77", "output": "85" }, { "input": "1 53 51", "output": "52" }, { "input": "25 97 93", "output": "72" }, { "input": "42 53 51", "output": "11" }, { "input": "81 96 94", "output": "15" }, { "input": "21 5 93", "output": "88" }, { "input": "50 13 75", "output": "62" }, { "input": "41 28 98", "output": "70" }, { "input": "69 46 82", "output": "36" }, { "input": "87 28 89", "output": "61" }, { "input": "44 45 40", "output": "5" }, { "input": "86 97 68", "output": "29" }, { "input": "43 92 30", "output": "62" }, { "input": "16 70 1", "output": "69" }, { "input": "40 46 19", "output": "27" }, { "input": "71 38 56", "output": "33" }, { "input": "82 21 80", "output": "61" }, { "input": "75 8 35", "output": "67" }, { "input": "75 24 28", "output": "51" }, { "input": "78 23 56", "output": "55" }, { "input": "85 31 10", "output": "75" }, { "input": "76 50 9", "output": "67" }, { "input": "95 37 34", "output": "61" }, { "input": "84 61 35", "output": "49" }, { "input": "87 85 37", "output": "50" }, { "input": "1 3 2", "output": "2" }, { "input": "4 2 6", "output": "4" }, { "input": "6 9 3", "output": "6" }, { "input": "12 4 8", "output": "8" }, { "input": "15 10 5", "output": "10" }, { "input": "1 50 17", "output": "49" }, { "input": "10 5 15", "output": "10" }, { "input": "8 1 9", "output": "8" }, { "input": "3 5 4", "output": "2" }, { "input": "2 1 3", "output": "2" }, { "input": "1 8 2", "output": "7" }, { "input": "1 100 2", "output": "99" }, { "input": "1 4 6", "output": "5" } ]
1,671,985,483
2,147,483,647
Python 3
OK
TESTS
48
46
0
l=[int(i) for i in input().split()] l.sort() print(min((2*l[2]-l[0]-l[1]),(l[2]-l[0]),l[2]+l[1]-2*l[0]))
Title: The New Year: Meeting Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer. Input Specification: The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively. Output Specification: Print one integer — the minimum total distance the friends need to travel in order to meet together. Demo Input: ['7 1 4\n', '30 20 10\n'] Demo Output: ['6\n', '20\n'] Note: In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
```python l=[int(i) for i in input().split()] l.sort() print(min((2*l[2]-l[0]-l[1]),(l[2]-l[0]),l[2]+l[1]-2*l[0])) ```
3
37
A
Towers
PROGRAMMING
1,000
[ "sortings" ]
A. Towers
2
256
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
[ "3\n1 2 3\n", "4\n6 5 6 7\n" ]
[ "1 3\n", "2 3\n" ]
none
500
[ { "input": "3\n1 2 3", "output": "1 3" }, { "input": "4\n6 5 6 7", "output": "2 3" }, { "input": "4\n3 2 1 1", "output": "2 3" }, { "input": "4\n1 2 3 3", "output": "2 3" }, { "input": "3\n20 22 36", "output": "1 3" }, { "input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162", "output": "2 23" }, { "input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193", "output": "2 43" }, { "input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111", "output": "2 57" }, { "input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642", "output": "2 80" }, { "input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188", "output": "2 92" }, { "input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233", "output": "3 101" }, { "input": "5\n5 5 5 5 5", "output": "5 1" }, { "input": "3\n1000 1000 1000", "output": "3 1" }, { "input": "1\n1000", "output": "1 1" }, { "input": "1\n1", "output": "1 1" }, { "input": "5\n1 1000 1000 1000 1000", "output": "4 2" }, { "input": "5\n1000 1000 1000 8 7", "output": "3 3" } ]
1,633,538,111
2,147,483,647
Python 3
OK
TESTS
61
154
6,963,200
n = int(input()) lengths = list(map(int, input().split())) towers = {} for length in lengths: if str(length) in towers.keys(): towers[str(length)] += 1 else: towers[str(length)] = 1 max_height = 0 num_towers = 0 for key in towers.keys(): if towers[key] > max_height: max_height = towers[key] num_towers += 1 print(max_height, num_towers)
Title: Towers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible. Input Specification: The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000. Output Specification: In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars. Demo Input: ['3\n1 2 3\n', '4\n6 5 6 7\n'] Demo Output: ['1 3\n', '2 3\n'] Note: none
```python n = int(input()) lengths = list(map(int, input().split())) towers = {} for length in lengths: if str(length) in towers.keys(): towers[str(length)] += 1 else: towers[str(length)] = 1 max_height = 0 num_towers = 0 for key in towers.keys(): if towers[key] > max_height: max_height = towers[key] num_towers += 1 print(max_height, num_towers) ```
3.94853
548
A
Mike and Fax
PROGRAMMING
1,100
[ "brute force", "implementation", "strings" ]
null
null
While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*. He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length. He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length.
The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000). The second line contains integer *k* (1<=≤<=*k*<=≤<=1000).
Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise.
[ "saba\n2\n", "saddastavvat\n2\n" ]
[ "NO\n", "YES\n" ]
Palindrome is a string reading the same forward and backward. In the second sample, the faxes in his back-bag can be "saddas" and "tavvat".
500
[ { "input": "saba\n2", "output": "NO" }, { "input": "saddastavvat\n2", "output": "YES" }, { "input": "aaaaaaaaaa\n3", "output": "NO" }, { "input": "aaaaaa\n3", "output": "YES" }, { "input": "abaacca\n2", "output": "NO" }, { "input": "a\n1", "output": "YES" }, { "input": "princeofpersia\n1", "output": "NO" }, { "input": "xhwbdoryfiaxglripavycmxmcejbcpzidrqsqvikfzjyfnmedxrvlnusavyhillaxrblkynwdrlhthtqzjktzkullgrqsolqssocpfwcaizhovajlhmeibhiuwtxpljkyyiwykzpmazkkzampzkywiyykjlpxtwuihbiemhljavohziacwfpcossqlosqrgllukztkjzqththlrdwnyklbrxallihyvasunlvrxdemnfyjzfkivqsqrdizpcbjecmxmcyvapirlgxaifyrodbwhx\n1", "output": "YES" }, { "input": "yfhqnbzaqeqmcvtsbcdn\n456", "output": "NO" }, { "input": "lgsdfiforlqrohhjyzrigewkigiiffvbyrapzmjvtkklndeyuqpuukajgtguhlarjdqlxksyekbjgrmhuyiqdlzjqqzlxufffpelyptodwhvkfbalxbufrlcsjgxmfxeqsszqghcustqrqjljattgvzynyvfbjgbuynbcguqtyfowgtcbbaywvcrgzrulqpghwoflutswu\n584", "output": "NO" }, { "input": "awlrhmxxivqbntvtapwkdkunamcqoerfncfmookhdnuxtttlxmejojpwbdyxirdsjippzjhdrpjepremruczbedxrjpodlyyldopjrxdebzcurmerpejprdhjzppijsdrixydbwpjojemxltttxundhkoomfcnfreoqcmanukdkwpatvtnbqvixxmhrlwa\n1", "output": "YES" }, { "input": "kafzpsglcpzludxojtdhzynpbekzssvhzizfrboxbhqvojiqtjitrackqccxgenwwnegxccqkcartijtqijovqhbxobrfzizhvsszkebpnyzhdtjoxdulzpclgspzfakvcbbjejeubvrrzlvjjgrcprntbyuakoxowoybbxgdugjffgbtfwrfiobifrshyaqqayhsrfiboifrwftbgffjgudgxbbyowoxokauybtnrpcrgjjvlzrrvbuejejbbcv\n2", "output": "YES" }, { "input": "zieqwmmbrtoxysvavwdemmdeatfrolsqvvlgphhhmojjfxfurtuiqdiilhlcwwqedlhblrzmvuoaczcwrqzyymiggpvbpkycibsvkhytrzhguksxyykkkvfljbbnjblylftmqxkojithwsegzsaexlpuicexbdzpwesrkzbqltxhifwqcehzsjgsqbwkujvjbjpqxdpmlimsusumizizpyigmkxwuberthdghnepyrxzvvidxeafwylegschhtywvqsxuqmsddhkzgkdiekodqpnftdyhnpicsnbhfxemxllvaurkmjvtrmqkulerxtaolmokiqqvqgechkqxmendpmgxwiaffcajmqjmvrwryzxujmiasuqtosuisiclnv\n8", "output": "NO" }, { "input": "syghzncbi\n829", "output": "NO" }, { "input": "ljpdpstntznciejqqtpysskztdfawuncqzwwfefrfsihyrdopwawowshquqnjhesxszuywezpebpzhtopgngrnqgwnoqhyrykojguybvdbjpfpmvkxscocywzsxcivysfrrzsonayztzzuybrkiombhqcfkszyscykzistiobrpavezedgobowjszfadcccmxyqehmkgywiwxffibzetb\n137", "output": "NO" }, { "input": "eytuqriplfczwsqlsnjetfpzehzvzayickkbnfqddaisfpasvigwtnvbybwultsgrtjbaebktvubwofysgidpufzteuhuaaqkhmhguockoczlrmlrrzouvqtwbcchxxiydbohnvrmtqjzhkfmvdulojhdvgwudvidpausvfujkjprxsobliuauxleqvsmz\n253", "output": "NO" }, { "input": "xkaqgwabuilhuqwhnrdtyattmqcjfbiqodjlwzgcyvghqncklbhnlmagvjvwysrfryrlmclninogumjfmyenkmydlmifxpkvlaapgnfarejaowftxxztshsesjtsgommaeslrhronruqdurvjesydrzmxirmxumrcqezznqltngsgdcthivdnjnshjfujtiqsltpttgbljfcbqsfwbzokciqlavrthgaqbzikpwwsebzwddlvdwrmztwmhcxdinwlbklwmteeybbdbzevfbsrtldapulwgusuvnreiflkytonzmervyrlbqhzapgxepwauaiwygpxarfeyqhimzlxntjuaaigeisgrvwgbhqemqetzyallzaoqprhzpjibkutgwrodruqu\n857", "output": "NO" }, { "input": "rbehjxpblnzfgeebpkvzznwtzszghjuuxovreapmwehqyjymrkmksffbdpbdyegulabsmjiykeeqtuvqqyxlitpxjdpwmqtlmudqsksgwqekvwfjdsggzajcpsyserkctpbajgzdbiqaekfaepnecezdzamqszpwfvhlannszgaiewvcdnnvzhblmuzjtqeyjcqjqoxatavavokyxokuxwuqueskktxnxraihnqovrfykpzsyjmrhqsvbobzsnfqwvdwatvjxaubtiwhgvrqwjhgfnauqegqmcwnaruinplmtmxhvohhqgvcatsdqiwkvslhqzqevdgdhpijjevuyuitnixdjhwlmjsstmugownjdhvxueg\n677", "output": "NO" }, { "input": "a\n3", "output": "NO" }, { "input": "aa\n2", "output": "YES" }, { "input": "abcaabca\n2", "output": "NO" }, { "input": "aaaaaaaaab\n5", "output": "NO" }, { "input": "aabbb\n3", "output": "NO" }, { "input": "abcde\n5", "output": "YES" }, { "input": "aabc\n2", "output": "NO" }, { "input": "aabcaa\n3", "output": "NO" } ]
1,659,959,465
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
51
77
0
s = list(input()) k = int(input()) if len(s)%k==0: i=0 while i<len(s): ss = s[i:len(s)//k] t = list(reversed(ss)) if ss != t: print("NO"); exit() i+=(len(s)//k) print("YES") else: print("NO")
Title: Mike and Fax Time Limit: None seconds Memory Limit: None megabytes Problem Description: While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*. He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length. He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length. Input Specification: The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000). The second line contains integer *k* (1<=≤<=*k*<=≤<=1000). Output Specification: Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise. Demo Input: ['saba\n2\n', 'saddastavvat\n2\n'] Demo Output: ['NO\n', 'YES\n'] Note: Palindrome is a string reading the same forward and backward. In the second sample, the faxes in his back-bag can be "saddas" and "tavvat".
```python s = list(input()) k = int(input()) if len(s)%k==0: i=0 while i<len(s): ss = s[i:len(s)//k] t = list(reversed(ss)) if ss != t: print("NO"); exit() i+=(len(s)//k) print("YES") else: print("NO") ```
0
803
A
Maximal Binary Matrix
PROGRAMMING
1,400
[ "constructive algorithms" ]
null
null
You are given matrix with *n* rows and *n* columns filled with zeroes. You should put *k* ones in it in such a way that the resulting matrix is symmetrical with respect to the main diagonal (the diagonal that goes from the top left to the bottom right corner) and is lexicographically maximal. One matrix is lexicographically greater than the other if the first different number in the first different row from the top in the first matrix is greater than the corresponding number in the second one. If there exists no such matrix then output -1.
The first line consists of two numbers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=106).
If the answer exists then output resulting matrix. Otherwise output -1.
[ "2 1\n", "3 2\n", "2 5\n" ]
[ "1 0 \n0 0 \n", "1 0 0 \n0 1 0 \n0 0 0 \n", "-1\n" ]
none
0
[ { "input": "2 1", "output": "1 0 \n0 0 " }, { "input": "3 2", "output": "1 0 0 \n0 1 0 \n0 0 0 " }, { "input": "2 5", "output": "-1" }, { "input": "1 0", "output": "0 " }, { "input": "1 1", "output": "1 " }, { "input": "20 398", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1..." }, { "input": "20 401", "output": "-1" }, { "input": "100 3574", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "100 10000", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "100 10001", "output": "-1" }, { "input": "2 3", "output": "1 1 \n1 0 " }, { "input": "4 5", "output": "1 1 1 0 \n1 0 0 0 \n1 0 0 0 \n0 0 0 0 " }, { "input": "5 6", "output": "1 1 1 0 0 \n1 1 0 0 0 \n1 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 24", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 0 " }, { "input": "2 0", "output": "0 0 \n0 0 " }, { "input": "3 5", "output": "1 1 1 \n1 0 0 \n1 0 0 " }, { "input": "3 3", "output": "1 1 0 \n1 0 0 \n0 0 0 " }, { "input": "5 10", "output": "1 1 1 1 1 \n1 1 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 " }, { "input": "3 4", "output": "1 1 0 \n1 1 0 \n0 0 0 " }, { "input": "4 3", "output": "1 1 0 0 \n1 0 0 0 \n0 0 0 0 \n0 0 0 0 " }, { "input": "1 1000000", "output": "-1" }, { "input": "3 6", "output": "1 1 1 \n1 1 0 \n1 0 0 " }, { "input": "1 2", "output": "-1" }, { "input": "1 0", "output": "0 " }, { "input": "1 1", "output": "1 " }, { "input": "1 2", "output": "-1" }, { "input": "1 3", "output": "-1" }, { "input": "1 4", "output": "-1" }, { "input": "1 5", "output": "-1" }, { "input": "1 6", "output": "-1" }, { "input": "1 7", "output": "-1" }, { "input": "1 8", "output": "-1" }, { "input": "1 9", "output": "-1" }, { "input": "1 10", "output": "-1" }, { "input": "1 11", "output": "-1" }, { "input": "1 12", "output": "-1" }, { "input": "1 13", "output": "-1" }, { "input": "1 14", "output": "-1" }, { "input": "1 15", "output": "-1" }, { "input": "1 16", "output": "-1" }, { "input": "1 17", "output": "-1" }, { "input": "1 18", "output": "-1" }, { "input": "1 19", "output": "-1" }, { "input": "1 20", "output": "-1" }, { "input": "1 21", "output": "-1" }, { "input": "1 22", "output": "-1" }, { "input": "1 23", "output": "-1" }, { "input": "1 24", "output": "-1" }, { "input": "1 25", "output": "-1" }, { "input": "1 26", "output": "-1" }, { "input": "2 0", "output": "0 0 \n0 0 " }, { "input": "2 1", "output": "1 0 \n0 0 " }, { "input": "2 2", "output": "1 0 \n0 1 " }, { "input": "2 3", "output": "1 1 \n1 0 " }, { "input": "2 4", "output": "1 1 \n1 1 " }, { "input": "2 5", "output": "-1" }, { "input": "2 6", "output": "-1" }, { "input": "2 7", "output": "-1" }, { "input": "2 8", "output": "-1" }, { "input": "2 9", "output": "-1" }, { "input": "2 10", "output": "-1" }, { "input": "2 11", "output": "-1" }, { "input": "2 12", "output": "-1" }, { "input": "2 13", "output": "-1" }, { "input": "2 14", "output": "-1" }, { "input": "2 15", "output": "-1" }, { "input": "2 16", "output": "-1" }, { "input": "2 17", "output": "-1" }, { "input": "2 18", "output": "-1" }, { "input": "2 19", "output": "-1" }, { "input": "2 20", "output": "-1" }, { "input": "2 21", "output": "-1" }, { "input": "2 22", "output": "-1" }, { "input": "2 23", "output": "-1" }, { "input": "2 24", "output": "-1" }, { "input": "2 25", "output": "-1" }, { "input": "2 26", "output": "-1" }, { "input": "3 0", "output": "0 0 0 \n0 0 0 \n0 0 0 " }, { "input": "3 1", "output": "1 0 0 \n0 0 0 \n0 0 0 " }, { "input": "3 2", "output": "1 0 0 \n0 1 0 \n0 0 0 " }, { "input": "3 3", "output": "1 1 0 \n1 0 0 \n0 0 0 " }, { "input": "3 4", "output": "1 1 0 \n1 1 0 \n0 0 0 " }, { "input": "3 5", "output": "1 1 1 \n1 0 0 \n1 0 0 " }, { "input": "3 6", "output": "1 1 1 \n1 1 0 \n1 0 0 " }, { "input": "3 7", "output": "1 1 1 \n1 1 0 \n1 0 1 " }, { "input": "3 8", "output": "1 1 1 \n1 1 1 \n1 1 0 " }, { "input": "3 9", "output": "1 1 1 \n1 1 1 \n1 1 1 " }, { "input": "3 10", "output": "-1" }, { "input": "3 11", "output": "-1" }, { "input": "3 12", "output": "-1" }, { "input": "3 13", "output": "-1" }, { "input": "3 14", "output": "-1" }, { "input": "3 15", "output": "-1" }, { "input": "3 16", "output": "-1" }, { "input": "3 17", "output": "-1" }, { "input": "3 18", "output": "-1" }, { "input": "3 19", "output": "-1" }, { "input": "3 20", "output": "-1" }, { "input": "3 21", "output": "-1" }, { "input": "3 22", "output": "-1" }, { "input": "3 23", "output": "-1" }, { "input": "3 24", "output": "-1" }, { "input": "3 25", "output": "-1" }, { "input": "3 26", "output": "-1" }, { "input": "4 0", "output": "0 0 0 0 \n0 0 0 0 \n0 0 0 0 \n0 0 0 0 " }, { "input": "4 1", "output": "1 0 0 0 \n0 0 0 0 \n0 0 0 0 \n0 0 0 0 " }, { "input": "4 2", "output": "1 0 0 0 \n0 1 0 0 \n0 0 0 0 \n0 0 0 0 " }, { "input": "4 3", "output": "1 1 0 0 \n1 0 0 0 \n0 0 0 0 \n0 0 0 0 " }, { "input": "4 4", "output": "1 1 0 0 \n1 1 0 0 \n0 0 0 0 \n0 0 0 0 " }, { "input": "4 5", "output": "1 1 1 0 \n1 0 0 0 \n1 0 0 0 \n0 0 0 0 " }, { "input": "4 6", "output": "1 1 1 0 \n1 1 0 0 \n1 0 0 0 \n0 0 0 0 " }, { "input": "4 7", "output": "1 1 1 1 \n1 0 0 0 \n1 0 0 0 \n1 0 0 0 " }, { "input": "4 8", "output": "1 1 1 1 \n1 1 0 0 \n1 0 0 0 \n1 0 0 0 " }, { "input": "4 9", "output": "1 1 1 1 \n1 1 0 0 \n1 0 1 0 \n1 0 0 0 " }, { "input": "4 10", "output": "1 1 1 1 \n1 1 1 0 \n1 1 0 0 \n1 0 0 0 " }, { "input": "4 11", "output": "1 1 1 1 \n1 1 1 0 \n1 1 1 0 \n1 0 0 0 " }, { "input": "4 12", "output": "1 1 1 1 \n1 1 1 1 \n1 1 0 0 \n1 1 0 0 " }, { "input": "4 13", "output": "1 1 1 1 \n1 1 1 1 \n1 1 1 0 \n1 1 0 0 " }, { "input": "4 14", "output": "1 1 1 1 \n1 1 1 1 \n1 1 1 0 \n1 1 0 1 " }, { "input": "4 15", "output": "1 1 1 1 \n1 1 1 1 \n1 1 1 1 \n1 1 1 0 " }, { "input": "4 16", "output": "1 1 1 1 \n1 1 1 1 \n1 1 1 1 \n1 1 1 1 " }, { "input": "4 17", "output": "-1" }, { "input": "4 18", "output": "-1" }, { "input": "4 19", "output": "-1" }, { "input": "4 20", "output": "-1" }, { "input": "4 21", "output": "-1" }, { "input": "4 22", "output": "-1" }, { "input": "4 23", "output": "-1" }, { "input": "4 24", "output": "-1" }, { "input": "4 25", "output": "-1" }, { "input": "4 26", "output": "-1" }, { "input": "5 0", "output": "0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 1", "output": "1 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 2", "output": "1 0 0 0 0 \n0 1 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 3", "output": "1 1 0 0 0 \n1 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 4", "output": "1 1 0 0 0 \n1 1 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 5", "output": "1 1 1 0 0 \n1 0 0 0 0 \n1 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 6", "output": "1 1 1 0 0 \n1 1 0 0 0 \n1 0 0 0 0 \n0 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 7", "output": "1 1 1 1 0 \n1 0 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 8", "output": "1 1 1 1 0 \n1 1 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 \n0 0 0 0 0 " }, { "input": "5 9", "output": "1 1 1 1 1 \n1 0 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 " }, { "input": "5 10", "output": "1 1 1 1 1 \n1 1 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 " }, { "input": "5 11", "output": "1 1 1 1 1 \n1 1 0 0 0 \n1 0 1 0 0 \n1 0 0 0 0 \n1 0 0 0 0 " }, { "input": "5 12", "output": "1 1 1 1 1 \n1 1 1 0 0 \n1 1 0 0 0 \n1 0 0 0 0 \n1 0 0 0 0 " }, { "input": "5 13", "output": "1 1 1 1 1 \n1 1 1 0 0 \n1 1 1 0 0 \n1 0 0 0 0 \n1 0 0 0 0 " }, { "input": "5 14", "output": "1 1 1 1 1 \n1 1 1 1 0 \n1 1 0 0 0 \n1 1 0 0 0 \n1 0 0 0 0 " }, { "input": "5 15", "output": "1 1 1 1 1 \n1 1 1 1 0 \n1 1 1 0 0 \n1 1 0 0 0 \n1 0 0 0 0 " }, { "input": "5 16", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 0 0 0 \n1 1 0 0 0 \n1 1 0 0 0 " }, { "input": "5 17", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 0 0 \n1 1 0 0 0 \n1 1 0 0 0 " }, { "input": "5 18", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 0 0 \n1 1 0 1 0 \n1 1 0 0 0 " }, { "input": "5 19", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 0 \n1 1 1 0 0 \n1 1 0 0 0 " }, { "input": "5 20", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 0 \n1 1 1 1 0 \n1 1 0 0 0 " }, { "input": "5 21", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 0 0 \n1 1 1 0 0 " }, { "input": "5 22", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 0 \n1 1 1 0 0 " }, { "input": "5 23", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 0 \n1 1 1 0 1 " }, { "input": "5 24", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 0 " }, { "input": "5 25", "output": "1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 \n1 1 1 1 1 " }, { "input": "5 26", "output": "-1" }, { "input": "100 0", "output": "0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 1", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 2", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 3", "output": "1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 99", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 100", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 101", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 9999", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "100 10000", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 \n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "100 10001", "output": "-1" } ]
1,671,508,687
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
31
0
n,k=map(int,input().split()) a=[[0]*n for i in range(n)] if k>n: print(-1) else: for i in range(n): for j in range(k): if i==j: a[i][j]=1 for i in a: print(*i)
Title: Maximal Binary Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given matrix with *n* rows and *n* columns filled with zeroes. You should put *k* ones in it in such a way that the resulting matrix is symmetrical with respect to the main diagonal (the diagonal that goes from the top left to the bottom right corner) and is lexicographically maximal. One matrix is lexicographically greater than the other if the first different number in the first different row from the top in the first matrix is greater than the corresponding number in the second one. If there exists no such matrix then output -1. Input Specification: The first line consists of two numbers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=106). Output Specification: If the answer exists then output resulting matrix. Otherwise output -1. Demo Input: ['2 1\n', '3 2\n', '2 5\n'] Demo Output: ['1 0 \n0 0 \n', '1 0 0 \n0 1 0 \n0 0 0 \n', '-1\n'] Note: none
```python n,k=map(int,input().split()) a=[[0]*n for i in range(n)] if k>n: print(-1) else: for i in range(n): for j in range(k): if i==j: a[i][j]=1 for i in a: print(*i) ```
0
894
A
QAQ
PROGRAMMING
800
[ "brute force", "dp" ]
null
null
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Print a single integer — the number of subsequences "QAQ" in the string.
[ "QAQAQYSYIOIWIN\n", "QAQQQZZYNOIWIN\n" ]
[ "4\n", "3\n" ]
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
500
[ { "input": "QAQAQYSYIOIWIN", "output": "4" }, { "input": "QAQQQZZYNOIWIN", "output": "3" }, { "input": "QA", "output": "0" }, { "input": "IAQVAQZLQBQVQFTQQQADAQJA", "output": "24" }, { "input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ", "output": "378" }, { "input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ", "output": "1077" }, { "input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA", "output": "568" }, { "input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA", "output": "70" }, { "input": "W", "output": "0" }, { "input": "DBA", "output": "0" }, { "input": "RQAWNACASAAKAGAAAAQ", "output": "10" }, { "input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA", "output": "111" }, { "input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA", "output": "411" }, { "input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ", "output": "625" }, { "input": "QORZOYAQ", "output": "1" }, { "input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA", "output": "13174" }, { "input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT", "output": "10420" }, { "input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ", "output": "12488" }, { "input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA", "output": "9114" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "35937" }, { "input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE", "output": "254" }, { "input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE", "output": "2174" }, { "input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ", "output": "2962" }, { "input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA", "output": "2482" }, { "input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ", "output": "7768" }, { "input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA", "output": "5422" }, { "input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ", "output": "3024" }, { "input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ", "output": "4527" }, { "input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH", "output": "6416" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ", "output": "13136" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA", "output": "14231" }, { "input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "15296" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA", "output": "20825" }, { "input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ", "output": "20825" }, { "input": "Q", "output": "0" }, { "input": "A", "output": "0" }, { "input": "FFF", "output": "0" }, { "input": "AAAAAA", "output": "0" } ]
1,647,760,814
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
15
0
print(len([i for i in 'QAQ' if i in input()]))
Title: QAQ Time Limit: None seconds Memory Limit: None megabytes Problem Description: "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. Input Specification: The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. Output Specification: Print a single integer — the number of subsequences "QAQ" in the string. Demo Input: ['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n'] Demo Output: ['4\n', '3\n'] Note: In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
```python print(len([i for i in 'QAQ' if i in input()])) ```
-1
468
A
24 Game
PROGRAMMING
1,500
[ "constructive algorithms", "greedy", "math" ]
null
null
Little X used to play a card game called "24 Game", but recently he has found it too easy. So he invented a new game. Initially you have a sequence of *n* integers: 1,<=2,<=...,<=*n*. In a single step, you can pick two of them, let's denote them *a* and *b*, erase them from the sequence, and append to the sequence either *a*<=+<=*b*, or *a*<=-<=*b*, or *a*<=×<=*b*. After *n*<=-<=1 steps there is only one number left. Can you make this number equal to 24?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105).
If it's possible, print "YES" in the first line. Otherwise, print "NO" (without the quotes). If there is a way to obtain 24 as the result number, in the following *n*<=-<=1 lines print the required operations an operation per line. Each operation should be in form: "*a* *op* *b* = *c*". Where *a* and *b* are the numbers you've picked at this operation; *op* is either "+", or "-", or "*"; *c* is the result of corresponding operation. Note, that the absolute value of *c* mustn't be greater than 1018. The result of the last operation must be equal to 24. Separate operator sign and equality sign from numbers with spaces. If there are multiple valid answers, you may print any of them.
[ "1\n", "8\n" ]
[ "NO\n", "YES\n8 * 7 = 56\n6 * 5 = 30\n3 - 4 = -1\n1 - 2 = -1\n30 - -1 = 31\n56 - 31 = 25\n25 + -1 = 24\n" ]
none
500
[ { "input": "1", "output": "NO" }, { "input": "8", "output": "YES\n8 * 7 = 56\n6 * 5 = 30\n3 - 4 = -1\n1 - 2 = -1\n30 - -1 = 31\n56 - 31 = 25\n25 + -1 = 24" }, { "input": "12", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24" }, { "input": "100", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "1000", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "987", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..." }, { "input": "2", "output": "NO" }, { "input": "3", "output": "NO" }, { "input": "4", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24" }, { "input": "5", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24" }, { "input": "6", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24" }, { "input": "7", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24" }, { "input": "100000", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "99999", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..." }, { "input": "99998", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "99997", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..." }, { "input": "580", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "422", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "116", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "447", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..." }, { "input": "62052", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "25770", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "56118", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "86351", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..." }, { "input": "48108", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "33373", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..." }, { "input": "9782", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "19082", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..." }, { "input": "4", "output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24" }, { "input": "7", "output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24" }, { "input": "3", "output": "NO" } ]
1,582,951,301
2,147,483,647
PyPy 3
COMPILATION_ERROR
TESTS
0
0
0
def greedy(n): '''uses +, -, and * to reduce range(n) to 24''' if n < 4: print('NO') else: print('YES') if n%2 == 0: for i in range(5, n+1, 2): print(str(i+1) + '-' str(i) ' = 1') print('1 * 1 = 1') print('1 * 2 = 2') print('2 * 3 = 6') print('6 * 4 = 24') else: for i in range(6, n+1, 2): print(str(i+1) + '-' str(i) ' = 1') print('1 * 1 = 1') print('5 * 4 = 20') print('2 + 3 = 5') print('20 + 5 = 25') print('25 - 1 = 24') greedy(int(input()))
Title: 24 Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little X used to play a card game called "24 Game", but recently he has found it too easy. So he invented a new game. Initially you have a sequence of *n* integers: 1,<=2,<=...,<=*n*. In a single step, you can pick two of them, let's denote them *a* and *b*, erase them from the sequence, and append to the sequence either *a*<=+<=*b*, or *a*<=-<=*b*, or *a*<=×<=*b*. After *n*<=-<=1 steps there is only one number left. Can you make this number equal to 24? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105). Output Specification: If it's possible, print "YES" in the first line. Otherwise, print "NO" (without the quotes). If there is a way to obtain 24 as the result number, in the following *n*<=-<=1 lines print the required operations an operation per line. Each operation should be in form: "*a* *op* *b* = *c*". Where *a* and *b* are the numbers you've picked at this operation; *op* is either "+", or "-", or "*"; *c* is the result of corresponding operation. Note, that the absolute value of *c* mustn't be greater than 1018. The result of the last operation must be equal to 24. Separate operator sign and equality sign from numbers with spaces. If there are multiple valid answers, you may print any of them. Demo Input: ['1\n', '8\n'] Demo Output: ['NO\n', 'YES\n8 * 7 = 56\n6 * 5 = 30\n3 - 4 = -1\n1 - 2 = -1\n30 - -1 = 31\n56 - 31 = 25\n25 + -1 = 24\n'] Note: none
```python def greedy(n): '''uses +, -, and * to reduce range(n) to 24''' if n < 4: print('NO') else: print('YES') if n%2 == 0: for i in range(5, n+1, 2): print(str(i+1) + '-' str(i) ' = 1') print('1 * 1 = 1') print('1 * 2 = 2') print('2 * 3 = 6') print('6 * 4 = 24') else: for i in range(6, n+1, 2): print(str(i+1) + '-' str(i) ' = 1') print('1 * 1 = 1') print('5 * 4 = 20') print('2 + 3 = 5') print('20 + 5 = 25') print('25 - 1 = 24') greedy(int(input())) ```
-1
931
A
Friends Meeting
PROGRAMMING
800
[ "brute force", "greedy", "implementation", "math" ]
null
null
Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*. Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the third — by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6. The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point.
The first line contains a single integer *a* (1<=≤<=*a*<=≤<=1000) — the initial position of the first friend. The second line contains a single integer *b* (1<=≤<=*b*<=≤<=1000) — the initial position of the second friend. It is guaranteed that *a*<=≠<=*b*.
Print the minimum possible total tiredness if the friends meet in the same point.
[ "3\n4\n", "101\n99\n", "5\n10\n" ]
[ "1\n", "2\n", "9\n" ]
In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1. In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2. In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend — two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
500
[ { "input": "3\n4", "output": "1" }, { "input": "101\n99", "output": "2" }, { "input": "5\n10", "output": "9" }, { "input": "1\n2", "output": "1" }, { "input": "1\n1000", "output": "250000" }, { "input": "999\n1000", "output": "1" }, { "input": "1000\n999", "output": "1" }, { "input": "1000\n1", "output": "250000" }, { "input": "2\n1", "output": "1" }, { "input": "2\n999", "output": "249001" }, { "input": "2\n998", "output": "248502" }, { "input": "999\n2", "output": "249001" }, { "input": "998\n2", "output": "248502" }, { "input": "2\n1000", "output": "249500" }, { "input": "1000\n2", "output": "249500" }, { "input": "1\n999", "output": "249500" }, { "input": "999\n1", "output": "249500" }, { "input": "188\n762", "output": "82656" }, { "input": "596\n777", "output": "8281" }, { "input": "773\n70", "output": "123904" }, { "input": "825\n729", "output": "2352" }, { "input": "944\n348", "output": "89102" }, { "input": "352\n445", "output": "2209" }, { "input": "529\n656", "output": "4096" }, { "input": "19\n315", "output": "22052" }, { "input": "138\n370", "output": "13572" }, { "input": "546\n593", "output": "576" }, { "input": "285\n242", "output": "484" }, { "input": "773\n901", "output": "4160" }, { "input": "892\n520", "output": "34782" }, { "input": "864\n179", "output": "117649" }, { "input": "479\n470", "output": "25" }, { "input": "967\n487", "output": "57840" }, { "input": "648\n106", "output": "73712" }, { "input": "58\n765", "output": "125316" }, { "input": "235\n56", "output": "8100" }, { "input": "285\n153", "output": "4422" }, { "input": "943\n13", "output": "216690" }, { "input": "675\n541", "output": "4556" }, { "input": "4\n912", "output": "206570" } ]
1,618,668,540
2,147,483,647
Python 3
OK
TESTS
40
78
0
a =int(input()) b=int(input()) mid = (a+b)//2 a1 = abs(mid - a) b1= abs(mid - b) def summ(k): sum=0 while(k>0): sum+=k k-=1 return sum print(summ(a1)+summ(b1))
Title: Friends Meeting Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*. Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the third — by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6. The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point. Input Specification: The first line contains a single integer *a* (1<=≤<=*a*<=≤<=1000) — the initial position of the first friend. The second line contains a single integer *b* (1<=≤<=*b*<=≤<=1000) — the initial position of the second friend. It is guaranteed that *a*<=≠<=*b*. Output Specification: Print the minimum possible total tiredness if the friends meet in the same point. Demo Input: ['3\n4\n', '101\n99\n', '5\n10\n'] Demo Output: ['1\n', '2\n', '9\n'] Note: In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1. In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2. In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend — two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
```python a =int(input()) b=int(input()) mid = (a+b)//2 a1 = abs(mid - a) b1= abs(mid - b) def summ(k): sum=0 while(k>0): sum+=k k-=1 return sum print(summ(a1)+summ(b1)) ```
3
626
E
Simple Skewness
PROGRAMMING
2,400
[ "binary search", "math", "ternary search" ]
null
null
Define the simple skewness of a collection of numbers to be the collection's mean minus its median. You are given a list of *n* (not necessarily distinct) integers. Find the non-empty subset (with repetition) with the maximum simple skewness. The mean of a collection is the average of its elements. The median of a collection is its middle element when all of its elements are sorted, or the average of its two middle elements if it has even size.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200 000) — the number of elements in the list. The second line contains *n* integers *x**i* (0<=≤<=*x**i*<=≤<=1<=000<=000) — the *i*th element of the list.
In the first line, print a single integer *k* — the size of the subset. In the second line, print *k* integers — the elements of the subset in any order. If there are multiple optimal subsets, print any.
[ "4\n1 2 3 12\n", "4\n1 1 2 2\n", "2\n1 2\n" ]
[ "3\n1 2 12 \n", "3\n1 1 2 \n", "2\n1 2\n" ]
In the first case, the optimal subset is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/04cdbd07a0375de9c557422eca077386392a9349.png" style="max-width: 100.0%;max-height: 100.0%;"/>, which has mean 5, median 2, and simple skewness of 5 - 2 = 3. In the second case, the optimal subset is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/af49670de7c27def20edf0ec421d9bb17d904c94.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Note that repetition is allowed. In the last case, any subset has the same median and mean, so all have simple skewness of 0.
2,000
[ { "input": "4\n1 2 3 12", "output": "3\n1 2 12 " }, { "input": "4\n1 1 2 2", "output": "3\n1 1 2 " }, { "input": "2\n1 2", "output": "2\n1 2" }, { "input": "1\n1000000", "output": "1\n1000000 " }, { "input": "20\n999999 999998 999996 999992 999984 999968 999936 999872 999744 999488 998976 997952 995904 991808 983616 967232 934464 868928 737856 475712", "output": "1\n475712 " }, { "input": "21\n999999 999998 999996 999992 999984 999968 999936 999872 999744 999488 998976 997952 995904 991808 983616 967232 934464 868928 737856 475712 1000000", "output": "1\n475712 " }, { "input": "40\n999999 999999 999998 999998 999996 999996 999992 999992 999984 999984 999968 999968 999936 999936 999872 999872 999744 999744 999488 999488 998976 998976 997952 997952 995904 995904 991808 991808 983616 983616 967232 967232 934464 934464 868928 868928 737856 737856 475712 0", "output": "3\n737856 737856 999999 " }, { "input": "1\n534166", "output": "1\n534166 " }, { "input": "1\n412237", "output": "1\n412237 " }, { "input": "1\n253309", "output": "1\n253309 " }, { "input": "1\n94381", "output": "1\n94381 " }, { "input": "1\n935454", "output": "1\n935454 " }, { "input": "2\n847420 569122", "output": "2\n847420 569122" }, { "input": "2\n725491 635622", "output": "2\n725491 635622" }, { "input": "2\n566563 590441", "output": "2\n566563 590441" }, { "input": "2\n407635 619942", "output": "2\n407635 619942" }, { "input": "2\n248707 649443", "output": "2\n248707 649443" }, { "input": "3\n198356 154895 894059", "output": "3\n154895 198356 894059 " }, { "input": "3\n76427 184396 963319", "output": "3\n76427 184396 963319 " }, { "input": "3\n880502 176898 958582", "output": "1\n176898 " }, { "input": "3\n758573 206400 991528", "output": "1\n206400 " }, { "input": "3\n599645 198217 986791", "output": "1\n198217 " }, { "input": "4\n549294 703669 96824 126683", "output": "3\n96824 126683 703669 " }, { "input": "4\n390366 733171 92086 595244", "output": "3\n92086 390366 733171 " }, { "input": "4\n231438 762672 125033 26806", "output": "3\n26806 125033 762672 " }, { "input": "4\n109509 792173 120296 495368", "output": "3\n109509 120296 792173 " }, { "input": "4\n950582 784676 190241 964614", "output": "1\n190241 " }, { "input": "5\n900232 289442 225592 622868 113587", "output": "3\n113587 225592 900232 " }, { "input": "5\n741304 281944 258539 54430 284591", "output": "3\n281944 284591 741304 " }, { "input": "5\n582376 311446 253801 560676 530279", "output": "3\n253801 311446 582376 " }, { "input": "5\n460447 303948 286063 992238 738282", "output": "3\n286063 303948 992238 " }, { "input": "5\n301519 370449 319010 460799 983970", "output": "3\n301519 319010 983970 " }, { "input": "21\n999999 999998 999996 999992 999984 999968 999936 999872 999744 999488 998976 997952 995904 991808 983616 967232 934464 868928 737856 475712 999998", "output": "3\n999998 999998 999999 " } ]
1,594,092,071
2,147,483,647
PyPy 3
COMPILATION_ERROR
TESTS
0
0
0
#include <bits/stdc++.h> #include <ext/pb_ds/assoc_container.hpp> #include <ext/pb_ds/trie_policy.hpp> #include <ext/rope> #pragma 03 #pragma GCC optimize("Ofast") #pragma GCC optimization("unroll-loops, no-stack-protector") #pragma GCC target("sse,sse2,sse3,ssse3,sse4.1,sse4.2") #define ll long long #define ld long double #define fi first #define se second #define sz(x) x.size() #define mp make_pair #define pb push_back #define eb emplace_back #define all(x) begin(x), end(x) #define rall(x) rbegin(x), rend(x) #define rep(i, x, n) for (ll i = x; i < n; i++) #define fastio() ios_base::sync_with_stdio(NULL); cin.tie(0); cout.tie(0) //#define int long long using namespace std; using namespace __gnu_pbds; using namespace __gnu_cxx; mt19937 rng(chrono::steady_clock::now().time_since_epoch().count()); typedef vector<int> vi; typedef vector<vi> vvi; typedef pair<int, int> ii; typedef vector<pair<int, int> > vii; typedef vector<ll> vl; typedef vector<vl> vvl; typedef pair<ll, ll> pll; typedef vector<pll> vll; inline void EXECUTE_TIME() {cout << endl << setprecision(10) << fixed << "CPU Time: " << clock() / double(CLOCKS_PER_SEC) << " sec(s)\n";} template <class T> inline T RD(T &a) {T x; cin >> x; return a = x;} template <class T> inline T gcd(T a, T b) {if (b) return gcd(b, a % b); else return a;} template <class T> inline T lcm(T a, T b) {return a / gcd(a,b) * b;} template<typename T> using ordered_set=tree<T, null_type, less<T>, rb_tree_tag, tree_order_statistics_node_update>; typedef trie<string, null_type, trie_string_access_traits<>, pat_trie_tag, trie_prefix_search_node_update> pref_trie; const int N = 2e5 + 1; int a[N], p[N]; int n; inline int calc(int i, int l) {return (p[n] + p[i] - p[i - l] - p[n - l]) / (2 * l + 1) - a[i];} signed main() { // freopen("connect.in", "r", stdin); // freopen("connect.out", "w", stdout); fastio(); cin >> n; rep(i, 1, n + 1) cin >> a[i]; sort(a, a + n); p[0] = 0; rep(i, 1, n + 1) p[i] = p[i - 1] + a[i]; int maxCalc = -1, pos = 0, len = 0; for (int i = 1; i <= n; i++) { int l = 0, r = min(i - 1, min(i - 1, n - i)); while (l <= r - 3) { int l1 = (l * 2 + r) / 3, r1 = (l + 2 * r) / 3; if (calc(i, l1) > calc(i, r1)) r = r1; else l = l1; } for (int j = l; j <= r; j++) { if (maxCalc < calc(i, j)) { maxCalc = calc(i, j); len = j; pos = i; } } } cout << len * 2 + 1 << endl; for (int i = pos - len; i <= pos; i++) cout << a[i] << ' '; for (int i = n - len + 1; i <= n; i++) cout << a[i] << ' '; // EXECUTE_TIME(); }
Title: Simple Skewness Time Limit: None seconds Memory Limit: None megabytes Problem Description: Define the simple skewness of a collection of numbers to be the collection's mean minus its median. You are given a list of *n* (not necessarily distinct) integers. Find the non-empty subset (with repetition) with the maximum simple skewness. The mean of a collection is the average of its elements. The median of a collection is its middle element when all of its elements are sorted, or the average of its two middle elements if it has even size. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200 000) — the number of elements in the list. The second line contains *n* integers *x**i* (0<=≤<=*x**i*<=≤<=1<=000<=000) — the *i*th element of the list. Output Specification: In the first line, print a single integer *k* — the size of the subset. In the second line, print *k* integers — the elements of the subset in any order. If there are multiple optimal subsets, print any. Demo Input: ['4\n1 2 3 12\n', '4\n1 1 2 2\n', '2\n1 2\n'] Demo Output: ['3\n1 2 12 \n', '3\n1 1 2 \n', '2\n1 2\n'] Note: In the first case, the optimal subset is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/04cdbd07a0375de9c557422eca077386392a9349.png" style="max-width: 100.0%;max-height: 100.0%;"/>, which has mean 5, median 2, and simple skewness of 5 - 2 = 3. In the second case, the optimal subset is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/af49670de7c27def20edf0ec421d9bb17d904c94.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Note that repetition is allowed. In the last case, any subset has the same median and mean, so all have simple skewness of 0.
```python #include <bits/stdc++.h> #include <ext/pb_ds/assoc_container.hpp> #include <ext/pb_ds/trie_policy.hpp> #include <ext/rope> #pragma 03 #pragma GCC optimize("Ofast") #pragma GCC optimization("unroll-loops, no-stack-protector") #pragma GCC target("sse,sse2,sse3,ssse3,sse4.1,sse4.2") #define ll long long #define ld long double #define fi first #define se second #define sz(x) x.size() #define mp make_pair #define pb push_back #define eb emplace_back #define all(x) begin(x), end(x) #define rall(x) rbegin(x), rend(x) #define rep(i, x, n) for (ll i = x; i < n; i++) #define fastio() ios_base::sync_with_stdio(NULL); cin.tie(0); cout.tie(0) //#define int long long using namespace std; using namespace __gnu_pbds; using namespace __gnu_cxx; mt19937 rng(chrono::steady_clock::now().time_since_epoch().count()); typedef vector<int> vi; typedef vector<vi> vvi; typedef pair<int, int> ii; typedef vector<pair<int, int> > vii; typedef vector<ll> vl; typedef vector<vl> vvl; typedef pair<ll, ll> pll; typedef vector<pll> vll; inline void EXECUTE_TIME() {cout << endl << setprecision(10) << fixed << "CPU Time: " << clock() / double(CLOCKS_PER_SEC) << " sec(s)\n";} template <class T> inline T RD(T &a) {T x; cin >> x; return a = x;} template <class T> inline T gcd(T a, T b) {if (b) return gcd(b, a % b); else return a;} template <class T> inline T lcm(T a, T b) {return a / gcd(a,b) * b;} template<typename T> using ordered_set=tree<T, null_type, less<T>, rb_tree_tag, tree_order_statistics_node_update>; typedef trie<string, null_type, trie_string_access_traits<>, pat_trie_tag, trie_prefix_search_node_update> pref_trie; const int N = 2e5 + 1; int a[N], p[N]; int n; inline int calc(int i, int l) {return (p[n] + p[i] - p[i - l] - p[n - l]) / (2 * l + 1) - a[i];} signed main() { // freopen("connect.in", "r", stdin); // freopen("connect.out", "w", stdout); fastio(); cin >> n; rep(i, 1, n + 1) cin >> a[i]; sort(a, a + n); p[0] = 0; rep(i, 1, n + 1) p[i] = p[i - 1] + a[i]; int maxCalc = -1, pos = 0, len = 0; for (int i = 1; i <= n; i++) { int l = 0, r = min(i - 1, min(i - 1, n - i)); while (l <= r - 3) { int l1 = (l * 2 + r) / 3, r1 = (l + 2 * r) / 3; if (calc(i, l1) > calc(i, r1)) r = r1; else l = l1; } for (int j = l; j <= r; j++) { if (maxCalc < calc(i, j)) { maxCalc = calc(i, j); len = j; pos = i; } } } cout << len * 2 + 1 << endl; for (int i = pos - len; i <= pos; i++) cout << a[i] << ' '; for (int i = n - len + 1; i <= n; i++) cout << a[i] << ' '; // EXECUTE_TIME(); } ```
-1
277
A
Learning Languages
PROGRAMMING
1,400
[ "dfs and similar", "dsu" ]
null
null
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar. Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages. Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages. The numbers in the lines are separated by single spaces.
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
[ "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n", "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n", "2 2\n1 2\n0\n" ]
[ "0\n", "2\n", "1\n" ]
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4. In the third sample employee 2 must learn language 2.
500
[ { "input": "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5", "output": "0" }, { "input": "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1", "output": "2" }, { "input": "2 2\n1 2\n0", "output": "1" }, { "input": "2 2\n0\n0", "output": "2" }, { "input": "5 5\n1 3\n0\n0\n2 4 1\n0", "output": "4" }, { "input": "6 2\n0\n0\n2 1 2\n1 1\n1 1\n0", "output": "3" }, { "input": "7 3\n3 1 3 2\n3 2 1 3\n2 2 3\n1 1\n2 2 3\n3 3 2 1\n3 2 3 1", "output": "0" }, { "input": "8 4\n0\n0\n4 2 3 1 4\n4 2 1 4 3\n3 4 3 1\n1 2\n2 4 1\n2 4 2", "output": "2" }, { "input": "10 10\n5 7 5 2 8 1\n7 10 6 9 5 8 2 4\n2 2 7\n5 8 6 9 10 1\n2 9 5\n3 6 5 2\n6 5 8 7 9 10 4\n0\n1 1\n2 8 6", "output": "1" }, { "input": "11 42\n4 20 26 9 24\n14 34 7 28 32 12 15 26 4 10 38 21 20 8 11\n4 21 8 36 6\n11 32 1 39 11 21 10 25 17 26 15 4\n2 8 12\n2 21 31\n8 17 10 3 39 32 30 5 15\n20 24 20 38 17 4 7 21 19 32 28 31 22 30 37 10 5 33 2 13 9\n7 38 34 42 27 20 11 6\n3 40 3 39\n14 39 40 4 30 33 8 36 28 14 23 16 7 25 9", "output": "0" }, { "input": "100 100\n1 33\n0\n2 35 4\n2 40 78\n1 69\n0\n1 2\n0\n0\n2 81 34\n1 45\n0\n1 87\n1 50\n1 97\n0\n2 100 59\n0\n0\n0\n1 45\n0\n0\n0\n1 6\n1 54\n0\n0\n0\n4 79 96 52 84\n1 86\n0\n0\n0\n0\n0\n0\n0\n0\n3 90 2 80\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 2\n0\n1 64\n0\n1 78\n1 82\n0\n0\n0\n0\n0\n1 6\n0\n0\n2 47 57\n1 95\n0\n2 91 79\n0\n1 27\n0\n1 74\n0\n0\n1 14\n0\n0\n2 90 19\n0\n1 10\n0\n0\n0\n0\n0\n1 57\n0\n2 28 50\n0\n0\n0\n1 47\n0\n0\n1 14\n0\n1 84\n1 1\n0\n0", "output": "87" }, { "input": "2 2\n2 1 2\n2 1 2", "output": "0" }, { "input": "2 2\n2 1 2\n1 1", "output": "0" }, { "input": "2 2\n1 2\n1 1", "output": "1" }, { "input": "3 100\n0\n0\n0", "output": "3" }, { "input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "100" }, { "input": "3 3\n0\n0\n0", "output": "3" } ]
1,680,793,852
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
62
0
def find(child): if parent[child] == child: return child parent[child] = find(parent[child]) # path compression return parent[child] def union(childA, childB): rootA = find(childA) rootB = find(childB) if rootA == rootB: return if size[rootA] > size[rootB]: tmp = rootA rootA = rootB rootB = tmp size[rootB] += size[rootA] parent[rootA] = rootB global num_components num_components -= 1 def initial(lang): global num_components, size num_components += 1 if size[lang] == 0 and parent[lang] == lang else 0 size[lang] = 1 if size[lang] == 0 else size[lang] line = input().split(" ") n = int(line[0]) m = int(line[1]) parent = [0] * (n + 1) for i in range(n+1): parent[i] = i size = [0] * (n + 1) # used for ranking num_components = 0 for _ in range(n): line = input().split(" ") num_lang = int(line[0]) if num_lang == 0: num_components += 1 elif num_lang == 1: lang = int(line[1]) initial(lang) else: first_lang = int(line[1]) initial(first_lang) #print("num components before for loop", num_components) for i in range(2,len(line)): lang = int(line[i]) initial(lang) #print("num components before union", num_components) union(first_lang, lang) #print("num components after union", num_components) #print(" ", num_components, parent) print(num_components-1)
Title: Learning Languages Time Limit: None seconds Memory Limit: None megabytes Problem Description: The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar. Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating). Input Specification: The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages. Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages. The numbers in the lines are separated by single spaces. Output Specification: Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating). Demo Input: ['5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n', '8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n', '2 2\n1 2\n0\n'] Demo Output: ['0\n', '2\n', '1\n'] Note: In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4. In the third sample employee 2 must learn language 2.
```python def find(child): if parent[child] == child: return child parent[child] = find(parent[child]) # path compression return parent[child] def union(childA, childB): rootA = find(childA) rootB = find(childB) if rootA == rootB: return if size[rootA] > size[rootB]: tmp = rootA rootA = rootB rootB = tmp size[rootB] += size[rootA] parent[rootA] = rootB global num_components num_components -= 1 def initial(lang): global num_components, size num_components += 1 if size[lang] == 0 and parent[lang] == lang else 0 size[lang] = 1 if size[lang] == 0 else size[lang] line = input().split(" ") n = int(line[0]) m = int(line[1]) parent = [0] * (n + 1) for i in range(n+1): parent[i] = i size = [0] * (n + 1) # used for ranking num_components = 0 for _ in range(n): line = input().split(" ") num_lang = int(line[0]) if num_lang == 0: num_components += 1 elif num_lang == 1: lang = int(line[1]) initial(lang) else: first_lang = int(line[1]) initial(first_lang) #print("num components before for loop", num_components) for i in range(2,len(line)): lang = int(line[i]) initial(lang) #print("num components before union", num_components) union(first_lang, lang) #print("num components after union", num_components) #print(" ", num_components, parent) print(num_components-1) ```
0
472
A
Design Tutorial: Learn from Math
PROGRAMMING
800
[ "math", "number theory" ]
null
null
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that. For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem. You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output two composite integers *x* and *y* (1<=&lt;<=*x*,<=*y*<=&lt;<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
[ "12\n", "15\n", "23\n", "1000000\n" ]
[ "4 8\n", "6 9\n", "8 15\n", "500000 500000\n" ]
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well. In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
500
[ { "input": "12", "output": "4 8" }, { "input": "15", "output": "6 9" }, { "input": "23", "output": "8 15" }, { "input": "1000000", "output": "500000 500000" }, { "input": "63874", "output": "4 63870" }, { "input": "14568", "output": "4 14564" }, { "input": "192", "output": "4 188" }, { "input": "86", "output": "4 82" }, { "input": "46220", "output": "4 46216" }, { "input": "57114", "output": "4 57110" }, { "input": "869", "output": "4 865" }, { "input": "738457", "output": "4 738453" }, { "input": "58113", "output": "6 58107" }, { "input": "4864", "output": "4 4860" }, { "input": "15", "output": "6 9" }, { "input": "74752", "output": "4 74748" }, { "input": "6073", "output": "4 6069" }, { "input": "1289", "output": "4 1285" }, { "input": "20", "output": "4 16" }, { "input": "58134", "output": "4 58130" }, { "input": "57756", "output": "4 57752" }, { "input": "765", "output": "6 759" }, { "input": "59", "output": "4 55" }, { "input": "991666", "output": "4 991662" }, { "input": "70761", "output": "4 70757" }, { "input": "13", "output": "4 9" }, { "input": "999999", "output": "4 999995" }, { "input": "17", "output": "8 9" }, { "input": "21", "output": "6 15" }, { "input": "19", "output": "4 15" }, { "input": "100007", "output": "6 100001" }, { "input": "999987", "output": "6 999981" }, { "input": "22", "output": "4 18" } ]
1,693,300,681
3,481
Python 3
OK
TESTS
33
46
0
import math a = int(input("")) e = 0 b = 0 for i in range(4, a): c = 0 d = 0 for j in range(2, int(math.sqrt(i)+1)): if i % j == 0: c = 1 break for j in range(2, int(math.sqrt(a - i)+1)): if (a - i) % j == 0: d = 1 break if d == 1 and c == 1: e = i b = a - i break print(e, b)
Title: Design Tutorial: Learn from Math Time Limit: None seconds Memory Limit: None megabytes Problem Description: One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that. For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem. You are given an integer *n* no less than 12, express it as a sum of two composite numbers. Input Specification: The only line contains an integer *n* (12<=≤<=*n*<=≤<=106). Output Specification: Output two composite integers *x* and *y* (1<=&lt;<=*x*,<=*y*<=&lt;<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them. Demo Input: ['12\n', '15\n', '23\n', '1000000\n'] Demo Output: ['4 8\n', '6 9\n', '8 15\n', '500000 500000\n'] Note: In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well. In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
```python import math a = int(input("")) e = 0 b = 0 for i in range(4, a): c = 0 d = 0 for j in range(2, int(math.sqrt(i)+1)): if i % j == 0: c = 1 break for j in range(2, int(math.sqrt(a - i)+1)): if (a - i) % j == 0: d = 1 break if d == 1 and c == 1: e = i b = a - i break print(e, b) ```
3
1
C
Ancient Berland Circus
PROGRAMMING
2,100
[ "geometry", "math" ]
C. Ancient Berland Circus
2
64
Nowadays all circuses in Berland have a round arena with diameter 13 meters, but in the past things were different. In Ancient Berland arenas in circuses were shaped as a regular (equiangular) polygon, the size and the number of angles could vary from one circus to another. In each corner of the arena there was a special pillar, and the rope strung between the pillars marked the arena edges. Recently the scientists from Berland have discovered the remains of the ancient circus arena. They found only three pillars, the others were destroyed by the time. You are given the coordinates of these three pillars. Find out what is the smallest area that the arena could have.
The input file consists of three lines, each of them contains a pair of numbers –– coordinates of the pillar. Any coordinate doesn't exceed 1000 by absolute value, and is given with at most six digits after decimal point.
Output the smallest possible area of the ancient arena. This number should be accurate to at least 6 digits after the decimal point. It's guaranteed that the number of angles in the optimal polygon is not larger than 100.
[ "0.000000 0.000000\n1.000000 1.000000\n0.000000 1.000000\n" ]
[ "1.00000000\n" ]
0
[ { "input": "0.000000 0.000000\n1.000000 1.000000\n0.000000 1.000000", "output": "1.00000000" }, { "input": "71.756151 7.532275\n-48.634784 100.159986\n91.778633 158.107739", "output": "9991.27897663" }, { "input": "18.716839 40.852752\n66.147248 -4.083161\n111.083161 43.347248", "output": "4268.87997505" }, { "input": "-13.242302 -45.014124\n-33.825369 51.083964\n84.512928 -55.134407", "output": "16617.24002771" }, { "input": "115.715093 141.583620\n136.158119 -23.780834\n173.673212 64.802787", "output": "24043.74046813" }, { "input": "17.288379 68.223317\n48.776683 71.688379\n23.170559 106.572762", "output": "1505.27997374" }, { "input": "76.820252 66.709341\n61.392328 82.684207\n44.267775 -2.378694", "output": "6503.44762335" }, { "input": "-46.482632 -31.161247\n19.689679 -70.646972\n-17.902656 -58.455808", "output": "23949.55226823" }, { "input": "34.236058 108.163949\n28.639345 104.566515\n25.610069 86.002927", "output": "780.93431702" }, { "input": "25.428124 39.407248\n17.868098 39.785933\n11.028461 43.028890", "output": "1152.21351717" }, { "input": "36.856072 121.845502\n46.453956 109.898647\n-30.047767 77.590282", "output": "5339.35578947" }, { "input": "-18.643272 56.008305\n9.107608 -22.094058\n-6.456146 70.308320", "output": "9009.25177521" }, { "input": "88.653021 18.024220\n51.942488 -2.527850\n76.164701 24.553012", "output": "1452.52866331" }, { "input": "80.181999 -38.076894\n23.381778 122.535736\n47.118815 140.734014", "output": "28242.17663744" }, { "input": "1.514204 81.400629\n32.168797 100.161401\n7.778734 46.010993", "output": "3149.43107333" }, { "input": "84.409605 38.496141\n77.788313 39.553807\n75.248391 59.413884", "output": "438.85760782" }, { "input": "12.272903 101.825792\n-51.240438 -12.708472\n-29.729299 77.882032", "output": "24908.67540438" }, { "input": "35.661751 27.283571\n96.513550 51.518022\n97.605986 131.258287", "output": "13324.78113326" }, { "input": "-20.003518 -4.671086\n93.588632 6.362759\n-24.748109 24.792124", "output": "11191.04493104" }, { "input": "93.583067 132.858352\n63.834975 19.353720\n33.677824 102.529376", "output": "10866.49390021" }, { "input": "-7.347450 36.971423\n84.498728 89.423536\n75.469963 98.022482", "output": "8977.83404724" }, { "input": "51.679280 56.072393\n-35.819256 73.390532\n-10.661374 129.756454", "output": "7441.86549199" }, { "input": "97.326813 61.492460\n100.982131 57.717635\n68.385216 22.538372", "output": "1840.59945324" }, { "input": "-16.356805 109.310423\n124.529388 25.066276\n-37.892043 80.604904", "output": "22719.36404168" }, { "input": "103.967164 63.475916\n86.466163 59.341930\n69.260229 73.258917", "output": "1621.96700296" }, { "input": "122.381894 -48.763263\n163.634346 -22.427845\n26.099674 73.681862", "output": "22182.51901824" }, { "input": "119.209229 133.905087\n132.001535 22.179509\n96.096673 0.539763", "output": "16459.52899209" }, { "input": "77.145533 85.041789\n67.452820 52.513188\n80.503843 85.000149", "output": "1034.70898496" }, { "input": "28.718442 36.116251\n36.734593 35.617015\n76.193973 99.136077", "output": "6271.48941610" }, { "input": "0.376916 17.054676\n100.187614 85.602831\n1.425829 132.750915", "output": "13947.47744984" }, { "input": "46.172435 -22.819705\n17.485134 -1.663888\n101.027565 111.619705", "output": "16483.23337238" }, { "input": "55.957968 -72.765994\n39.787413 -75.942282\n24.837014 128.144762", "output": "32799.66697178" }, { "input": "40.562163 -47.610606\n10.073051 -54.490068\n54.625875 -40.685797", "output": "31224.34817875" }, { "input": "20.965151 74.716562\n167.264364 81.864800\n5.931644 48.813212", "output": "30115.26346791" }, { "input": "105.530943 80.920069\n40.206723 125.323331\n40.502256 -85.455877", "output": "36574.64621711" }, { "input": "104.636703 49.583778\n85.940583 95.426299\n69.375168 93.234795", "output": "2632.68754075" }, { "input": "72.873708 -59.083734\n110.911118 -6.206576\n-44.292395 13.106202", "output": "19244.42781859" }, { "input": "49.320630 48.119616\n65.888396 93.514980\n27.342377 97.600590", "output": "2437.50897386" }, { "input": "6.949504 69.606390\n26.139268 72.136945\n24.032442 57.407195", "output": "372.09309018" }, { "input": "-21.925928 -24.623076\n-33.673619 -11.677794\n4.692348 52.266292", "output": "5669.99444283" }, { "input": "109.515505 37.575315\n5.377080 101.729711\n17.501630 103.324931", "output": "25142.85604936" }, { "input": "-56.880888 172.997993\n81.126977 42.144034\n-51.413417 17.057807", "output": "29051.57171313" }, { "input": "80.895061 94.491414\n42.361631 65.191687\n77.556800 76.694829", "output": "2386.01792476" }, { "input": "165.094169 94.574129\n46.867578 147.178855\n174.685774 62.705213", "output": "32087.47120554" }, { "input": "146.604506 -3.502359\n24.935572 44.589981\n106.160918 -51.162271", "output": "13799.61044048" }, { "input": "139.847022 19.153937\n104.096879 75.379874\n49.164271 46.404632", "output": "7083.26303902" }, { "input": "31.312532 151.532355\n182.646053 56.534075\n15.953947 127.065925", "output": "25712.80766033" }, { "input": "42.147045 64.165917\n70.260284 4.962470\n10.532991 76.277713", "output": "14261.92257159" }, { "input": "129.400249 -44.695226\n122.278798 -53.696996\n44.828427 -83.507917", "output": "26227.47891833" }, { "input": "28.420253 0.619862\n10.966628 21.724132\n14.618862 10.754642", "output": "1760.14006648" } ]
1,673,653,052
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
248
13,824,000
import math from fractions import Fraction as Fr from functools import reduce # xy = [[float(c) for c in input().split()] for _ in "foo"] # print(xy) xy = [[0.0, 0.0], [1.0, 1.0], [0.0, 1.0]] def circumcenter(p1, p2, p3): x1, y1 = p1 x2, y2 = p2 x3, y3 = p3 d = 2 * (x1 * (y2 - y3) + x2 * (y3 - y1) + x3 * (y1 - y2)) ux = ((x1**2 + y1**2) * (y2 - y3) + (x2**2 + y2**2) * (y3 - y1) + (x3**2 + y3**2) * (y1 - y2)) / d uy = ((x1**2 + y1**2) * (x3 - x2) + (x2**2 + y2**2) * (x1 - x3) + (x3**2 + y3**2) * (x2 - x1)) / d return ux, uy def dist(p1, p2): return math.sqrt((p1[0]-p2[0])**2 + (p1[1]-p2[1])**2) def angle_from_points(p1, p2, p3): a = dist(p2, p3) b = dist(p1, p3) c = dist(p1, p2) angle = math.acos((a**2 + b**2 - c**2) / (2*a*b)) return math.degrees(angle) def denom(x: float, max_denominator=1000): return Fr(x).limit_denominator(max_denominator).denominator def lcm(*args): return reduce(lambda a, b: a*b // math.gcd(a, b), args) def regular_polygon_area(n, r): return (n * (r ** 2)) * math.sin(2 * math.pi / n) / 2 def go(xy=xy): center_xy = circumcenter(*xy) a1 = angle_from_points(xy[0], xy[1], center_xy) a2 = angle_from_points(xy[1], xy[2], center_xy) a3 = angle_from_points(xy[2], xy[0], center_xy) n = lcm(denom(a1 / 360.0), denom(a2 / 360.0), denom(a3 / 360.0)) return regular_polygon_area(n, dist(center_xy, xy[0]))
Title: Ancient Berland Circus Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Nowadays all circuses in Berland have a round arena with diameter 13 meters, but in the past things were different. In Ancient Berland arenas in circuses were shaped as a regular (equiangular) polygon, the size and the number of angles could vary from one circus to another. In each corner of the arena there was a special pillar, and the rope strung between the pillars marked the arena edges. Recently the scientists from Berland have discovered the remains of the ancient circus arena. They found only three pillars, the others were destroyed by the time. You are given the coordinates of these three pillars. Find out what is the smallest area that the arena could have. Input Specification: The input file consists of three lines, each of them contains a pair of numbers –– coordinates of the pillar. Any coordinate doesn't exceed 1000 by absolute value, and is given with at most six digits after decimal point. Output Specification: Output the smallest possible area of the ancient arena. This number should be accurate to at least 6 digits after the decimal point. It's guaranteed that the number of angles in the optimal polygon is not larger than 100. Demo Input: ['0.000000 0.000000\n1.000000 1.000000\n0.000000 1.000000\n'] Demo Output: ['1.00000000\n']
```python import math from fractions import Fraction as Fr from functools import reduce # xy = [[float(c) for c in input().split()] for _ in "foo"] # print(xy) xy = [[0.0, 0.0], [1.0, 1.0], [0.0, 1.0]] def circumcenter(p1, p2, p3): x1, y1 = p1 x2, y2 = p2 x3, y3 = p3 d = 2 * (x1 * (y2 - y3) + x2 * (y3 - y1) + x3 * (y1 - y2)) ux = ((x1**2 + y1**2) * (y2 - y3) + (x2**2 + y2**2) * (y3 - y1) + (x3**2 + y3**2) * (y1 - y2)) / d uy = ((x1**2 + y1**2) * (x3 - x2) + (x2**2 + y2**2) * (x1 - x3) + (x3**2 + y3**2) * (x2 - x1)) / d return ux, uy def dist(p1, p2): return math.sqrt((p1[0]-p2[0])**2 + (p1[1]-p2[1])**2) def angle_from_points(p1, p2, p3): a = dist(p2, p3) b = dist(p1, p3) c = dist(p1, p2) angle = math.acos((a**2 + b**2 - c**2) / (2*a*b)) return math.degrees(angle) def denom(x: float, max_denominator=1000): return Fr(x).limit_denominator(max_denominator).denominator def lcm(*args): return reduce(lambda a, b: a*b // math.gcd(a, b), args) def regular_polygon_area(n, r): return (n * (r ** 2)) * math.sin(2 * math.pi / n) / 2 def go(xy=xy): center_xy = circumcenter(*xy) a1 = angle_from_points(xy[0], xy[1], center_xy) a2 = angle_from_points(xy[1], xy[2], center_xy) a3 = angle_from_points(xy[2], xy[0], center_xy) n = lcm(denom(a1 / 360.0), denom(a2 / 360.0), denom(a3 / 360.0)) return regular_polygon_area(n, dist(center_xy, xy[0])) ```
0
415
A
Mashmokh and Lights
PROGRAMMING
900
[ "implementation" ]
null
null
Mashmokh works in a factory. At the end of each day he must turn off all of the lights. The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off. Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*. Please, help Mashmokh, print these indices.
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*). It is guaranteed that all lights will be turned off after pushing all buttons.
Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off.
[ "5 4\n4 3 1 2\n", "5 5\n5 4 3 2 1\n" ]
[ "1 1 3 4 4 \n", "1 2 3 4 5 \n" ]
In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
500
[ { "input": "5 4\n4 3 1 2", "output": "1 1 3 4 4 " }, { "input": "5 5\n5 4 3 2 1", "output": "1 2 3 4 5 " }, { "input": "16 11\n8 5 12 10 14 2 6 3 15 9 1", "output": "1 2 2 2 5 5 5 8 8 8 8 8 8 8 8 8 " }, { "input": "79 22\n76 32 48 28 33 44 58 59 1 51 77 13 15 64 49 72 74 21 61 12 60 57", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 28 28 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 76 76 76 76 " }, { "input": "25 19\n3 12 21 11 19 6 5 15 4 16 20 8 9 1 22 23 25 18 13", "output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "48 8\n42 27 40 1 18 3 19 2", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 42 42 42 42 42 42 42 " }, { "input": "44 19\n13 20 7 10 9 14 43 17 18 39 21 42 37 1 33 8 35 4 6", "output": "1 1 1 1 1 1 7 7 7 7 7 7 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 " }, { "input": "80 29\n79 51 28 73 65 39 10 1 59 29 7 70 64 3 35 17 24 71 74 2 6 49 66 80 13 18 60 15 12", "output": "1 1 1 1 1 1 1 1 1 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 79 79 " }, { "input": "31 4\n8 18 30 1", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 " }, { "input": "62 29\n61 55 35 13 51 56 23 6 8 26 27 40 48 11 18 12 19 50 54 14 24 21 32 17 43 33 1 2 3", "output": "1 1 1 1 1 6 6 6 6 6 6 6 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 55 55 55 55 55 55 61 61 " }, { "input": "5 4\n2 3 4 1", "output": "1 2 2 2 2 " }, { "input": "39 37\n2 5 17 24 19 33 35 16 20 3 1 34 10 36 15 37 14 8 28 21 13 31 30 29 7 25 32 12 6 27 22 4 11 39 18 9 26", "output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100 100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "1 1\n1", "output": "1 " }, { "input": "18 3\n18 1 11", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 18 " }, { "input": "67 20\n66 23 40 49 3 39 60 43 52 47 16 36 22 5 41 10 55 34 64 1", "output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 66 66 " }, { "input": "92 52\n9 85 44 13 27 61 8 1 28 41 6 14 70 67 39 71 56 80 34 21 5 10 40 73 63 38 90 57 37 36 82 86 65 46 7 54 81 12 45 49 83 59 64 26 62 25 60 24 91 47 53 55", "output": "1 1 1 1 1 1 1 8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 " }, { "input": "66 36\n44 62 32 29 3 15 47 30 50 42 35 2 33 65 10 13 56 12 1 16 7 36 39 11 25 28 20 52 46 38 37 8 61 49 48 14", "output": "1 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 29 29 29 32 32 32 32 32 32 32 32 32 32 32 32 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 " }, { "input": "32 8\n27 23 1 13 18 24 17 26", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 23 23 23 23 27 27 27 27 27 27 " }, { "input": "26 13\n1 14 13 2 4 24 21 22 16 3 10 12 6", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "31 20\n10 11 20 2 4 26 31 7 13 12 28 1 30 18 21 8 3 16 15 19", "output": "1 2 2 2 2 2 2 2 2 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "86 25\n22 62 8 23 53 77 9 31 43 1 58 16 72 11 15 35 60 39 79 4 82 64 76 63 59", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 " }, { "input": "62 54\n2 5 4 47 40 61 37 31 41 16 44 42 48 32 10 6 62 38 52 49 11 20 55 22 3 36 25 21 50 8 28 14 18 39 34 54 53 19 46 27 15 23 12 24 60 17 33 57 58 1 35 29 51 7", "output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "57 19\n43 45 37 40 42 55 16 33 47 32 34 35 9 41 1 6 8 15 5", "output": "1 1 1 1 1 1 1 1 9 9 9 9 9 9 9 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 37 37 37 37 37 37 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 " }, { "input": "32 14\n4 7 13 1 25 22 9 27 6 28 30 2 14 21", "output": "1 1 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 " }, { "input": "57 12\n8 53 51 38 1 6 16 33 13 46 28 35", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 " }, { "input": "87 9\n57 34 78 1 52 67 56 6 54", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 " }, { "input": "88 42\n85 45 52 14 63 53 70 71 16 86 66 47 12 22 10 72 4 31 3 69 11 77 17 25 46 75 23 1 21 84 44 20 18 33 48 88 41 83 67 61 73 34", "output": "1 1 3 4 4 4 4 4 4 10 10 12 12 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 85 85 85 85 " }, { "input": "27 25\n9 21 17 5 16 3 23 7 12 4 14 11 13 1 15 19 27 8 20 10 22 25 6 18 26", "output": "1 1 3 3 5 5 5 5 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 " }, { "input": "89 28\n5 22 79 42 16 35 66 48 57 55 1 37 29 31 40 38 45 62 41 87 64 89 81 13 60 44 71 82", "output": "1 1 1 1 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 " }, { "input": "17 4\n4 3 1 2", "output": "1 1 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 " } ]
1,552,498,997
2,147,483,647
Python 3
OK
TESTS
31
109
0
n, m = input().split() n = int(n) m = int(m) a = input().split() a = [int(item) for item in a] ans = [0]*n for i in range(m): for j in range(a[i]-1,n): if ans[j]==0: ans[j] = a[i] for i in range(n): print(ans[i],end = ' ')
Title: Mashmokh and Lights Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mashmokh works in a factory. At the end of each day he must turn off all of the lights. The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off. Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*. Please, help Mashmokh, print these indices. Input Specification: The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*). It is guaranteed that all lights will be turned off after pushing all buttons. Output Specification: Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off. Demo Input: ['5 4\n4 3 1 2\n', '5 5\n5 4 3 2 1\n'] Demo Output: ['1 1 3 4 4 \n', '1 2 3 4 5 \n'] Note: In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
```python n, m = input().split() n = int(n) m = int(m) a = input().split() a = [int(item) for item in a] ans = [0]*n for i in range(m): for j in range(a[i]-1,n): if ans[j]==0: ans[j] = a[i] for i in range(n): print(ans[i],end = ' ') ```
3
807
A
Is it rated?
PROGRAMMING
900
[ "implementation", "sortings" ]
null
null
Is it rated? Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it. Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known. It's known that if at least one participant's rating has changed, then the round was rated for sure. It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed. In this problem, you should not make any other assumptions about the rating system. Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants. Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
[ "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n", "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n", "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n" ]
[ "rated\n", "unrated\n", "maybe\n" ]
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated. In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure. In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
500
[ { "input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884", "output": "rated" }, { "input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400", "output": "unrated" }, { "input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699", "output": "maybe" }, { "input": "2\n1 1\n1 1", "output": "maybe" }, { "input": "2\n4126 4126\n4126 4126", "output": "maybe" }, { "input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423", "output": "rated" }, { "input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110", "output": "unrated" }, { "input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143", "output": "maybe" }, { "input": "2\n3936 3936\n2967 2967", "output": "maybe" }, { "input": "2\n1 1\n2 2", "output": "unrated" }, { "input": "2\n2 2\n1 1", "output": "maybe" }, { "input": "2\n2 1\n1 2", "output": "rated" }, { "input": "2\n2967 2967\n3936 3936", "output": "unrated" }, { "input": "3\n1200 1200\n1200 1200\n1300 1300", "output": "unrated" }, { "input": "3\n3 3\n2 2\n1 1", "output": "maybe" }, { "input": "3\n1 1\n1 1\n2 2", "output": "unrated" }, { "input": "2\n3 2\n3 2", "output": "rated" }, { "input": "3\n5 5\n4 4\n3 4", "output": "rated" }, { "input": "3\n200 200\n200 200\n300 300", "output": "unrated" }, { "input": "3\n1 1\n2 2\n3 3", "output": "unrated" }, { "input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699", "output": "maybe" }, { "input": "2\n10 10\n8 8", "output": "maybe" }, { "input": "3\n1500 1500\n1500 1500\n1600 1600", "output": "unrated" }, { "input": "3\n1500 1500\n1500 1500\n1700 1700", "output": "unrated" }, { "input": "4\n100 100\n100 100\n70 70\n80 80", "output": "unrated" }, { "input": "2\n1 2\n2 1", "output": "rated" }, { "input": "3\n5 5\n4 3\n3 3", "output": "rated" }, { "input": "3\n1600 1650\n1500 1550\n1400 1450", "output": "rated" }, { "input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700", "output": "unrated" }, { "input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700", "output": "unrated" }, { "input": "2\n1600 1600\n1400 1400", "output": "maybe" }, { "input": "2\n3 1\n9 8", "output": "rated" }, { "input": "2\n2 1\n1 1", "output": "rated" }, { "input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670", "output": "unrated" }, { "input": "2\n2 2\n3 3", "output": "unrated" }, { "input": "2\n10 11\n5 4", "output": "rated" }, { "input": "2\n15 14\n13 12", "output": "rated" }, { "input": "2\n2 1\n2 2", "output": "rated" }, { "input": "3\n2670 2670\n3670 3670\n4106 4106", "output": "unrated" }, { "input": "3\n4 5\n3 3\n2 2", "output": "rated" }, { "input": "2\n10 9\n10 10", "output": "rated" }, { "input": "3\n1011 1011\n1011 999\n2200 2100", "output": "rated" }, { "input": "2\n3 3\n5 5", "output": "unrated" }, { "input": "2\n1500 1500\n3000 2000", "output": "rated" }, { "input": "2\n5 6\n5 5", "output": "rated" }, { "input": "3\n2000 2000\n1500 1501\n500 500", "output": "rated" }, { "input": "2\n2 3\n2 2", "output": "rated" }, { "input": "2\n3 3\n2 2", "output": "maybe" }, { "input": "2\n1 2\n1 1", "output": "rated" }, { "input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699", "output": "maybe" }, { "input": "2\n15 14\n14 13", "output": "rated" }, { "input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900", "output": "unrated" }, { "input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884", "output": "rated" }, { "input": "2\n100 99\n100 100", "output": "rated" }, { "input": "4\n2 2\n1 1\n1 1\n2 2", "output": "unrated" }, { "input": "3\n100 101\n100 100\n100 100", "output": "rated" }, { "input": "4\n1000 1001\n900 900\n950 950\n890 890", "output": "rated" }, { "input": "2\n2 3\n1 1", "output": "rated" }, { "input": "2\n2 2\n1 1", "output": "maybe" }, { "input": "2\n3 2\n2 2", "output": "rated" }, { "input": "2\n3 2\n3 3", "output": "rated" }, { "input": "2\n1 1\n2 2", "output": "unrated" }, { "input": "3\n3 2\n3 3\n3 3", "output": "rated" }, { "input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400", "output": "rated" }, { "input": "3\n1000 1000\n500 500\n400 300", "output": "rated" }, { "input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000", "output": "unrated" }, { "input": "2\n1 1\n2 3", "output": "rated" }, { "input": "2\n6 2\n6 2", "output": "rated" }, { "input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246", "output": "unrated" }, { "input": "2\n1500 1500\n1600 1600", "output": "unrated" }, { "input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699", "output": "maybe" }, { "input": "2\n20 30\n10 5", "output": "rated" }, { "input": "3\n1 1\n2 2\n1 1", "output": "unrated" }, { "input": "2\n1 2\n3 3", "output": "rated" }, { "input": "5\n5 5\n4 4\n3 3\n2 2\n1 1", "output": "maybe" }, { "input": "2\n2 2\n2 1", "output": "rated" }, { "input": "2\n100 100\n90 89", "output": "rated" }, { "input": "2\n1000 900\n2000 2000", "output": "rated" }, { "input": "2\n50 10\n10 50", "output": "rated" }, { "input": "2\n200 200\n100 100", "output": "maybe" }, { "input": "3\n2 2\n2 2\n3 3", "output": "unrated" }, { "input": "3\n1000 1000\n300 300\n100 100", "output": "maybe" }, { "input": "4\n2 2\n2 2\n3 3\n4 4", "output": "unrated" }, { "input": "2\n5 3\n6 3", "output": "rated" }, { "input": "2\n1200 1100\n1200 1000", "output": "rated" }, { "input": "2\n5 5\n4 4", "output": "maybe" }, { "input": "2\n5 5\n3 3", "output": "maybe" }, { "input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100", "output": "unrated" }, { "input": "5\n10 10\n9 9\n8 8\n7 7\n6 6", "output": "maybe" }, { "input": "3\n1000 1000\n300 300\n10 10", "output": "maybe" }, { "input": "5\n6 6\n5 5\n4 4\n3 3\n2 2", "output": "maybe" }, { "input": "2\n3 3\n1 1", "output": "maybe" }, { "input": "4\n2 2\n2 2\n2 2\n3 3", "output": "unrated" }, { "input": "2\n1000 1000\n700 700", "output": "maybe" }, { "input": "2\n4 3\n5 3", "output": "rated" }, { "input": "2\n1000 1000\n1100 1100", "output": "unrated" }, { "input": "4\n5 5\n4 4\n3 3\n2 2", "output": "maybe" }, { "input": "3\n1 1\n2 3\n2 2", "output": "rated" }, { "input": "2\n1 2\n1 3", "output": "rated" }, { "input": "2\n3 3\n1 2", "output": "rated" }, { "input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400", "output": "rated" }, { "input": "5\n1 1\n2 2\n3 3\n4 4\n5 5", "output": "unrated" }, { "input": "2\n10 10\n1 2", "output": "rated" }, { "input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900", "output": "unrated" }, { "input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699", "output": "unrated" }, { "input": "2\n100 100\n110 110", "output": "unrated" }, { "input": "3\n3 3\n3 3\n4 4", "output": "unrated" }, { "input": "3\n3 3\n3 2\n4 4", "output": "rated" }, { "input": "3\n5 2\n4 4\n3 3", "output": "rated" }, { "input": "4\n4 4\n3 3\n2 2\n1 1", "output": "maybe" }, { "input": "2\n1 1\n3 2", "output": "rated" }, { "input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699", "output": "unrated" }, { "input": "3\n3 3\n3 3\n3 4", "output": "rated" }, { "input": "3\n1 2\n2 2\n3 3", "output": "rated" }, { "input": "3\n1 2\n1 2\n1 2", "output": "rated" }, { "input": "2\n2 1\n2 1", "output": "rated" }, { "input": "2\n1 2\n3 4", "output": "rated" }, { "input": "2\n3 2\n2 3", "output": "rated" }, { "input": "3\n1500 1500\n1600 1600\n1600 1600", "output": "unrated" }, { "input": "3\n1 1\n3 3\n4 4", "output": "unrated" }, { "input": "3\n1 1\n2 2\n2 2", "output": "unrated" }, { "input": "2\n10 12\n8 8", "output": "rated" }, { "input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500", "output": "unrated" }, { "input": "2\n1 2\n2 2", "output": "rated" }, { "input": "3\n1500 1400\n1200 1200\n1100 1100", "output": "rated" }, { "input": "2\n10 12\n10 10", "output": "rated" }, { "input": "3\n1500 1500\n1400 1400\n1300 1300", "output": "maybe" }, { "input": "3\n3 3\n4 4\n5 5", "output": "unrated" }, { "input": "3\n2 6\n3 5\n4 4", "output": "rated" }, { "input": "2\n5 6\n4 6", "output": "rated" }, { "input": "4\n10 10\n10 10\n7 7\n8 8", "output": "unrated" }, { "input": "2\n4 4\n3 3", "output": "maybe" } ]
1,609,946,997
2,147,483,647
Python 3
OK
TESTS
150
109
307,200
n = int(input()) l = [] for _ in range(n): a,b = [int(x) for x in input().split()] l.append((a,b)) for a,b in l: if a!=b: print('rated') break else: mini = l[0][0] for i in range(1,n): if l[i][0]>mini: print('unrated') break mini = min(mini, l[i][0]) else: print('maybe')
Title: Is it rated? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Is it rated? Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it. Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known. It's known that if at least one participant's rating has changed, then the round was rated for sure. It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed. In this problem, you should not make any other assumptions about the rating system. Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not. Input Specification: The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants. Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings. Output Specification: If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe". Demo Input: ['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n'] Demo Output: ['rated\n', 'unrated\n', 'maybe\n'] Note: In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated. In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure. In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
```python n = int(input()) l = [] for _ in range(n): a,b = [int(x) for x in input().split()] l.append((a,b)) for a,b in l: if a!=b: print('rated') break else: mini = l[0][0] for i in range(1,n): if l[i][0]>mini: print('unrated') break mini = min(mini, l[i][0]) else: print('maybe') ```
3
5
C
Longest Regular Bracket Sequence
PROGRAMMING
1,900
[ "constructive algorithms", "data structures", "dp", "greedy", "sortings", "strings" ]
C. Longest Regular Bracket Sequence
2
256
This is yet another problem dealing with regular bracket sequences. We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not. You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well.
The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106.
Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1".
[ ")((())))(()())\n", "))(\n" ]
[ "6 2\n", "0 1\n" ]
none
0
[ { "input": ")((())))(()())", "output": "6 2" }, { "input": "))(", "output": "0 1" }, { "input": "()(())()", "output": "8 1" }, { "input": "((((()(((", "output": "2 1" }, { "input": "))))()())))", "output": "4 1" }, { "input": "(()())()(())()()())())()((()(()(())()()())((()(())()(()()()()))()(())()(((()())()(()((())()(())(()))", "output": "28 1" }, { "input": ")(()(((((())))))(((()))))))((()(((((((())())()))))((((((((())))((((((())))))(()((((()))))(()))))))))", "output": "68 1" }, { "input": "())(((((())())((((()))(())))())())(((()(()()()())(())()))((()(())())()()))()(()())))))(()))((())((((", "output": "80 1" }, { "input": "))(((((((()((((())(((((((((()()))))(()())()((())())))((((()))(()()()))))(()()))())))))((())())()))((", "output": "92 1" } ]
1,506,637,401
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
1
62
0
inp,kol,max_len,pos,temp=input(),0,0,[-1],0; for i in range(len(inp)): if(inp[i]=='('): pos.append(i); elif(len(pos)>1): pos.pop(); x=i-pos[-1]; if(max_len<x): max_len,poi=x,1; elif(max_len==x): poi+=1; else: pos[0]=i; print(max_len,poi); #the problem requires you to find the longest real bracket sequence and the number ofsuch other sequences that might exist WITH THE SAME MAXIMUM LENGHT.the lenght of the no of brackes bn any two points is the difference bn the last index and the one before the 1st index.
Title: Longest Regular Bracket Sequence Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: This is yet another problem dealing with regular bracket sequences. We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not. You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well. Input Specification: The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106. Output Specification: Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1". Demo Input: [')((())))(()())\n', '))(\n'] Demo Output: ['6 2\n', '0 1\n'] Note: none
```python inp,kol,max_len,pos,temp=input(),0,0,[-1],0; for i in range(len(inp)): if(inp[i]=='('): pos.append(i); elif(len(pos)>1): pos.pop(); x=i-pos[-1]; if(max_len<x): max_len,poi=x,1; elif(max_len==x): poi+=1; else: pos[0]=i; print(max_len,poi); #the problem requires you to find the longest real bracket sequence and the number ofsuch other sequences that might exist WITH THE SAME MAXIMUM LENGHT.the lenght of the no of brackes bn any two points is the difference bn the last index and the one before the 1st index. ```
-1
588
A
Duff and Meat
PROGRAMMING
900
[ "greedy" ]
null
null
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat. There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future. Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days. In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day.
Print the minimum money needed to keep Duff happy for *n* days, in one line.
[ "3\n1 3\n2 2\n3 1\n", "3\n1 3\n2 1\n3 2\n" ]
[ "10\n", "8\n" ]
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day. In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
750
[ { "input": "3\n1 3\n2 2\n3 1", "output": "10" }, { "input": "3\n1 3\n2 1\n3 2", "output": "8" }, { "input": "1\n39 52", "output": "2028" }, { "input": "2\n25 56\n94 17", "output": "2998" }, { "input": "5\n39 21\n95 89\n73 90\n9 55\n85 32", "output": "6321" }, { "input": "12\n70 11\n74 27\n32 11\n26 83\n57 18\n97 28\n75 43\n75 21\n84 29\n16 2\n89 63\n21 88", "output": "6742" }, { "input": "2\n100 68\n38 80", "output": "9384" } ]
1,604,817,555
2,147,483,647
Python 3
OK
TESTS
30
280
0
from sys import stdin n = int(stdin.readline()) res = 0 price = float('inf') for _ in range(n): x, y = list(map(int, stdin.readline().split())) if y < price: price = y res += price * x print(res)
Title: Duff and Meat Time Limit: None seconds Memory Limit: None megabytes Problem Description: Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat. There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future. Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days. Input Specification: The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days. In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day. Output Specification: Print the minimum money needed to keep Duff happy for *n* days, in one line. Demo Input: ['3\n1 3\n2 2\n3 1\n', '3\n1 3\n2 1\n3 2\n'] Demo Output: ['10\n', '8\n'] Note: In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day. In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
```python from sys import stdin n = int(stdin.readline()) res = 0 price = float('inf') for _ in range(n): x, y = list(map(int, stdin.readline().split())) if y < price: price = y res += price * x print(res) ```
3
451
B
Sort the Array
PROGRAMMING
1,300
[ "implementation", "sortings" ]
null
null
Being a programmer, you like arrays a lot. For your birthday, your friends have given you an array *a* consisting of *n* distinct integers. Unfortunately, the size of *a* is too small. You want a bigger array! Your friends agree to give you a bigger array, but only if you are able to answer the following question correctly: is it possible to sort the array *a* (in increasing order) by reversing exactly one segment of *a*? See definitions of segment and reversing in the notes.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the size of array *a*. The second line contains *n* distinct space-separated integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109).
Print "yes" or "no" (without quotes), depending on the answer. If your answer is "yes", then also print two space-separated integers denoting start and end (start must not be greater than end) indices of the segment to be reversed. If there are multiple ways of selecting these indices, print any of them.
[ "3\n3 2 1\n", "4\n2 1 3 4\n", "4\n3 1 2 4\n", "2\n1 2\n" ]
[ "yes\n1 3\n", "yes\n1 2\n", "no\n", "yes\n1 1\n" ]
Sample 1. You can reverse the entire array to get [1, 2, 3], which is sorted. Sample 3. No segment can be reversed such that the array will be sorted. Definitions A segment [*l*, *r*] of array *a* is the sequence *a*[*l*], *a*[*l* + 1], ..., *a*[*r*]. If you have an array *a* of size *n* and you reverse its segment [*l*, *r*], the array will become: *a*[1], *a*[2], ..., *a*[*l* - 2], *a*[*l* - 1], *a*[*r*], *a*[*r* - 1], ..., *a*[*l* + 1], *a*[*l*], *a*[*r* + 1], *a*[*r* + 2], ..., *a*[*n* - 1], *a*[*n*].
1,000
[ { "input": "3\n3 2 1", "output": "yes\n1 3" }, { "input": "4\n2 1 3 4", "output": "yes\n1 2" }, { "input": "4\n3 1 2 4", "output": "no" }, { "input": "2\n1 2", "output": "yes\n1 1" }, { "input": "2\n58 4", "output": "yes\n1 2" }, { "input": "5\n69 37 27 4 2", "output": "yes\n1 5" }, { "input": "9\n6 78 63 59 28 24 8 96 99", "output": "yes\n2 7" }, { "input": "6\n19517752 43452931 112792556 68417469 779722934 921694415", "output": "yes\n3 4" }, { "input": "6\n169793171 335736854 449917902 513287332 811627074 938727967", "output": "yes\n1 1" }, { "input": "6\n509329 173849943 297546987 591032670 796346199 914588283", "output": "yes\n1 1" }, { "input": "25\n46 45 37 35 26 25 21 19 11 3 1 51 54 55 57 58 59 62 66 67 76 85 88 96 100", "output": "yes\n1 11" }, { "input": "46\n10 12 17 19 20 21 22 24 25 26 27 28 29 30 32 37 42 43 47 48 50 51 52 56 87 86 81 79 74 71 69 67 66 65 60 59 57 89 91 92 94 96 97 98 99 100", "output": "yes\n25 37" }, { "input": "96\n1 2 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 68 69 70 71 72 73 74 75 76 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "yes\n3 22" }, { "input": "2\n404928771 698395106", "output": "yes\n1 1" }, { "input": "2\n699573624 308238132", "output": "yes\n1 2" }, { "input": "5\n75531609 242194958 437796493 433259361 942142185", "output": "yes\n3 4" }, { "input": "5\n226959376 840957605 833410429 273566427 872976052", "output": "yes\n2 4" }, { "input": "5\n373362086 994096202 767275079 734424844 515504383", "output": "yes\n2 5" }, { "input": "5\n866379155 593548704 259097686 216134784 879911740", "output": "yes\n1 4" }, { "input": "5\n738083041 719956102 420866851 307749161 257917459", "output": "yes\n1 5" }, { "input": "5\n90786760 107075352 139104198 424911569 858427981", "output": "yes\n1 1" }, { "input": "6\n41533825 525419745 636375901 636653266 879043107 967434399", "output": "yes\n1 1" }, { "input": "40\n22993199 75843013 76710455 99749069 105296587 122559115 125881005 153961749 163646706 175409222 185819807 214465092 264449243 278246513 295514446 322935239 370349154 375773209 390474983 775646826 767329655 740310077 718820037 708508595 693119912 680958422 669537382 629123011 607511013 546574974 546572137 511951383 506996390 493995578 458256840 815612821 881161983 901337648 962275390 986568907", "output": "yes\n20 35" }, { "input": "40\n3284161 23121669 24630274 33434127 178753820 231503277 271972002 272578266 346450638 355655265 372217434 376132047 386622863 387235708 389799554 427160037 466577363 491873718 492746058 502535866 535768673 551570285 557477055 583643014 586216753 588981593 592960633 605923775 611051145 643142759 632768011 634888864 736715552 750574599 867737742 924365786 927179496 934453020 954090860 977765165", "output": "no" }, { "input": "40\n42131757 49645896 49957344 78716964 120937785 129116222 172128600 211446903 247833196 779340466 717548386 709969818 696716905 636153997 635635467 614115746 609201167 533608141 521874836 273044950 291514539 394083281 399369419 448830087 485128983 487192341 488673105 497678164 501864738 265305156 799595875 831638598 835155840 845617770 847736630 851436542 879757553 885618675 964068808 969215471", "output": "no" }, { "input": "40\n25722567 28250400 47661056 108729970 119887370 142272261 145287693 178946020 182917658 187405805 209478929 278713296 312035195 393514697 403876943 410188367 413061616 420619615 477231590 511200584 560288373 571690007 603093961 615463729 631624043 723138759 726089658 728151980 756393077 785590533 809755752 823601179 828357990 866942019 869575503 877310377 881382070 901314141 929048602 947139655", "output": "yes\n1 1" }, { "input": "40\n17927221 33153935 60257083 110553879 114654567 119809916 163899753 167741765 182812464 188486743 220036903 220127072 227545828 229552200 244963635 248298934 299478582 354141058 371400641 430054473 452548736 458695269 466968129 469000714 478004472 478693873 509342093 750631027 609759323 669427158 688490225 690701652 696893030 704668825 749028408 557906039 545356441 926901326 955586118 972642992", "output": "no" }, { "input": "4\n1 4 2 3", "output": "no" }, { "input": "6\n1 2 5 4 3 6", "output": "yes\n3 5" }, { "input": "1\n1", "output": "yes\n1 1" }, { "input": "6\n1 5 3 4 2 6", "output": "no" }, { "input": "4\n3 4 1 2", "output": "no" }, { "input": "5\n2 5 4 3 1", "output": "no" }, { "input": "4\n2 1 4 3", "output": "no" }, { "input": "6\n2 1 4 3 5 6", "output": "no" } ]
1,696,005,747
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
31
0
n=int(input()) a=list(map(int,input().split())) y=sorted(a) c=0 x=a if a==sorted(a): print("yes") print(1,1) else: for i in range(n): for j in range(i+1,n): x[i],x[j]=x[j],x[i] if x==y: print("yes") print(x[i],x[j]) c=1 break x[i],x[j]=x[j],x[i] if c==1: break if c==0: print("no")
Title: Sort the Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Being a programmer, you like arrays a lot. For your birthday, your friends have given you an array *a* consisting of *n* distinct integers. Unfortunately, the size of *a* is too small. You want a bigger array! Your friends agree to give you a bigger array, but only if you are able to answer the following question correctly: is it possible to sort the array *a* (in increasing order) by reversing exactly one segment of *a*? See definitions of segment and reversing in the notes. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the size of array *a*. The second line contains *n* distinct space-separated integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109). Output Specification: Print "yes" or "no" (without quotes), depending on the answer. If your answer is "yes", then also print two space-separated integers denoting start and end (start must not be greater than end) indices of the segment to be reversed. If there are multiple ways of selecting these indices, print any of them. Demo Input: ['3\n3 2 1\n', '4\n2 1 3 4\n', '4\n3 1 2 4\n', '2\n1 2\n'] Demo Output: ['yes\n1 3\n', 'yes\n1 2\n', 'no\n', 'yes\n1 1\n'] Note: Sample 1. You can reverse the entire array to get [1, 2, 3], which is sorted. Sample 3. No segment can be reversed such that the array will be sorted. Definitions A segment [*l*, *r*] of array *a* is the sequence *a*[*l*], *a*[*l* + 1], ..., *a*[*r*]. If you have an array *a* of size *n* and you reverse its segment [*l*, *r*], the array will become: *a*[1], *a*[2], ..., *a*[*l* - 2], *a*[*l* - 1], *a*[*r*], *a*[*r* - 1], ..., *a*[*l* + 1], *a*[*l*], *a*[*r* + 1], *a*[*r* + 2], ..., *a*[*n* - 1], *a*[*n*].
```python n=int(input()) a=list(map(int,input().split())) y=sorted(a) c=0 x=a if a==sorted(a): print("yes") print(1,1) else: for i in range(n): for j in range(i+1,n): x[i],x[j]=x[j],x[i] if x==y: print("yes") print(x[i],x[j]) c=1 break x[i],x[j]=x[j],x[i] if c==1: break if c==0: print("no") ```
0
412
B
Network Configuration
PROGRAMMING
900
[ "greedy", "sortings" ]
null
null
The R1 company wants to hold a web search championship. There were *n* computers given for the competition, each of them is connected to the Internet. The organizers believe that the data transfer speed directly affects the result. The higher the speed of the Internet is, the faster the participant will find the necessary information. Therefore, before the competition started, each computer had its maximum possible data transfer speed measured. On the *i*-th computer it was *a**i* kilobits per second. There will be *k* participants competing in the championship, each should get a separate computer. The organizing company does not want any of the participants to have an advantage over the others, so they want to provide the same data transfer speed to each participant's computer. Also, the organizers want to create the most comfortable conditions for the participants, so the data transfer speed on the participants' computers should be as large as possible. The network settings of the R1 company has a special option that lets you to cut the initial maximum data transfer speed of any computer to any lower speed. How should the R1 company configure the network using the described option so that at least *k* of *n* computers had the same data transfer speed and the data transfer speed on these computers was as large as possible?
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of computers and the number of participants, respectively. In the second line you have a space-separated sequence consisting of *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (16<=≤<=*a**i*<=≤<=32768); number *a**i* denotes the maximum data transfer speed on the *i*-th computer.
Print a single integer — the maximum Internet speed value. It is guaranteed that the answer to the problem is always an integer.
[ "3 2\n40 20 30\n", "6 4\n100 20 40 20 50 50\n" ]
[ "30\n", "40\n" ]
In the first test case the organizers can cut the first computer's speed to 30 kilobits. Then two computers (the first and the third one) will have the same speed of 30 kilobits. They should be used as the participants' computers. This answer is optimal.
1,000
[ { "input": "3 2\n40 20 30", "output": "30" }, { "input": "6 4\n100 20 40 20 50 50", "output": "40" }, { "input": "1 1\n16", "output": "16" }, { "input": "2 1\n10000 17", "output": "10000" }, { "input": "2 2\n200 300", "output": "200" }, { "input": "3 1\n21 25 16", "output": "25" }, { "input": "3 2\n23 20 26", "output": "23" }, { "input": "3 3\n19 29 28", "output": "19" }, { "input": "100 2\n82 37 88 28 98 30 38 76 90 68 79 29 67 93 19 71 122 103 110 79 20 75 68 101 16 120 114 68 73 71 103 114 99 70 73 18 36 31 32 87 32 79 44 72 58 25 44 72 106 38 47 17 83 41 75 23 49 30 73 67 117 52 22 117 109 89 66 88 75 62 17 35 83 69 63 60 23 120 93 18 112 93 39 72 116 109 106 72 27 123 117 119 87 72 33 73 70 110 43 43", "output": "122" }, { "input": "30 13\n36 82 93 91 48 62 59 96 72 40 45 68 97 70 26 22 35 98 92 83 72 49 70 39 53 94 97 65 37 28", "output": "70" }, { "input": "50 49\n20 77 31 40 18 87 44 64 70 48 29 59 98 33 95 17 69 84 81 17 24 66 37 54 97 55 77 79 42 21 23 42 36 55 81 83 94 45 25 84 20 97 37 95 46 92 73 39 90 71", "output": "17" }, { "input": "40 40\n110 674 669 146 882 590 650 844 427 187 380 711 122 94 38 216 414 874 380 31 895 390 414 557 913 68 665 964 895 708 594 17 24 621 780 509 837 550 630 568", "output": "17" }, { "input": "40 1\n851 110 1523 1572 945 4966 4560 756 2373 4760 144 2579 4022 220 1924 1042 160 2792 2425 4483 2154 4120 319 4617 4686 2502 4797 4941 4590 4478 4705 4355 695 684 1560 684 2780 1090 4995 3113", "output": "4995" }, { "input": "70 12\n6321 2502 557 2734 16524 10133 13931 5045 3897 18993 5745 8687 12344 1724 12071 2345 3852 9312 14432 8615 7461 2439 4751 19872 12266 12997 8276 8155 9502 3047 7226 12754 9447 17349 1888 14564 18257 18099 8924 14199 738 13693 10917 15554 15773 17859 13391 13176 10567 19658 16494 3968 13977 14694 10537 4044 16402 9714 4425 13599 19660 2426 19687 2455 2382 3413 5754 113 7542 8353", "output": "16402" }, { "input": "80 60\n6159 26457 23753 27073 9877 4492 11957 10989 27151 6552 1646 7773 23924 27554 10517 8788 31160 455 12625 22009 22133 15657 14968 31871 15344 16550 27414 876 31213 10895 21508 17516 12747 59 11786 10497 30143 25548 22003 2809 11694 30395 8122 31248 23075 19013 31614 9133 27942 27346 15969 19415 10367 8424 29355 18903 3396 6327 4201 24124 24266 22586 724 1595 3972 17526 2843 20982 23655 12714 18050 15225 2658 7236 27555 13023 729 9022 17386 2585", "output": "8122" }, { "input": "100 1\n199 348 489 76 638 579 982 125 28 401 228 117 195 337 80 914 752 98 679 417 47 225 357 413 849 622 477 620 487 223 321 240 439 393 733 660 652 500 877 40 788 246 376 723 952 601 912 316 598 809 476 932 384 147 982 271 202 695 129 303 304 712 49 306 598 141 833 730 946 708 724 788 202 465 951 118 279 706 214 655 152 976 998 231 487 311 342 317 243 554 977 232 365 643 336 501 761 400 600 528", "output": "998" }, { "input": "80 50\n15160 6853 20254 11358 19535 27691 2983 31650 9219 11833 32053 31695 21511 4320 4384 24843 1454 31543 18796 13815 1546 27926 16276 14315 12542 25370 24890 29647 3584 17867 12446 15072 19852 30207 16361 7964 5343 398 10837 31114 9252 12767 15098 22562 32637 31823 8160 12658 6422 19142 12448 6765 7373 868 31712 24856 23251 29200 8159 16144 27165 4308 13652 12502 4183 7961 3032 26855 8687 12263 24319 7722 19460 30700 29806 1280 21141 25965 25550 26881", "output": "12448" }, { "input": "50 16\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16", "output": "16" }, { "input": "100 1\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16", "output": "16" }, { "input": "100 2\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16", "output": "16" }, { "input": "100 100\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16", "output": "16" }, { "input": "100 99\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16", "output": "16" } ]
1,496,915,486
2,147,483,647
Python 3
OK
TESTS
34
46
0
import sys n,k = map(int,input().split()) arr = sorted(list(map(int,input().split()))) print(arr[n-k])
Title: Network Configuration Time Limit: None seconds Memory Limit: None megabytes Problem Description: The R1 company wants to hold a web search championship. There were *n* computers given for the competition, each of them is connected to the Internet. The organizers believe that the data transfer speed directly affects the result. The higher the speed of the Internet is, the faster the participant will find the necessary information. Therefore, before the competition started, each computer had its maximum possible data transfer speed measured. On the *i*-th computer it was *a**i* kilobits per second. There will be *k* participants competing in the championship, each should get a separate computer. The organizing company does not want any of the participants to have an advantage over the others, so they want to provide the same data transfer speed to each participant's computer. Also, the organizers want to create the most comfortable conditions for the participants, so the data transfer speed on the participants' computers should be as large as possible. The network settings of the R1 company has a special option that lets you to cut the initial maximum data transfer speed of any computer to any lower speed. How should the R1 company configure the network using the described option so that at least *k* of *n* computers had the same data transfer speed and the data transfer speed on these computers was as large as possible? Input Specification: The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of computers and the number of participants, respectively. In the second line you have a space-separated sequence consisting of *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (16<=≤<=*a**i*<=≤<=32768); number *a**i* denotes the maximum data transfer speed on the *i*-th computer. Output Specification: Print a single integer — the maximum Internet speed value. It is guaranteed that the answer to the problem is always an integer. Demo Input: ['3 2\n40 20 30\n', '6 4\n100 20 40 20 50 50\n'] Demo Output: ['30\n', '40\n'] Note: In the first test case the organizers can cut the first computer's speed to 30 kilobits. Then two computers (the first and the third one) will have the same speed of 30 kilobits. They should be used as the participants' computers. This answer is optimal.
```python import sys n,k = map(int,input().split()) arr = sorted(list(map(int,input().split()))) print(arr[n-k]) ```
3
2
A
Winner
PROGRAMMING
1,500
[ "hashing", "implementation" ]
A. Winner
1
64
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Print the name of the winner.
[ "3\nmike 3\nandrew 5\nmike 2\n", "3\nandrew 3\nandrew 2\nmike 5\n" ]
[ "andrew\n", "andrew\n" ]
none
0
[ { "input": "3\nmike 3\nandrew 5\nmike 2", "output": "andrew" }, { "input": "3\nandrew 3\nandrew 2\nmike 5", "output": "andrew" }, { "input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303", "output": "kaxqybeultn" }, { "input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734", "output": "ksjuuerbnlklcfdjeyq" }, { "input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879", "output": "fcgslzkicjrpbqaifgweyzreajjfdo" }, { "input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735", "output": "aawtvezfntstrcpgbzjbf" }, { "input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158", "output": "ivhgbxiv" } ]
1,596,625,208
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
186
6,656,000
m,q,e=eval(input()),{},[] for i in range(m):p,d=input().split(' ');q[p]=q.get(p,0)+int(d);e.append([p,q[p]]) m=max(q.values()) for i,j in e: if c[i]==m and int(j)>=m:print(i);break
Title: Winner Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points. Input Specification: The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive. Output Specification: Print the name of the winner. Demo Input: ['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n'] Demo Output: ['andrew\n', 'andrew\n'] Note: none
```python m,q,e=eval(input()),{},[] for i in range(m):p,d=input().split(' ');q[p]=q.get(p,0)+int(d);e.append([p,q[p]]) m=max(q.values()) for i,j in e: if c[i]==m and int(j)>=m:print(i);break ```
-1
71
A
Way Too Long Words
PROGRAMMING
800
[ "strings" ]
A. Way Too Long Words
1
256
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
[ "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n" ]
[ "word\nl10n\ni18n\np43s\n" ]
none
500
[ { "input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis", "output": "word\nl10n\ni18n\np43s" }, { "input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm", "output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m" }, { "input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd", "output": "n20n\nj27b\nk15d" }, { "input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt", "output": "t41t" }, { "input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings", "output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings" }, { "input": "1\na", "output": "a" }, { "input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz", "output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz" }, { "input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij", "output": "a98j" }, { "input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco", "output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco" }, { "input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt", "output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t" }, { "input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr", "output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr" } ]
1,673,280,382
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
x=int(input("")) for i in range(1,x+1): y=input("") y=y.lower() z=int(len(y))-2 print(y[0]+f"{z}"+y[int(len(y))-1])
Title: Way Too Long Words Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. Output Specification: Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. Demo Input: ['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n'] Demo Output: ['word\nl10n\ni18n\np43s\n'] Note: none
```python x=int(input("")) for i in range(1,x+1): y=input("") y=y.lower() z=int(len(y))-2 print(y[0]+f"{z}"+y[int(len(y))-1]) ```
0
996
A
Hit the Lottery
PROGRAMMING
800
[ "dp", "greedy" ]
null
null
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output the minimum number of bills that Allen could receive.
[ "125\n", "43\n", "1000000000\n" ]
[ "3\n", "5\n", "10000000\n" ]
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
500
[ { "input": "125", "output": "3" }, { "input": "43", "output": "5" }, { "input": "1000000000", "output": "10000000" }, { "input": "4", "output": "4" }, { "input": "5", "output": "1" }, { "input": "1", "output": "1" }, { "input": "74", "output": "8" }, { "input": "31", "output": "3" }, { "input": "59", "output": "8" }, { "input": "79", "output": "9" }, { "input": "7", "output": "3" }, { "input": "55", "output": "4" }, { "input": "40", "output": "2" }, { "input": "719", "output": "13" }, { "input": "847", "output": "13" }, { "input": "225", "output": "4" }, { "input": "4704", "output": "51" }, { "input": "1132", "output": "15" }, { "input": "7811", "output": "80" }, { "input": "7981", "output": "84" }, { "input": "82655", "output": "830" }, { "input": "6364", "output": "70" }, { "input": "74611", "output": "748" }, { "input": "45391", "output": "459" }, { "input": "620448", "output": "6210" }, { "input": "265145", "output": "2654" }, { "input": "671704", "output": "6721" }, { "input": "365173", "output": "3658" }, { "input": "7130872", "output": "71314" }, { "input": "9628747", "output": "96292" }, { "input": "8898399", "output": "88993" }, { "input": "9497953", "output": "94985" }, { "input": "19070947", "output": "190714" }, { "input": "20185520", "output": "201856" }, { "input": "91402248", "output": "914028" }, { "input": "27035533", "output": "270360" }, { "input": "22717528", "output": "227180" }, { "input": "24403439", "output": "244041" }, { "input": "163565555", "output": "1635659" }, { "input": "152541908", "output": "1525423" }, { "input": "668439837", "output": "6684403" }, { "input": "20", "output": "1" }, { "input": "999999999", "output": "10000009" }, { "input": "10", "output": "1" }, { "input": "7", "output": "3" }, { "input": "6", "output": "2" }, { "input": "99999999", "output": "1000009" }, { "input": "1000001", "output": "10001" }, { "input": "2521", "output": "27" } ]
1,683,336,565
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
8
31
0
n=int(input()) def htl(n): if n<5: return (n) elif n==5 or n==10 or n==20 or n==100: return (1) elif 5<n<10: return (1+n%5) elif 10<n<20: return(1+n%10) elif 20<n<100: if n%20==0: return(n//20) else: if (n%20)<5: return(n//20 +n%20) elif n%20 ==5: return(n//20+1) else: return(n//20+(n%20)%5+1) else: return n//100 + htl(n%100) print(htl(n))
Title: Hit the Lottery Time Limit: None seconds Memory Limit: None megabytes Problem Description: Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance? Input Specification: The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$). Output Specification: Output the minimum number of bills that Allen could receive. Demo Input: ['125\n', '43\n', '1000000000\n'] Demo Output: ['3\n', '5\n', '10000000\n'] Note: In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
```python n=int(input()) def htl(n): if n<5: return (n) elif n==5 or n==10 or n==20 or n==100: return (1) elif 5<n<10: return (1+n%5) elif 10<n<20: return(1+n%10) elif 20<n<100: if n%20==0: return(n//20) else: if (n%20)<5: return(n//20 +n%20) elif n%20 ==5: return(n//20+1) else: return(n//20+(n%20)%5+1) else: return n//100 + htl(n%100) print(htl(n)) ```
0
246
C
Beauty Pageant
PROGRAMMING
1,600
[ "brute force", "constructive algorithms", "greedy" ]
null
null
General Payne has a battalion of *n* soldiers. The soldiers' beauty contest is coming up, it will last for *k* days. Payne decided that his battalion will participate in the pageant. Now he has choose the participants. All soldiers in the battalion have different beauty that is represented by a positive integer. The value *a**i* represents the beauty of the *i*-th soldier. On each of *k* days Generals has to send a detachment of soldiers to the pageant. The beauty of the detachment is the sum of the beauties of the soldiers, who are part of this detachment. Payne wants to surprise the jury of the beauty pageant, so each of *k* days the beauty of the sent detachment should be unique. In other words, all *k* beauties of the sent detachments must be distinct numbers. Help Payne choose *k* detachments of different beauties for the pageant. Please note that Payne cannot just forget to send soldiers on one day, that is, the detachment of soldiers he sends to the pageant should never be empty.
The first line contains two integers *n*, *k* (1<=≤<=*n*<=≤<=50; 1<=≤<=*k*<=≤<= ) — the number of soldiers and the number of days in the pageant, correspondingly. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=107) — the beauties of the battalion soldiers. It is guaranteed that Payne's battalion doesn't have two soldiers with the same beauty.
Print *k* lines: in the *i*-th line print the description of the detachment that will participate in the pageant on the *i*-th day. The description consists of integer *c**i* (1<=≤<=*c**i*<=≤<=*n*) — the number of soldiers in the detachment on the *i*-th day of the pageant and *c**i* distinct integers *p*1,<=*i*,<=*p*2,<=*i*,<=...,<=*p**c**i*,<=*i* — the beauties of the soldiers in the detachment on the *i*-th day of the pageant. The beauties of the soldiers are allowed to print in any order. Separate numbers on the lines by spaces. It is guaranteed that there is the solution that meets the problem conditions. If there are multiple solutions, print any of them.
[ "3 3\n1 2 3\n", "2 1\n7 12\n" ]
[ "1 1\n1 2\n2 3 2\n", "1 12 \n" ]
none
1,500
[ { "input": "3 3\n1 2 3", "output": "1 1\n1 2\n2 3 2" }, { "input": "2 1\n7 12", "output": "1 12 " }, { "input": "1 1\n1000", "output": "1 1000 " }, { "input": "5 8\n10 3 8 31 20", "output": "1 31 \n1 20 \n1 10 \n1 8 \n1 3 \n2 31 20 \n2 31 10 \n2 31 8 " }, { "input": "5 15\n1 2 3 4 5", "output": "1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 5 4 \n2 5 3 \n2 5 2 \n2 5 1 \n3 5 4 3 \n3 5 4 2 \n3 5 4 1 \n4 5 4 3 2 \n4 5 4 3 1 \n5 5 4 3 2 1 " }, { "input": "8 25\n6 8 3 7 2 1 4 9", "output": "1 9 \n1 8 \n1 7 \n1 6 \n1 4 \n1 3 \n1 2 \n1 1 \n2 9 8 \n2 9 7 \n2 9 6 \n2 9 4 \n2 9 3 \n2 9 2 \n2 9 1 \n3 9 8 7 \n3 9 8 6 \n3 9 8 4 \n3 9 8 3 \n3 9 8 2 \n3 9 8 1 \n4 9 8 7 6 \n4 9 8 7 4 \n4 9 8 7 3 \n4 9 8 7 2 " }, { "input": "10 9\n5 10 2 14 15 6 3 11 4 1", "output": "1 15 \n1 14 \n1 11 \n1 10 \n1 6 \n1 5 \n1 4 \n1 3 \n1 2 " }, { "input": "10 27\n17 53 94 95 57 36 47 68 48 16", "output": "1 95 \n1 94 \n1 68 \n1 57 \n1 53 \n1 48 \n1 47 \n1 36 \n1 17 \n1 16 \n2 95 94 \n2 95 68 \n2 95 57 \n2 95 53 \n2 95 48 \n2 95 47 \n2 95 36 \n2 95 17 \n2 95 16 \n3 95 94 68 \n3 95 94 57 \n3 95 94 53 \n3 95 94 48 \n3 95 94 47 \n3 95 94 36 \n3 95 94 17 \n3 95 94 16 " }, { "input": "6 5\n17 35 15 11 33 39", "output": "1 39 \n1 35 \n1 33 \n1 17 \n1 15 " }, { "input": "10 27\n17 53 94 95 57 36 47 68 48 16", "output": "1 95 \n1 94 \n1 68 \n1 57 \n1 53 \n1 48 \n1 47 \n1 36 \n1 17 \n1 16 \n2 95 94 \n2 95 68 \n2 95 57 \n2 95 53 \n2 95 48 \n2 95 47 \n2 95 36 \n2 95 17 \n2 95 16 \n3 95 94 68 \n3 95 94 57 \n3 95 94 53 \n3 95 94 48 \n3 95 94 47 \n3 95 94 36 \n3 95 94 17 \n3 95 94 16 " }, { "input": "30 122\n5858 8519 5558 2397 3059 3710 6238 8547 2167 9401 471 9160 8505 5876 4373 1596 2535 2592 7630 6304 3761 8752 60 3735 6760 999 4616 8695 5471 4107", "output": "1 9401 \n1 9160 \n1 8752 \n1 8695 \n1 8547 \n1 8519 \n1 8505 \n1 7630 \n1 6760 \n1 6304 \n1 6238 \n1 5876 \n1 5858 \n1 5558 \n1 5471 \n1 4616 \n1 4373 \n1 4107 \n1 3761 \n1 3735 \n1 3710 \n1 3059 \n1 2592 \n1 2535 \n1 2397 \n1 2167 \n1 1596 \n1 999 \n1 471 \n1 60 \n2 9401 9160 \n2 9401 8752 \n2 9401 8695 \n2 9401 8547 \n2 9401 8519 \n2 9401 8505 \n2 9401 7630 \n2 9401 6760 \n2 9401 6304 \n2 9401 6238 \n2 9401 5876 \n2 9401 5858 \n2 9401 5558 \n2 9401 5471 \n2 9401 4616 \n2 9401 4373 \n2 9401 4107 \n2 9401 ..." }, { "input": "40 57\n126032 9927136 5014907 292040 7692407 6366126 7729668 2948494 7684624 1116536 1647501 1431473 9383644 973174 1470440 700000 7802576 6112611 3601596 892656 6128849 2872763 8432319 3811223 7102327 9934716 5184890 6025259 9459149 3290088 738057 6728294 2688654 8600385 5985112 7644837 6567914 2828556 7564262 6794404", "output": "1 9934716 \n1 9927136 \n1 9459149 \n1 9383644 \n1 8600385 \n1 8432319 \n1 7802576 \n1 7729668 \n1 7692407 \n1 7684624 \n1 7644837 \n1 7564262 \n1 7102327 \n1 6794404 \n1 6728294 \n1 6567914 \n1 6366126 \n1 6128849 \n1 6112611 \n1 6025259 \n1 5985112 \n1 5184890 \n1 5014907 \n1 3811223 \n1 3601596 \n1 3290088 \n1 2948494 \n1 2872763 \n1 2828556 \n1 2688654 \n1 1647501 \n1 1470440 \n1 1431473 \n1 1116536 \n1 973174 \n1 892656 \n1 738057 \n1 700000 \n1 292040 \n1 126032 \n2 9934716 9927136 \n2 9934716 9459149..." }, { "input": "50 813\n7449220 5273373 3201959 2504940 1861950 5457724 7770654 5521932 3601175 8613797 5015473 3267679 5852552 317709 8222785 3095558 7401768 8363473 1465064 9308012 4880614 7406265 9829434 9196038 3063370 237239 8633093 2256018 5444025 8093607 7099410 9798618 7512880 5806095 3225443 3861872 1158790 4245341 4542965 378481 7628588 4918701 1031421 1230404 8413677 7381891 9338029 3206618 1658288 4721546", "output": "1 9829434 \n1 9798618 \n1 9338029 \n1 9308012 \n1 9196038 \n1 8633093 \n1 8613797 \n1 8413677 \n1 8363473 \n1 8222785 \n1 8093607 \n1 7770654 \n1 7628588 \n1 7512880 \n1 7449220 \n1 7406265 \n1 7401768 \n1 7381891 \n1 7099410 \n1 5852552 \n1 5806095 \n1 5521932 \n1 5457724 \n1 5444025 \n1 5273373 \n1 5015473 \n1 4918701 \n1 4880614 \n1 4721546 \n1 4542965 \n1 4245341 \n1 3861872 \n1 3601175 \n1 3267679 \n1 3225443 \n1 3206618 \n1 3201959 \n1 3095558 \n1 3063370 \n1 2504940 \n1 2256018 \n1 1861950 \n1 16582..." }, { "input": "50 836\n43 33 24 13 29 34 11 17 39 14 40 23 35 26 38 28 8 32 4 25 46 9 5 21 45 7 6 30 37 12 2 10 3 41 42 22 50 1 18 49 48 44 47 19 15 36 20 31 16 27", "output": "1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 50 49 \n2 50 48 \n2 50 47 \n2 50 46 \n2 50 45 \n2 50 44 \n2 50 43 \n2 50 42 \n2 50 41 \n2 50 40 \n2 50 39 \n2 50 38 \n2 50 37 \n2 50 36 \n2 50 35 \n2 50 34 \n2 50 33 \n..." }, { "input": "50 423\n49 38 12 5 15 14 18 23 39 3 43 28 20 16 25 42 22 17 21 37 31 27 30 41 10 36 13 40 35 44 48 46 7 24 9 8 33 29 26 19 32 2 4 11 6 47 50 34 1 45", "output": "1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 50 49 \n2 50 48 \n2 50 47 \n2 50 46 \n2 50 45 \n2 50 44 \n2 50 43 \n2 50 42 \n2 50 41 \n2 50 40 \n2 50 39 \n2 50 38 \n2 50 37 \n2 50 36 \n2 50 35 \n2 50 34 \n2 50 33 \n..." }, { "input": "50 870\n39 13 35 11 30 26 53 22 28 56 16 25 3 48 5 14 51 32 46 59 40 18 60 21 50 23 17 57 34 10 2 9 55 42 24 36 12 4 52 58 20 1 54 33 44 8 31 37 41 15", "output": "1 60 \n1 59 \n1 58 \n1 57 \n1 56 \n1 55 \n1 54 \n1 53 \n1 52 \n1 51 \n1 50 \n1 48 \n1 46 \n1 44 \n1 42 \n1 41 \n1 40 \n1 39 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 28 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 60 59 \n2 60 58 \n2 60 57 \n2 60 56 \n2 60 55 \n2 60 54 \n2 60 53 \n2 60 52 \n2 60 51 \n2 60 50 \n2 60 48 \n2 60 46 \n2 60 44 \n2 60 42 \n2 60 41 \n2 60 40 \n2 60 39 ..." }, { "input": "50 379\n67 54 43 61 55 58 11 21 24 5 41 30 65 19 32 31 39 28 40 27 14 2 8 64 60 23 66 20 53 63 51 57 34 48 4 49 25 47 7 44 62 15 52 13 36 9 38 1 17 10", "output": "1 67 \n1 66 \n1 65 \n1 64 \n1 63 \n1 62 \n1 61 \n1 60 \n1 58 \n1 57 \n1 55 \n1 54 \n1 53 \n1 52 \n1 51 \n1 49 \n1 48 \n1 47 \n1 44 \n1 43 \n1 41 \n1 40 \n1 39 \n1 38 \n1 36 \n1 34 \n1 32 \n1 31 \n1 30 \n1 28 \n1 27 \n1 25 \n1 24 \n1 23 \n1 21 \n1 20 \n1 19 \n1 17 \n1 15 \n1 14 \n1 13 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 5 \n1 4 \n1 2 \n1 1 \n2 67 66 \n2 67 65 \n2 67 64 \n2 67 63 \n2 67 62 \n2 67 61 \n2 67 60 \n2 67 58 \n2 67 57 \n2 67 55 \n2 67 54 \n2 67 53 \n2 67 52 \n2 67 51 \n2 67 49 \n2 67 48 \n2 67 47 ..." }, { "input": "50 270\n72 67 3 27 47 45 69 79 55 46 48 10 13 26 1 37 32 54 78 40 80 29 49 57 73 53 70 5 71 33 52 17 8 6 65 23 63 64 16 56 44 36 39 59 41 58 43 22 35 4", "output": "1 80 \n1 79 \n1 78 \n1 73 \n1 72 \n1 71 \n1 70 \n1 69 \n1 67 \n1 65 \n1 64 \n1 63 \n1 59 \n1 58 \n1 57 \n1 56 \n1 55 \n1 54 \n1 53 \n1 52 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 41 \n1 40 \n1 39 \n1 37 \n1 36 \n1 35 \n1 33 \n1 32 \n1 29 \n1 27 \n1 26 \n1 23 \n1 22 \n1 17 \n1 16 \n1 13 \n1 10 \n1 8 \n1 6 \n1 5 \n1 4 \n1 3 \n1 1 \n2 80 79 \n2 80 78 \n2 80 73 \n2 80 72 \n2 80 71 \n2 80 70 \n2 80 69 \n2 80 67 \n2 80 65 \n2 80 64 \n2 80 63 \n2 80 59 \n2 80 58 \n2 80 57 \n2 80 56 \n2 80 55 \n2 80 54..." }, { "input": "50 144\n9 97 15 22 69 27 7 23 84 73 74 60 94 43 98 13 4 63 49 31 93 6 75 32 99 68 48 16 54 20 38 40 65 34 28 21 55 79 50 2 18 95 25 56 77 71 52 10 47 36", "output": "1 99 \n1 98 \n1 97 \n1 95 \n1 94 \n1 93 \n1 84 \n1 79 \n1 77 \n1 75 \n1 74 \n1 73 \n1 71 \n1 69 \n1 68 \n1 65 \n1 63 \n1 60 \n1 56 \n1 55 \n1 54 \n1 52 \n1 50 \n1 49 \n1 48 \n1 47 \n1 43 \n1 40 \n1 38 \n1 36 \n1 34 \n1 32 \n1 31 \n1 28 \n1 27 \n1 25 \n1 23 \n1 22 \n1 21 \n1 20 \n1 18 \n1 16 \n1 15 \n1 13 \n1 10 \n1 9 \n1 7 \n1 6 \n1 4 \n1 2 \n2 99 98 \n2 99 97 \n2 99 95 \n2 99 94 \n2 99 93 \n2 99 84 \n2 99 79 \n2 99 77 \n2 99 75 \n2 99 74 \n2 99 73 \n2 99 71 \n2 99 69 \n2 99 68 \n2 99 65 \n2 99 63 \n2 99 6..." }, { "input": "50 263\n110 98 17 54 76 31 195 77 207 168 104 229 37 88 29 164 130 156 261 181 8 113 232 234 132 53 179 59 3 141 178 61 276 152 163 85 148 129 235 79 135 94 108 69 117 2 18 158 275 174", "output": "1 276 \n1 275 \n1 261 \n1 235 \n1 234 \n1 232 \n1 229 \n1 207 \n1 195 \n1 181 \n1 179 \n1 178 \n1 174 \n1 168 \n1 164 \n1 163 \n1 158 \n1 156 \n1 152 \n1 148 \n1 141 \n1 135 \n1 132 \n1 130 \n1 129 \n1 117 \n1 113 \n1 110 \n1 108 \n1 104 \n1 98 \n1 94 \n1 88 \n1 85 \n1 79 \n1 77 \n1 76 \n1 69 \n1 61 \n1 59 \n1 54 \n1 53 \n1 37 \n1 31 \n1 29 \n1 18 \n1 17 \n1 8 \n1 3 \n1 2 \n2 276 275 \n2 276 261 \n2 276 235 \n2 276 234 \n2 276 232 \n2 276 229 \n2 276 207 \n2 276 195 \n2 276 181 \n2 276 179 \n2 276 178 \n2 ..." }, { "input": "50 1260\n4 20 37 50 46 19 25 47 10 6 34 12 41 9 22 28 40 42 15 27 8 38 17 13 7 30 48 23 11 16 2 32 18 24 14 33 49 35 44 39 3 36 31 45 1 29 5 43 26 21", "output": "1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 50 49 \n2 50 48 \n2 50 47 \n2 50 46 \n2 50 45 \n2 50 44 \n2 50 43 \n2 50 42 \n2 50 41 \n2 50 40 \n2 50 39 \n2 50 38 \n2 50 37 \n2 50 36 \n2 50 35 \n2 50 34 \n2 50 33 \n..." }, { "input": "49 1221\n30 1 8 22 39 19 49 48 7 43 24 31 29 3 44 14 38 27 4 23 32 25 15 36 40 35 10 13 28 20 21 45 9 2 33 6 5 42 47 18 37 26 17 41 46 11 34 12 16", "output": "1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 49 48 \n2 49 47 \n2 49 46 \n2 49 45 \n2 49 44 \n2 49 43 \n2 49 42 \n2 49 41 \n2 49 40 \n2 49 39 \n2 49 38 \n2 49 37 \n2 49 36 \n2 49 35 \n2 49 34 \n2 49 33 \n2 49 32 \n2 49 31..." }, { "input": "40 816\n816843 900330 562275 683341 469585 146423 911678 402115 930078 168816 916945 431061 334812 205026 264126 227854 913266 866210 54081 956450 449344 904851 624237 701550 596898 291551 23284 479098 80555 289147 187677 980472 283817 162917 795597 631748 710693 76839 632833 204451", "output": "1 980472 \n1 956450 \n1 930078 \n1 916945 \n1 913266 \n1 911678 \n1 904851 \n1 900330 \n1 866210 \n1 816843 \n1 795597 \n1 710693 \n1 701550 \n1 683341 \n1 632833 \n1 631748 \n1 624237 \n1 596898 \n1 562275 \n1 479098 \n1 469585 \n1 449344 \n1 431061 \n1 402115 \n1 334812 \n1 291551 \n1 289147 \n1 283817 \n1 264126 \n1 227854 \n1 205026 \n1 204451 \n1 187677 \n1 168816 \n1 162917 \n1 146423 \n1 80555 \n1 76839 \n1 54081 \n1 23284 \n2 980472 956450 \n2 980472 930078 \n2 980472 916945 \n2 980472 913266 \n2 9..." }, { "input": "50 1267\n7449220 5273373 3201959 2504940 1861950 5457724 7770654 5521932 3601175 8613797 5015473 3267679 5852552 317709 8222785 3095558 7401768 8363473 1465064 9308012 4880614 7406265 9829434 9196038 3063370 237239 8633093 2256018 5444025 8093607 7099410 9798618 7512880 5806095 3225443 3861872 1158790 4245341 4542965 378481 7628588 4918701 1031421 1230404 8413677 7381891 9338029 3206618 1658288 4721546", "output": "1 9829434 \n1 9798618 \n1 9338029 \n1 9308012 \n1 9196038 \n1 8633093 \n1 8613797 \n1 8413677 \n1 8363473 \n1 8222785 \n1 8093607 \n1 7770654 \n1 7628588 \n1 7512880 \n1 7449220 \n1 7406265 \n1 7401768 \n1 7381891 \n1 7099410 \n1 5852552 \n1 5806095 \n1 5521932 \n1 5457724 \n1 5444025 \n1 5273373 \n1 5015473 \n1 4918701 \n1 4880614 \n1 4721546 \n1 4542965 \n1 4245341 \n1 3861872 \n1 3601175 \n1 3267679 \n1 3225443 \n1 3206618 \n1 3201959 \n1 3095558 \n1 3063370 \n1 2504940 \n1 2256018 \n1 1861950 \n1 16582..." }, { "input": "35 623\n5575 9829 2987 3856 893 1590 706 1270 3993 7532 4168 9800 7425 138 7824 5229 5204 3485 3591 3046 2844 7435 6180 1647 7885 4947 248 2797 4453 7217 9085 3406 8332 5288 6537", "output": "1 9829 \n1 9800 \n1 9085 \n1 8332 \n1 7885 \n1 7824 \n1 7532 \n1 7435 \n1 7425 \n1 7217 \n1 6537 \n1 6180 \n1 5575 \n1 5288 \n1 5229 \n1 5204 \n1 4947 \n1 4453 \n1 4168 \n1 3993 \n1 3856 \n1 3591 \n1 3485 \n1 3406 \n1 3046 \n1 2987 \n1 2844 \n1 2797 \n1 1647 \n1 1590 \n1 1270 \n1 893 \n1 706 \n1 248 \n1 138 \n2 9829 9800 \n2 9829 9085 \n2 9829 8332 \n2 9829 7885 \n2 9829 7824 \n2 9829 7532 \n2 9829 7435 \n2 9829 7425 \n2 9829 7217 \n2 9829 6537 \n2 9829 6180 \n2 9829 5575 \n2 9829 5288 \n2 9829 5229 \n2 98..." }, { "input": "50 1275\n10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 62", "output": "1 62 \n1 59 \n1 58 \n1 57 \n1 56 \n1 55 \n1 54 \n1 53 \n1 52 \n1 51 \n1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n2 62 59 \n2 62 58 \n2 62 57 \n2 62 56 \n2 62 55 \n2 62 54 \n2 62 53 \n2 62 52 \n2 62 51 \n2 62 50 \n2 62 49 \n2 62 48 \n2 62 47 \n2 62 46 \n2 62 45 \n2 62 44 \n2..." }, { "input": "50 1275\n11 84 1000000 1000001 1000002 1000003 1000004 1000005 1000006 1000007 1000008 1000009 1000010 1000011 1000012 1000013 1000014 1000015 1000016 1000017 1000018 1000019 1000020 1000021 1000022 1000023 1000024 1000025 1000026 1000028 1000030 1000031 1000032 1000033 1000034 1000035 1000036 1000037 1000038 1000039 1000040 1000041 1000042 1000043 1000044 1000045 1000046 1000047 1000048 1000049", "output": "1 1000049 \n1 1000048 \n1 1000047 \n1 1000046 \n1 1000045 \n1 1000044 \n1 1000043 \n1 1000042 \n1 1000041 \n1 1000040 \n1 1000039 \n1 1000038 \n1 1000037 \n1 1000036 \n1 1000035 \n1 1000034 \n1 1000033 \n1 1000032 \n1 1000031 \n1 1000030 \n1 1000028 \n1 1000026 \n1 1000025 \n1 1000024 \n1 1000023 \n1 1000022 \n1 1000021 \n1 1000020 \n1 1000019 \n1 1000018 \n1 1000017 \n1 1000016 \n1 1000015 \n1 1000014 \n1 1000013 \n1 1000012 \n1 1000011 \n1 1000010 \n1 1000009 \n1 1000008 \n1 1000007 \n1 1000006 \n1 10000..." }, { "input": "50 1275\n1 2 3 4 5 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 46 47 48 49 50 52 56", "output": "1 56 \n1 52 \n1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 5 \n1 4 \n1 3 \n1 2 \n1 1 \n2 56 52 \n2 56 50 \n2 56 49 \n2 56 48 \n2 56 47 \n2 56 46 \n2 56 45 \n2 56 43 \n2 56 42 \n2 56 41 \n2 56 40 \n2 56 39 \n2 56 38 \n2 56 37 \n2 56 36 \n2 56 35 \n2 56 34 \n..." }, { "input": "50 1275\n1 2 3 4 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 56", "output": "1 56 \n1 51 \n1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 4 \n1 3 \n1 2 \n1 1 \n2 56 51 \n2 56 50 \n2 56 49 \n2 56 48 \n2 56 47 \n2 56 46 \n2 56 45 \n2 56 44 \n2 56 43 \n2 56 42 \n2 56 41 \n2 56 40 \n2 56 39 \n2 56 38 \n2 56 37 \n2 56 36 \n2 56 35 \n..." }, { "input": "50 1275\n2 3 4 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 58", "output": "1 58 \n1 52 \n1 51 \n1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 4 \n1 3 \n1 2 \n2 58 52 \n2 58 51 \n2 58 50 \n2 58 49 \n2 58 48 \n2 58 47 \n2 58 46 \n2 58 45 \n2 58 44 \n2 58 43 \n2 58 42 \n2 58 41 \n2 58 40 \n2 58 39 \n2 58 38 \n2 58 37 \n2 58 36 ..." }, { "input": "50 1275\n4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 30 31 32 33 34 35 36 37 38 40 41 42 43 44 45 46 47 48 49 50 51 52 53 56 59", "output": "1 59 \n1 56 \n1 53 \n1 52 \n1 51 \n1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 42 \n1 41 \n1 40 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 30 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 21 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 8 \n1 7 \n1 6 \n1 5 \n1 4 \n2 59 56 \n2 59 53 \n2 59 52 \n2 59 51 \n2 59 50 \n2 59 49 \n2 59 48 \n2 59 47 \n2 59 46 \n2 59 45 \n2 59 44 \n2 59 43 \n2 59 42 \n2 59 41 \n2 59 40 \n2 59 38 \n2 59 37..." }, { "input": "50 1275\n6 9 10 11 12 13 14 16 17 18 19 20 22 24 25 26 27 28 29 30 31 33 34 35 36 37 38 39 40 41 43 44 45 46 47 48 49 50 51 52 54 55 64 66 67 68 84 88 90 92", "output": "1 92 \n1 90 \n1 88 \n1 84 \n1 68 \n1 67 \n1 66 \n1 64 \n1 55 \n1 54 \n1 52 \n1 51 \n1 50 \n1 49 \n1 48 \n1 47 \n1 46 \n1 45 \n1 44 \n1 43 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 31 \n1 30 \n1 29 \n1 28 \n1 27 \n1 26 \n1 25 \n1 24 \n1 22 \n1 20 \n1 19 \n1 18 \n1 17 \n1 16 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 6 \n2 92 90 \n2 92 88 \n2 92 84 \n2 92 68 \n2 92 67 \n2 92 66 \n2 92 64 \n2 92 55 \n2 92 54 \n2 92 52 \n2 92 51 \n2 92 50 \n2 92 49 \n2 92 48 \n2 92 47 \n2 92 46 \n2 9..." }, { "input": "50 1275\n6 7 9 10 11 12 13 14 15 16 17 19 20 22 23 24 25 26 28 29 31 32 33 34 35 36 37 38 39 40 41 43 44 46 48 50 51 52 53 54 55 11656 22042 30478 68064 70277 74455 88403 93743 99342", "output": "1 99342 \n1 93743 \n1 88403 \n1 74455 \n1 70277 \n1 68064 \n1 30478 \n1 22042 \n1 11656 \n1 55 \n1 54 \n1 53 \n1 52 \n1 51 \n1 50 \n1 48 \n1 46 \n1 44 \n1 43 \n1 41 \n1 40 \n1 39 \n1 38 \n1 37 \n1 36 \n1 35 \n1 34 \n1 33 \n1 32 \n1 31 \n1 29 \n1 28 \n1 26 \n1 25 \n1 24 \n1 23 \n1 22 \n1 20 \n1 19 \n1 17 \n1 16 \n1 15 \n1 14 \n1 13 \n1 12 \n1 11 \n1 10 \n1 9 \n1 7 \n1 6 \n2 99342 93743 \n2 99342 88403 \n2 99342 74455 \n2 99342 70277 \n2 99342 68064 \n2 99342 30478 \n2 99342 22042 \n2 99342 11656 \n2 99342 5..." }, { "input": "3 6\n1 2 3", "output": "1 3 \n1 2 \n1 1 \n2 3 2 \n2 3 1 \n3 3 2 1 " } ]
1,621,023,603
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
5
154
0
n,k=list(map(int,input().split())) a=list(map(int,input().split())) j=0 c=0 for i in range(k): b=[a[i-c]] for l in range(n-j,n): b.append(a[l]) print(j+1,*b) if i-c==n-j-1: c+=n-j j+=1
Title: Beauty Pageant Time Limit: None seconds Memory Limit: None megabytes Problem Description: General Payne has a battalion of *n* soldiers. The soldiers' beauty contest is coming up, it will last for *k* days. Payne decided that his battalion will participate in the pageant. Now he has choose the participants. All soldiers in the battalion have different beauty that is represented by a positive integer. The value *a**i* represents the beauty of the *i*-th soldier. On each of *k* days Generals has to send a detachment of soldiers to the pageant. The beauty of the detachment is the sum of the beauties of the soldiers, who are part of this detachment. Payne wants to surprise the jury of the beauty pageant, so each of *k* days the beauty of the sent detachment should be unique. In other words, all *k* beauties of the sent detachments must be distinct numbers. Help Payne choose *k* detachments of different beauties for the pageant. Please note that Payne cannot just forget to send soldiers on one day, that is, the detachment of soldiers he sends to the pageant should never be empty. Input Specification: The first line contains two integers *n*, *k* (1<=≤<=*n*<=≤<=50; 1<=≤<=*k*<=≤<= ) — the number of soldiers and the number of days in the pageant, correspondingly. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=107) — the beauties of the battalion soldiers. It is guaranteed that Payne's battalion doesn't have two soldiers with the same beauty. Output Specification: Print *k* lines: in the *i*-th line print the description of the detachment that will participate in the pageant on the *i*-th day. The description consists of integer *c**i* (1<=≤<=*c**i*<=≤<=*n*) — the number of soldiers in the detachment on the *i*-th day of the pageant and *c**i* distinct integers *p*1,<=*i*,<=*p*2,<=*i*,<=...,<=*p**c**i*,<=*i* — the beauties of the soldiers in the detachment on the *i*-th day of the pageant. The beauties of the soldiers are allowed to print in any order. Separate numbers on the lines by spaces. It is guaranteed that there is the solution that meets the problem conditions. If there are multiple solutions, print any of them. Demo Input: ['3 3\n1 2 3\n', '2 1\n7 12\n'] Demo Output: ['1 1\n1 2\n2 3 2\n', '1 12 \n'] Note: none
```python n,k=list(map(int,input().split())) a=list(map(int,input().split())) j=0 c=0 for i in range(k): b=[a[i-c]] for l in range(n-j,n): b.append(a[l]) print(j+1,*b) if i-c==n-j-1: c+=n-j j+=1 ```
0
133
A
HQ9+
PROGRAMMING
900
[ "implementation" ]
null
null
HQ9+ is a joke programming language which has only four one-character instructions: - "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator. Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored. You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output.
The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive.
Output "YES", if executing the program will produce any output, and "NO" otherwise.
[ "Hi!\n", "Codeforces\n" ]
[ "YES\n", "NO\n" ]
In the first case the program contains only one instruction — "H", which prints "Hello, World!". In the second case none of the program characters are language instructions.
500
[ { "input": "Hi!", "output": "YES" }, { "input": "Codeforces", "output": "NO" }, { "input": "a+b=c", "output": "NO" }, { "input": "hq-lowercase", "output": "NO" }, { "input": "Q", "output": "YES" }, { "input": "9", "output": "YES" }, { "input": "H", "output": "YES" }, { "input": "+", "output": "NO" }, { "input": "~", "output": "NO" }, { "input": "dEHsbM'gS[\\brZ_dpjXw8f?L[4E\"s4Zc9*(,j:>p$}m7HD[_9nOWQ\\uvq2mHWR", "output": "YES" }, { "input": "tt6l=RHOfStm.;Qd$-}zDes*E,.F7qn5-b%HC", "output": "YES" }, { "input": "@F%K2=%RyL/", "output": "NO" }, { "input": "juq)k(FT.^G=G\\zcqnO\"uJIE1_]KFH9S=1c\"mJ;F9F)%>&.WOdp09+k`Yc6}\"6xw,Aos:M\\_^^:xBb[CcsHm?J", "output": "YES" }, { "input": "6G_\"Fq#<AWyHG=Rci1t%#Jc#x<Fpg'N@t%F=``YO7\\Zd;6PkMe<#91YgzTC)", "output": "YES" }, { "input": "Fvg_~wC>SO4lF}*c`Q;mII9E{4.QodbqN]C", "output": "YES" }, { "input": "p-UXsbd&f", "output": "NO" }, { "input": "<]D7NMA)yZe=`?RbP5lsa.l_Mg^V:\"-0x+$3c,q&L%18Ku<HcA\\s!^OQblk^x{35S'>yz8cKgVHWZ]kV0>_", "output": "YES" }, { "input": "f.20)8b+.R}Gy!DbHU3v(.(=Q^`z[_BaQ}eO=C1IK;b2GkD\\{\\Bf\"!#qh]", "output": "YES" }, { "input": "}do5RU<(w<q[\"-NR)IAH_HyiD{", "output": "YES" }, { "input": "Iy^.,Aw*,5+f;l@Q;jLK'G5H-r1Pfmx?ei~`CjMmUe{K:lS9cu4ay8rqRh-W?Gqv!e-j*U)!Mzn{E8B6%~aSZ~iQ_QwlC9_cX(o8", "output": "YES" }, { "input": "sKLje,:q>-D,;NvQ3,qN3-N&tPx0nL/,>Ca|z\"k2S{NF7btLa3_TyXG4XZ:`(t&\"'^M|@qObZxv", "output": "YES" }, { "input": "%z:c@1ZsQ@\\6U/NQ+M9R>,$bwG`U1+C\\18^:S},;kw!&4r|z`", "output": "YES" }, { "input": "OKBB5z7ud81[Tn@P\"nDUd,>@", "output": "NO" }, { "input": "y{0;neX]w0IenPvPx0iXp+X|IzLZZaRzBJ>q~LhMhD$x-^GDwl;,a'<bAqH8QrFwbK@oi?I'W.bZ]MlIQ/x(0YzbTH^l.)]0Bv", "output": "YES" }, { "input": "EL|xIP5_+Caon1hPpQ0[8+r@LX4;b?gMy>;/WH)pf@Ur*TiXu*e}b-*%acUA~A?>MDz#!\\Uh", "output": "YES" }, { "input": "UbkW=UVb>;z6)p@Phr;^Dn.|5O{_i||:Rv|KJ_ay~V(S&Jp", "output": "NO" }, { "input": "!3YPv@2JQ44@)R2O_4`GO", "output": "YES" }, { "input": "Kba/Q,SL~FMd)3hOWU'Jum{9\"$Ld4:GW}D]%tr@G{hpG:PV5-c'VIZ~m/6|3I?_4*1luKnOp`%p|0H{[|Y1A~4-ZdX,Rw2[\\", "output": "YES" }, { "input": "NRN*=v>;oU7[acMIJn*n^bWm!cm3#E7Efr>{g-8bl\"DN4~_=f?[T;~Fq#&)aXq%</GcTJD^e$@Extm[e\"C)q_L", "output": "NO" }, { "input": "y#<fv{_=$MP!{D%I\\1OqjaqKh[pqE$KvYL<9@*V'j8uH0/gQdA'G;&y4Cv6&", "output": "YES" }, { "input": "+SE_Pg<?7Fh,z&uITQut2a-mk8X8La`c2A}", "output": "YES" }, { "input": "Uh3>ER](J", "output": "NO" }, { "input": "!:!{~=9*\\P;Z6F?HC5GadFz)>k*=u|+\"Cm]ICTmB!`L{&oS/z6b~#Snbp/^\\Q>XWU-vY+/dP.7S=-#&whS@,", "output": "YES" }, { "input": "KimtYBZp+ISeO(uH;UldoE6eAcp|9u?SzGZd6j-e}[}u#e[Cx8.qgY]$2!", "output": "YES" }, { "input": "[:[SN-{r>[l+OggH3v3g{EPC*@YBATT@", "output": "YES" }, { "input": "'jdL(vX", "output": "NO" }, { "input": "Q;R+aay]cL?Zh*uG\"YcmO*@Dts*Gjp}D~M7Z96+<4?9I3aH~0qNdO(RmyRy=ci,s8qD_kwj;QHFzD|5,5", "output": "YES" }, { "input": "{Q@#<LU_v^qdh%gGxz*pu)Y\"]k-l-N30WAxvp2IE3:jD0Wi4H/xWPH&s", "output": "YES" }, { "input": "~@Gb(S&N$mBuBUMAky-z^{5VwLNTzYg|ZUZncL@ahS?K*As<$iNUARM3r43J'jJB)$ujfPAq\"G<S9flGyakZg!2Z.-NJ|2{F>]", "output": "YES" }, { "input": "Jp5Aa>aP6fZ!\\6%A}<S}j{O4`C6y$8|i3IW,WHy&\"ioE&7zP\"'xHAY;:x%@SnS]Mr{R|})gU", "output": "YES" }, { "input": "ZA#:U)$RI^sE\\vuAt]x\"2zipI!}YEu2<j$:H0_9/~eB?#->", "output": "YES" }, { "input": "&ppw0._:\\p-PuWM@l}%%=", "output": "NO" }, { "input": "P(^pix\"=oiEZu8?@d@J(I`Xp5TN^T3\\Z7P5\"ZrvZ{2Fwz3g-8`U!)(1$a<g+9Q|COhDoH;HwFY02Pa|ZGp$/WZBR=>6Jg!yr", "output": "YES" }, { "input": "`WfODc\\?#ax~1xu@[ao+o_rN|L7%v,p,nDv>3+6cy.]q3)+A6b!q*Hc+#.t4f~vhUa~$^q", "output": "YES" }, { "input": ",)TH9N}'6t2+0Yg?S#6/{_.,!)9d}h'wG|sY&'Ul4D0l0", "output": "YES" }, { "input": "VXB&r9Z)IlKOJ:??KDA", "output": "YES" }, { "input": "\")1cL>{o\\dcYJzu?CefyN^bGRviOH&P7rJS3PT4:0V3F)%\\}L=AJouYsj_>j2|7^1NWu*%NbOP>ngv-ls<;b-4Sd3Na0R", "output": "YES" }, { "input": "2Y}\\A)>row{~c[g>:'.|ZC8%UTQ/jcdhK%6O)QRC.kd@%y}LJYk=V{G5pQK/yKJ%{G3C", "output": "YES" }, { "input": "O.&=qt(`z(", "output": "NO" }, { "input": "_^r6fyIc/~~;>l%9?aVEi7-{=,[<aMiB'-scSg$$|\"jAzY0N>QkHHGBZj2c\"=fhRlWd5;5K|GgU?7h]!;wl@", "output": "YES" }, { "input": "+/`sAd&eB29E=Nu87${.u6GY@$^a$,}s^!p!F}B-z8<<wORb<S7;HM1a,gp", "output": "YES" }, { "input": "U_ilyOGMT+QiW/M8/D(1=6a7)_FA,h4`8", "output": "YES" }, { "input": "!0WKT:$O", "output": "NO" }, { "input": "1EE*I%EQz6$~pPu7|(r7nyPQt4uGU@]~H'4uII?b1_Wn)K?ZRHrr0z&Kr;}aO3<mN=3:{}QgPxI|Ncm4#)", "output": "YES" }, { "input": "[u3\"$+!:/.<Dp1M7tH}:zxjt],^kv}qP;y12\"`^'/u*h%AFmPJ>e1#Yly", "output": "YES" }, { "input": "'F!_]tB<A&UO+p?7liE>(x&RFgG2~\\(", "output": "NO" }, { "input": "Qv)X8", "output": "YES" }, { "input": "aGv7,J@&g1(}E3g6[LuDZwZl2<v7IwQA%\"R(?ouBD>_=y\"3Kf%^>vON<a^T\\G^ootgE@whWmZo=[ex|F", "output": "YES" }, { "input": "e{}2vQ+/r@p0}cLKNe4MCk", "output": "YES" }, { "input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnkH", "output": "YES" }, { "input": "Qzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky", "output": "YES" }, { "input": "mzbmweyydiadtlcouegmdbyfwurpwb9uvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky", "output": "YES" }, { "input": "1H1", "output": "YES" }, { "input": "+Q", "output": "YES" }, { "input": "1ab", "output": "NO" }, { "input": "!", "output": "NO" }, { "input": "0+", "output": "NO" }, { "input": "+H", "output": "YES" }, { "input": "cH", "output": "YES" }, { "input": "+8", "output": "NO" }, { "input": "8+", "output": "NO" }, { "input": "++++++++++++++++++++++++++", "output": "NO" }, { "input": "(+)", "output": "NO" }, { "input": "H+", "output": "YES" }, { "input": "a!", "output": "NO" }, { "input": "++++++++++++++", "output": "NO" }, { "input": "+++++++++++++++++++++++++++++++++++++++++++++++++++++++++", "output": "NO" }, { "input": "8", "output": "NO" }, { "input": "3", "output": "NO" }, { "input": "HQ9", "output": "YES" }, { "input": "+++H", "output": "YES" }, { "input": "++++++++++", "output": "NO" }, { "input": "HHHHHHH", "output": "YES" }, { "input": "abacabaH", "output": "YES" }, { "input": "+G", "output": "NO" } ]
1,693,597,924
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
62
0
def check_output(program): for char in program: if char.isupper() and char in ['H', 'Q']: return "YES" return "NO" # Read the input program = input() # Check if the program will produce output output = check_output(program) # Print the result print(output)
Title: HQ9+ Time Limit: None seconds Memory Limit: None megabytes Problem Description: HQ9+ is a joke programming language which has only four one-character instructions: - "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator. Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored. You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output. Input Specification: The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive. Output Specification: Output "YES", if executing the program will produce any output, and "NO" otherwise. Demo Input: ['Hi!\n', 'Codeforces\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first case the program contains only one instruction — "H", which prints "Hello, World!". In the second case none of the program characters are language instructions.
```python def check_output(program): for char in program: if char.isupper() and char in ['H', 'Q']: return "YES" return "NO" # Read the input program = input() # Check if the program will produce output output = check_output(program) # Print the result print(output) ```
0
952
C
Ravioli Sort
PROGRAMMING
1,600
[ "implementation" ]
null
null
Everybody knows of [spaghetti sort](https://en.wikipedia.org/wiki/Spaghetti_sort). You decided to implement an analog sorting algorithm yourself, but as you survey your pantry you realize you're out of spaghetti! The only type of pasta you have is ravioli, but you are not going to let this stop you... You come up with the following algorithm. For each number in the array *a**i*, build a stack of *a**i* ravioli. The image shows the stack for *a**i*<==<=4. Arrange the stacks in one row in the order in which the corresponding numbers appear in the input array. Find the tallest one (if there are several stacks of maximal height, use the leftmost one). Remove it and add its height to the end of the output array. Shift the stacks in the row so that there is no gap between them. Repeat the procedure until all stacks have been removed. At first you are very happy with your algorithm, but as you try it on more inputs you realize that it doesn't always produce the right sorted array. Turns out when two stacks of ravioli are next to each other (at any step of the process) and differ in height by two or more, the top ravioli of the taller stack slides down on top of the lower stack. Given an input array, figure out whether the described algorithm will sort it correctly.
The first line of input contains a single number *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The second line of input contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the elements of the array.
Output "YES" if the array can be sorted using the described procedure and "NO" if it can not.
[ "3\n1 2 3\n", "3\n3 1 2\n" ]
[ "YES\n", "NO\n" ]
In the second example the array will change even before the tallest stack is chosen for the first time: ravioli from stack of height 3 will slide on the stack of height 1, and the algorithm will output an array {2, 2, 2}.
0
[ { "input": "3\n1 2 3", "output": "YES" }, { "input": "3\n3 1 2", "output": "NO" }, { "input": "1\n13", "output": "YES" }, { "input": "10\n67 67 67 67 67 67 67 67 67 67", "output": "YES" }, { "input": "10\n16 17 16 15 14 15 16 17 16 15", "output": "YES" }, { "input": "4\n54 54 54 55", "output": "YES" }, { "input": "3\n68 67 67", "output": "YES" }, { "input": "5\n46 46 47 46 45", "output": "YES" }, { "input": "4\n14 15 15 16", "output": "YES" }, { "input": "6\n59 59 60 60 59 58", "output": "YES" }, { "input": "3\n40 40 40", "output": "YES" }, { "input": "4\n90 91 90 91", "output": "YES" }, { "input": "10\n9 9 9 10 10 9 8 8 9 9", "output": "YES" }, { "input": "3\n22 23 24", "output": "YES" }, { "input": "9\n71 71 70 70 71 70 69 70 71", "output": "YES" }, { "input": "9\n15 14 14 13 13 12 13 13 14", "output": "YES" }, { "input": "4\n61 60 60 60", "output": "YES" }, { "input": "4\n16 17 17 18", "output": "YES" }, { "input": "6\n87 86 86 86 85 86", "output": "YES" }, { "input": "5\n64 63 63 62 61", "output": "YES" }, { "input": "9\n13 80 13 38 98 85 11 73 74", "output": "NO" }, { "input": "10\n2 83 18 65 58 95 37 51 86 47", "output": "NO" }, { "input": "6\n47 100 96 2 96 43", "output": "NO" }, { "input": "10\n28 61 23 73 61 33 45 55 18 43", "output": "NO" }, { "input": "10\n95 51 52 8 44 39 77 17 96 88", "output": "NO" }, { "input": "5\n14 91 91 91 84", "output": "NO" }, { "input": "4\n92 18 29 93", "output": "NO" }, { "input": "7\n23 37 39 8 72 31 85", "output": "NO" }, { "input": "4\n61 28 3 81", "output": "NO" }, { "input": "4\n83 100 81 75", "output": "NO" }, { "input": "9\n95 7 97 61 90 7 30 65 39", "output": "NO" }, { "input": "3\n90 39 98", "output": "NO" }, { "input": "3\n76 9 12", "output": "NO" }, { "input": "3\n69 26 73", "output": "NO" }, { "input": "10\n55 39 93 42 97 40 36 38 11 97", "output": "NO" }, { "input": "5\n21 57 40 94 17", "output": "NO" }, { "input": "7\n35 91 87 78 17 71 63", "output": "NO" }, { "input": "7\n20 21 95 73 49 98 53", "output": "NO" }, { "input": "8\n46 4 30 85 52 6 84 13", "output": "NO" }, { "input": "10\n79 84 22 38 23 22 33 42 13 96", "output": "NO" } ]
1,664,895,364
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
31
0
n=int(input()) x=list(map(int,input().split())) if sorted(x)==x: print('YES') else: print('NO')
Title: Ravioli Sort Time Limit: None seconds Memory Limit: None megabytes Problem Description: Everybody knows of [spaghetti sort](https://en.wikipedia.org/wiki/Spaghetti_sort). You decided to implement an analog sorting algorithm yourself, but as you survey your pantry you realize you're out of spaghetti! The only type of pasta you have is ravioli, but you are not going to let this stop you... You come up with the following algorithm. For each number in the array *a**i*, build a stack of *a**i* ravioli. The image shows the stack for *a**i*<==<=4. Arrange the stacks in one row in the order in which the corresponding numbers appear in the input array. Find the tallest one (if there are several stacks of maximal height, use the leftmost one). Remove it and add its height to the end of the output array. Shift the stacks in the row so that there is no gap between them. Repeat the procedure until all stacks have been removed. At first you are very happy with your algorithm, but as you try it on more inputs you realize that it doesn't always produce the right sorted array. Turns out when two stacks of ravioli are next to each other (at any step of the process) and differ in height by two or more, the top ravioli of the taller stack slides down on top of the lower stack. Given an input array, figure out whether the described algorithm will sort it correctly. Input Specification: The first line of input contains a single number *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The second line of input contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the elements of the array. Output Specification: Output "YES" if the array can be sorted using the described procedure and "NO" if it can not. Demo Input: ['3\n1 2 3\n', '3\n3 1 2\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the second example the array will change even before the tallest stack is chosen for the first time: ravioli from stack of height 3 will slide on the stack of height 1, and the algorithm will output an array {2, 2, 2}.
```python n=int(input()) x=list(map(int,input().split())) if sorted(x)==x: print('YES') else: print('NO') ```
0
841
A
Generous Kefa
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends. Next line contains string *s* — colors of baloons.
Answer to the task — «YES» or «NO» in a single line. You can choose the case (lower or upper) for each letter arbitrary.
[ "4 2\naabb\n", "6 3\naacaab\n" ]
[ "YES\n", "NO\n" ]
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
500
[ { "input": "4 2\naabb", "output": "YES" }, { "input": "6 3\naacaab", "output": "NO" }, { "input": "2 2\nlu", "output": "YES" }, { "input": "5 3\novvoo", "output": "YES" }, { "input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf", "output": "YES" }, { "input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv", "output": "NO" }, { "input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "YES" }, { "input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod", "output": "NO" }, { "input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl", "output": "YES" }, { "input": "18 6\njzwtnkvmscqhmdlsxy", "output": "YES" }, { "input": "21 2\nfscegcqgzesefghhwcexs", "output": "NO" }, { "input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc", "output": "YES" }, { "input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd", "output": "YES" }, { "input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv", "output": "YES" }, { "input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul", "output": "YES" }, { "input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii", "output": "NO" }, { "input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq", "output": "YES" }, { "input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb", "output": "YES" }, { "input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc", "output": "YES" }, { "input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab", "output": "YES" }, { "input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia", "output": "NO" }, { "input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf", "output": "YES" }, { "input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb", "output": "YES" }, { "input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa", "output": "NO" }, { "input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo", "output": "YES" }, { "input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib", "output": "YES" }, { "input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf", "output": "YES" }, { "input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci", "output": "YES" }, { "input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn", "output": "YES" }, { "input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev", "output": "YES" }, { "input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss", "output": "YES" }, { "input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs", "output": "NO" }, { "input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc", "output": "NO" }, { "input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi", "output": "NO" }, { "input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah", "output": "NO" }, { "input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka", "output": "YES" }, { "input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq", "output": "YES" }, { "input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb", "output": "YES" }, { "input": "14 5\nfssmmsfffmfmmm", "output": "NO" }, { "input": "2 1\nff", "output": "NO" }, { "input": "2 1\nhw", "output": "YES" }, { "input": "2 2\nss", "output": "YES" }, { "input": "1 1\nl", "output": "YES" }, { "input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp", "output": "YES" }, { "input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj", "output": "YES" }, { "input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj", "output": "YES" }, { "input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm", "output": "YES" }, { "input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq", "output": "YES" }, { "input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt", "output": "YES" }, { "input": "1 2\na", "output": "YES" }, { "input": "3 1\nabb", "output": "NO" }, { "input": "2 1\naa", "output": "NO" }, { "input": "2 1\nab", "output": "YES" }, { "input": "6 2\naaaaaa", "output": "NO" }, { "input": "8 4\naaaaaaaa", "output": "NO" }, { "input": "4 2\naaaa", "output": "NO" }, { "input": "4 3\naaaa", "output": "NO" }, { "input": "1 3\na", "output": "YES" }, { "input": "4 3\nzzzz", "output": "NO" }, { "input": "4 1\naaaa", "output": "NO" }, { "input": "3 4\nabc", "output": "YES" }, { "input": "2 5\nab", "output": "YES" }, { "input": "2 4\nab", "output": "YES" }, { "input": "1 10\na", "output": "YES" }, { "input": "5 2\nzzzzz", "output": "NO" }, { "input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "NO" }, { "input": "4 1\nabab", "output": "NO" }, { "input": "4 1\nabcb", "output": "NO" }, { "input": "4 2\nabbb", "output": "NO" }, { "input": "5 2\nabccc", "output": "NO" }, { "input": "2 3\nab", "output": "YES" }, { "input": "4 3\nbbbs", "output": "YES" }, { "input": "10 2\nazzzzzzzzz", "output": "NO" }, { "input": "1 2\nb", "output": "YES" }, { "input": "1 3\nb", "output": "YES" }, { "input": "4 5\nabcd", "output": "YES" }, { "input": "4 6\naabb", "output": "YES" }, { "input": "5 2\naaaab", "output": "NO" }, { "input": "3 5\naaa", "output": "YES" }, { "input": "5 3\nazzzz", "output": "NO" }, { "input": "4 100\naabb", "output": "YES" }, { "input": "3 10\naaa", "output": "YES" }, { "input": "3 4\naaa", "output": "YES" }, { "input": "12 5\naaaaabbbbbbb", "output": "NO" }, { "input": "5 2\naabbb", "output": "NO" }, { "input": "10 5\nzzzzzzzzzz", "output": "NO" }, { "input": "2 4\naa", "output": "YES" }, { "input": "1 5\na", "output": "YES" }, { "input": "10 5\naaaaaaaaaa", "output": "NO" }, { "input": "6 3\naaaaaa", "output": "NO" }, { "input": "7 1\nabcdeee", "output": "NO" }, { "input": "18 3\naaaaaabbbbbbcccccc", "output": "NO" }, { "input": "8 2\naabbccdd", "output": "YES" }, { "input": "4 2\nzzzz", "output": "NO" }, { "input": "4 2\nabaa", "output": "NO" }, { "input": "3 2\naaa", "output": "NO" }, { "input": "3 1\nzzz", "output": "NO" }, { "input": "5 4\nzzzzz", "output": "NO" }, { "input": "6 2\naabbbc", "output": "NO" }, { "input": "3 6\naaa", "output": "YES" }, { "input": "2 1\nzz", "output": "NO" }, { "input": "10 3\naaaeeeeeee", "output": "NO" }, { "input": "4 5\naabb", "output": "YES" }, { "input": "3 1\naaa", "output": "NO" }, { "input": "5 2\naazzz", "output": "NO" }, { "input": "6 2\nabbbbc", "output": "NO" }, { "input": "4 2\nxxxx", "output": "NO" }, { "input": "6 3\nzzzzzz", "output": "NO" }, { "input": "3 2\nabb", "output": "YES" }, { "input": "3 2\nzzz", "output": "NO" }, { "input": "6 5\nzzzzzz", "output": "NO" }, { "input": "6 3\nbcaaaa", "output": "NO" }, { "input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES" }, { "input": "3 6\nabc", "output": "YES" } ]
1,613,727,515
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
10
108
0
n,k=map(int,input().split()) s=list(input()) l=[] d=[] for i in s: if i not in d: d.append(i) l.append(s.count(i)) for j in l: if j>k: print("NO") break print("YES") break
Title: Generous Kefa Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends. Next line contains string *s* — colors of baloons. Output Specification: Answer to the task — «YES» or «NO» in a single line. You can choose the case (lower or upper) for each letter arbitrary. Demo Input: ['4 2\naabb\n', '6 3\naacaab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
```python n,k=map(int,input().split()) s=list(input()) l=[] d=[] for i in s: if i not in d: d.append(i) l.append(s.count(i)) for j in l: if j>k: print("NO") break print("YES") break ```
0
551
A
GukiZ and Contest
PROGRAMMING
800
[ "brute force", "implementation", "sortings" ]
null
null
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
[ "3\n1 3 3\n", "1\n1\n", "5\n3 5 3 4 5\n" ]
[ "3 1 1\n", "1\n", "4 1 4 3 1\n" ]
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
500
[ { "input": "3\n1 3 3", "output": "3 1 1" }, { "input": "1\n1", "output": "1" }, { "input": "5\n3 5 3 4 5", "output": "4 1 4 3 1" }, { "input": "7\n1 3 5 4 2 2 1", "output": "6 3 1 2 4 4 6" }, { "input": "11\n5 6 4 2 9 7 6 6 6 6 7", "output": "9 4 10 11 1 2 4 4 4 4 2" }, { "input": "1\n2000", "output": "1" }, { "input": "2\n2000 2000", "output": "1 1" }, { "input": "3\n500 501 502", "output": "3 2 1" }, { "input": "10\n105 106 1 1 1 11 1000 999 1000 999", "output": "6 5 8 8 8 7 1 3 1 3" }, { "input": "6\n1 2 3 4 5 6", "output": "6 5 4 3 2 1" }, { "input": "7\n6 5 4 3 2 1 1", "output": "1 2 3 4 5 6 6" }, { "input": "8\n153 100 87 14 10 8 6 5", "output": "1 2 3 4 5 6 7 8" }, { "input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10", "output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63" }, { "input": "5\n1 2000 1 1 2000", "output": "3 1 3 3 1" } ]
1,671,082,314
2,147,483,647
Python 3
OK
TESTS
36
499
0
x=int(input()) y=list(map(int,input().split())) arr1=[] for i in y: count=0 for j in y: if i<j: count+=1 arr1.append(count+1) print(*arr1)
Title: GukiZ and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*). Output Specification: In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input. Demo Input: ['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n'] Demo Output: ['3 1 1\n', '1\n', '4 1 4 3 1\n'] Note: In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
```python x=int(input()) y=list(map(int,input().split())) arr1=[] for i in y: count=0 for j in y: if i<j: count+=1 arr1.append(count+1) print(*arr1) ```
3
926
G
Large Bouquets
PROGRAMMING
1,500
[]
null
null
A flower shop has got *n* bouquets, and the *i*-th bouquet consists of *a**i* flowers. Vasya, the manager of the shop, decided to make large bouquets from these bouquets. Vasya thinks that a bouquet is large if it is made of two or more initial bouquets, and there is a constraint: the total number of flowers in a large bouquet should be odd. Each of the initial bouquets can be a part of at most one large bouquet. If an initial bouquet becomes a part of a large bouquet, all its flowers are included in the large bouquet. Determine the maximum possible number of large bouquets Vasya can make.
The first line contains a single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of initial bouquets. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the number of flowers in each of the initial bouquets.
Print the maximum number of large bouquets Vasya can make.
[ "5\n2 3 4 2 7\n", "6\n2 2 6 8 6 12\n", "3\n11 4 10\n" ]
[ "2\n", "0\n", "1\n" ]
In the first example Vasya can make 2 large bouquets. For example, the first bouquet can contain the first and the fifth initial bouquets (the total number of flowers is then equal to 9), and the second bouquet can consist of the second and the third initial bouquets (the total number of flowers is then equal to 7). The fourth initial bouquet is unused in this scheme. In the second example it is not possible to form a single bouquet with odd number of flowers. In the third example Vasya can make one large bouquet. For example, he can make it using all three initial bouquets. The size of the large bouquet is then equal to 11 + 4 + 10 = 25.
0
[ { "input": "5\n2 3 4 2 7", "output": "2" }, { "input": "6\n2 2 6 8 6 12", "output": "0" }, { "input": "3\n11 4 10", "output": "1" }, { "input": "1\n1", "output": "0" }, { "input": "1\n2", "output": "0" }, { "input": "1\n999999", "output": "0" }, { "input": "1\n1000000", "output": "0" }, { "input": "4\n943543 151729 379602 589828", "output": "2" }, { "input": "2\n468463 62253", "output": "0" }, { "input": "3\n352987 849349 967007", "output": "1" }, { "input": "20\n274039 899325 798709 157662 963297 276599 529230 80095 252956 980560 358150 82383 29856 901568 123794 275349 512273 508369 120076 170206", "output": "10" }, { "input": "25\n742168 377547 485672 437223 96307 902863 759104 747933 512899 410317 588598 666688 823202 257684 520631 910066 168864 71499 899972 565350 764848 754913 929040 864132 289976", "output": "10" } ]
1,521,304,387
3,487
Python 3
OK
TESTS
49
139
13,107,200
n = int(input()) arr = (map(int, input().split())) res = 0 for x in arr: res = res + x % 2 finalres = min(n - res, res) res = res - finalres finalres = finalres + res // 3 print(finalres)
Title: Large Bouquets Time Limit: None seconds Memory Limit: None megabytes Problem Description: A flower shop has got *n* bouquets, and the *i*-th bouquet consists of *a**i* flowers. Vasya, the manager of the shop, decided to make large bouquets from these bouquets. Vasya thinks that a bouquet is large if it is made of two or more initial bouquets, and there is a constraint: the total number of flowers in a large bouquet should be odd. Each of the initial bouquets can be a part of at most one large bouquet. If an initial bouquet becomes a part of a large bouquet, all its flowers are included in the large bouquet. Determine the maximum possible number of large bouquets Vasya can make. Input Specification: The first line contains a single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of initial bouquets. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the number of flowers in each of the initial bouquets. Output Specification: Print the maximum number of large bouquets Vasya can make. Demo Input: ['5\n2 3 4 2 7\n', '6\n2 2 6 8 6 12\n', '3\n11 4 10\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first example Vasya can make 2 large bouquets. For example, the first bouquet can contain the first and the fifth initial bouquets (the total number of flowers is then equal to 9), and the second bouquet can consist of the second and the third initial bouquets (the total number of flowers is then equal to 7). The fourth initial bouquet is unused in this scheme. In the second example it is not possible to form a single bouquet with odd number of flowers. In the third example Vasya can make one large bouquet. For example, he can make it using all three initial bouquets. The size of the large bouquet is then equal to 11 + 4 + 10 = 25.
```python n = int(input()) arr = (map(int, input().split())) res = 0 for x in arr: res = res + x % 2 finalres = min(n - res, res) res = res - finalres finalres = finalres + res // 3 print(finalres) ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,694,832,802
2,147,483,647
Python 3
OK
TESTS
31
92
0
n = int(input()) teams = [] for i in range(n): home_color, guest_color = map(int, input().split()) teams.append((home_color, guest_color)) count = 0 for i in range(n): for j in range(n): if i != j: # Exclude the same team playing against itself if teams[i][0] == teams[j][1]: # Check if home uniform of host matches guest uniform of guest count += 1 print(count)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python n = int(input()) teams = [] for i in range(n): home_color, guest_color = map(int, input().split()) teams.append((home_color, guest_color)) count = 0 for i in range(n): for j in range(n): if i != j: # Exclude the same team playing against itself if teams[i][0] == teams[j][1]: # Check if home uniform of host matches guest uniform of guest count += 1 print(count) ```
3
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,596,736,411
2,147,483,647
Python 3
OK
TESTS
34
109
6,656,000
n, x = map(int, input().split()) t = 0 for i in range(n): s, v = input().split() v = int(v) if s == '-': v = -v if x + v >= 0: x += v else: t += 1 print(x, t)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python n, x = map(int, input().split()) t = 0 for i in range(n): s, v = input().split() v = int(v) if s == '-': v = -v if x + v >= 0: x += v else: t += 1 print(x, t) ```
3
898
A
Rounding
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded. For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct. For given *n* find out to which integer will Vasya round it.
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
[ "5\n", "113\n", "1000000000\n", "5432359\n" ]
[ "0\n", "110\n", "1000000000\n", "5432360\n" ]
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
500
[ { "input": "5", "output": "0" }, { "input": "113", "output": "110" }, { "input": "1000000000", "output": "1000000000" }, { "input": "5432359", "output": "5432360" }, { "input": "999999994", "output": "999999990" }, { "input": "10", "output": "10" }, { "input": "9", "output": "10" }, { "input": "1", "output": "0" }, { "input": "0", "output": "0" }, { "input": "3", "output": "0" }, { "input": "4", "output": "0" }, { "input": "6", "output": "10" }, { "input": "7", "output": "10" }, { "input": "8", "output": "10" }, { "input": "19", "output": "20" }, { "input": "100", "output": "100" }, { "input": "997", "output": "1000" }, { "input": "9994", "output": "9990" }, { "input": "10002", "output": "10000" }, { "input": "100000", "output": "100000" }, { "input": "99999", "output": "100000" }, { "input": "999999999", "output": "1000000000" }, { "input": "999999998", "output": "1000000000" }, { "input": "999999995", "output": "999999990" }, { "input": "999999990", "output": "999999990" }, { "input": "1000000", "output": "1000000" }, { "input": "1000010", "output": "1000010" }, { "input": "10000010", "output": "10000010" }, { "input": "100000011", "output": "100000010" }, { "input": "400000003", "output": "400000000" }, { "input": "234234", "output": "234230" }, { "input": "675621", "output": "675620" }, { "input": "43532", "output": "43530" }, { "input": "4576453", "output": "4576450" }, { "input": "65754674", "output": "65754670" }, { "input": "3245526", "output": "3245530" }, { "input": "123445", "output": "123440" }, { "input": "234217", "output": "234220" }, { "input": "23451218", "output": "23451220" }, { "input": "1231239", "output": "1231240" }, { "input": "1923140", "output": "1923140" }, { "input": "307910310", "output": "307910310" }, { "input": "780961030", "output": "780961030" }, { "input": "103509421", "output": "103509420" }, { "input": "576560141", "output": "576560140" }, { "input": "48851642", "output": "48851640" }, { "input": "226935072", "output": "226935070" }, { "input": "844450763", "output": "844450760" }, { "input": "22534183", "output": "22534180" }, { "input": "640049874", "output": "640049870" }, { "input": "818133304", "output": "818133300" }, { "input": "730616285", "output": "730616280" }, { "input": "613732415", "output": "613732410" }, { "input": "380991216", "output": "380991220" }, { "input": "559074636", "output": "559074640" }, { "input": "176590327", "output": "176590330" }, { "input": "354673757", "output": "354673760" }, { "input": "267156738", "output": "267156740" }, { "input": "150272868", "output": "150272870" }, { "input": "62755859", "output": "62755860" }, { "input": "945871979", "output": "945871980" }, { "input": "46", "output": "50" }, { "input": "999", "output": "1000" }, { "input": "1397", "output": "1400" } ]
1,670,870,363
2,147,483,647
Python 3
OK
TESTS
64
46
0
# https://codeforces.com/problemset/problem/898/A n = int(input()) n_ = n%10 if n_ != 0 : if n_ >5: n=n-n_+10 else: n = n-n_ print(n)
Title: Rounding Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded. For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct. For given *n* find out to which integer will Vasya round it. Input Specification: The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has. Output Specification: Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer. Demo Input: ['5\n', '113\n', '1000000000\n', '5432359\n'] Demo Output: ['0\n', '110\n', '1000000000\n', '5432360\n'] Note: In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
```python # https://codeforces.com/problemset/problem/898/A n = int(input()) n_ = n%10 if n_ != 0 : if n_ >5: n=n-n_+10 else: n = n-n_ print(n) ```
3
723
A
The New Year: Meeting Friends
PROGRAMMING
800
[ "implementation", "math", "sortings" ]
null
null
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer.
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Print one integer — the minimum total distance the friends need to travel in order to meet together.
[ "7 1 4\n", "30 20 10\n" ]
[ "6\n", "20\n" ]
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
500
[ { "input": "7 1 4", "output": "6" }, { "input": "30 20 10", "output": "20" }, { "input": "1 4 100", "output": "99" }, { "input": "100 1 91", "output": "99" }, { "input": "1 45 100", "output": "99" }, { "input": "1 2 3", "output": "2" }, { "input": "71 85 88", "output": "17" }, { "input": "30 38 99", "output": "69" }, { "input": "23 82 95", "output": "72" }, { "input": "22 41 47", "output": "25" }, { "input": "9 94 77", "output": "85" }, { "input": "1 53 51", "output": "52" }, { "input": "25 97 93", "output": "72" }, { "input": "42 53 51", "output": "11" }, { "input": "81 96 94", "output": "15" }, { "input": "21 5 93", "output": "88" }, { "input": "50 13 75", "output": "62" }, { "input": "41 28 98", "output": "70" }, { "input": "69 46 82", "output": "36" }, { "input": "87 28 89", "output": "61" }, { "input": "44 45 40", "output": "5" }, { "input": "86 97 68", "output": "29" }, { "input": "43 92 30", "output": "62" }, { "input": "16 70 1", "output": "69" }, { "input": "40 46 19", "output": "27" }, { "input": "71 38 56", "output": "33" }, { "input": "82 21 80", "output": "61" }, { "input": "75 8 35", "output": "67" }, { "input": "75 24 28", "output": "51" }, { "input": "78 23 56", "output": "55" }, { "input": "85 31 10", "output": "75" }, { "input": "76 50 9", "output": "67" }, { "input": "95 37 34", "output": "61" }, { "input": "84 61 35", "output": "49" }, { "input": "87 85 37", "output": "50" }, { "input": "1 3 2", "output": "2" }, { "input": "4 2 6", "output": "4" }, { "input": "6 9 3", "output": "6" }, { "input": "12 4 8", "output": "8" }, { "input": "15 10 5", "output": "10" }, { "input": "1 50 17", "output": "49" }, { "input": "10 5 15", "output": "10" }, { "input": "8 1 9", "output": "8" }, { "input": "3 5 4", "output": "2" }, { "input": "2 1 3", "output": "2" }, { "input": "1 8 2", "output": "7" }, { "input": "1 100 2", "output": "99" }, { "input": "1 4 6", "output": "5" } ]
1,682,336,671
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
30
0
a, b, c = map(int, input().split()) avg = round((a+c+b)/3) print(abs(a-avg)+abs(b-avg)+abs(c-avg))
Title: The New Year: Meeting Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer. Input Specification: The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively. Output Specification: Print one integer — the minimum total distance the friends need to travel in order to meet together. Demo Input: ['7 1 4\n', '30 20 10\n'] Demo Output: ['6\n', '20\n'] Note: In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
```python a, b, c = map(int, input().split()) avg = round((a+c+b)/3) print(abs(a-avg)+abs(b-avg)+abs(c-avg)) ```
0
114
A
Cifera
PROGRAMMING
1,000
[ "math" ]
null
null
When Petya went to school, he got interested in large numbers and what they were called in ancient times. For instance, he learned that the Russian word "tma" (which now means "too much to be counted") used to stand for a thousand and "tma tmyschaya" (which literally means "the tma of tmas") used to stand for a million. Petya wanted to modernize the words we use for numbers and invented a word petricium that represents number *k*. Moreover, petricium la petricium stands for number *k*2, petricium la petricium la petricium stands for *k*3 and so on. All numbers of this form are called petriciumus cifera, and the number's importance is the number of articles la in its title. Petya's invention brought on a challenge that needed to be solved quickly: does some number *l* belong to the set petriciumus cifera? As Petya is a very busy schoolboy he needs to automate the process, he asked you to solve it.
The first input line contains integer number *k*, the second line contains integer number *l* (2<=≤<=*k*,<=*l*<=≤<=231<=-<=1).
You should print in the first line of the output "YES", if the number belongs to the set petriciumus cifera and otherwise print "NO". If the number belongs to the set, then print on the seconds line the only number — the importance of number *l*.
[ "5\n25\n", "3\n8\n" ]
[ "YES\n1\n", "NO\n" ]
none
500
[ { "input": "5\n25", "output": "YES\n1" }, { "input": "3\n8", "output": "NO" }, { "input": "123\n123", "output": "YES\n0" }, { "input": "99\n970300", "output": "NO" }, { "input": "1000\n6666666", "output": "NO" }, { "input": "59\n3571", "output": "NO" }, { "input": "256\n16777217", "output": "NO" }, { "input": "4638\n21511044", "output": "YES\n1" }, { "input": "24\n191102976", "output": "YES\n5" }, { "input": "52010\n557556453", "output": "NO" }, { "input": "61703211\n1750753082", "output": "NO" }, { "input": "137\n2571353", "output": "YES\n2" }, { "input": "8758\n1746157336", "output": "NO" }, { "input": "2\n64", "output": "YES\n5" }, { "input": "96\n884736", "output": "YES\n2" }, { "input": "1094841453\n1656354409", "output": "NO" }, { "input": "1154413\n1229512809", "output": "NO" }, { "input": "2442144\n505226241", "output": "NO" }, { "input": "11548057\n1033418098", "output": "NO" }, { "input": "581\n196122941", "output": "YES\n2" }, { "input": "146\n1913781536", "output": "NO" }, { "input": "945916\n1403881488", "output": "NO" }, { "input": "68269\n365689065", "output": "NO" }, { "input": "30\n900", "output": "YES\n1" }, { "input": "6\n1296", "output": "YES\n3" }, { "input": "1470193122\n1420950405", "output": "NO" }, { "input": "90750\n1793111557", "output": "NO" }, { "input": "1950054\n1664545956", "output": "NO" }, { "input": "6767692\n123762320", "output": "NO" }, { "input": "1437134\n1622348229", "output": "NO" }, { "input": "444103\n1806462642", "output": "NO" }, { "input": "2592\n6718464", "output": "YES\n1" }, { "input": "50141\n366636234", "output": "NO" }, { "input": "835\n582182875", "output": "YES\n2" }, { "input": "156604\n902492689", "output": "NO" }, { "input": "27385965\n1742270058", "output": "NO" }, { "input": "3\n9", "output": "YES\n1" }, { "input": "35\n1838265625", "output": "YES\n5" }, { "input": "8\n4096", "output": "YES\n3" }, { "input": "85955\n945811082", "output": "NO" }, { "input": "54958832\n956670209", "output": "NO" }, { "input": "1475381\n1348159738", "output": "NO" }, { "input": "7313241\n413670642", "output": "NO" }, { "input": "582470\n2116368165", "output": "NO" }, { "input": "26859739\n595086170", "output": "NO" }, { "input": "249766393\n1582130", "output": "NO" }, { "input": "11734\n137686756", "output": "YES\n1" }, { "input": "925093\n1098566745", "output": "NO" }, { "input": "40\n1600", "output": "YES\n1" }, { "input": "2147483647\n2147483647", "output": "YES\n0" }, { "input": "2147483646\n2147483647", "output": "NO" }, { "input": "2147483647\n2147483646", "output": "NO" }, { "input": "2\n2147483647", "output": "NO" }, { "input": "2\n1073741825", "output": "NO" }, { "input": "2\n1073741824", "output": "YES\n29" }, { "input": "10000\n10", "output": "NO" }, { "input": "10\n10000", "output": "YES\n3" }, { "input": "10\n2000000000", "output": "NO" }, { "input": "10\n1000000000", "output": "YES\n8" }, { "input": "5\n1808548329", "output": "NO" }, { "input": "2\n2147483646", "output": "NO" }, { "input": "25\n125", "output": "NO" }, { "input": "6\n18", "output": "NO" }, { "input": "5\n30", "output": "NO" } ]
1,592,589,533
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
186
0
n = int(input()) b = int(input()) i,w=0,-1 while True: q = n**i if q>b:break elif q==b:w =i;break i+=1 if w>=2:print("YES");print(w-1) else:print("NO")
Title: Cifera Time Limit: None seconds Memory Limit: None megabytes Problem Description: When Petya went to school, he got interested in large numbers and what they were called in ancient times. For instance, he learned that the Russian word "tma" (which now means "too much to be counted") used to stand for a thousand and "tma tmyschaya" (which literally means "the tma of tmas") used to stand for a million. Petya wanted to modernize the words we use for numbers and invented a word petricium that represents number *k*. Moreover, petricium la petricium stands for number *k*2, petricium la petricium la petricium stands for *k*3 and so on. All numbers of this form are called petriciumus cifera, and the number's importance is the number of articles la in its title. Petya's invention brought on a challenge that needed to be solved quickly: does some number *l* belong to the set petriciumus cifera? As Petya is a very busy schoolboy he needs to automate the process, he asked you to solve it. Input Specification: The first input line contains integer number *k*, the second line contains integer number *l* (2<=≤<=*k*,<=*l*<=≤<=231<=-<=1). Output Specification: You should print in the first line of the output "YES", if the number belongs to the set petriciumus cifera and otherwise print "NO". If the number belongs to the set, then print on the seconds line the only number — the importance of number *l*. Demo Input: ['5\n25\n', '3\n8\n'] Demo Output: ['YES\n1\n', 'NO\n'] Note: none
```python n = int(input()) b = int(input()) i,w=0,-1 while True: q = n**i if q>b:break elif q==b:w =i;break i+=1 if w>=2:print("YES");print(w-1) else:print("NO") ```
0
369
A
Valera and Plates
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
[ "3 1 1\n1 2 1\n", "4 3 1\n1 1 1 1\n", "3 1 2\n2 2 2\n", "8 2 2\n1 2 1 2 1 2 1 2\n" ]
[ "1\n", "1\n", "0\n", "4\n" ]
In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
500
[ { "input": "3 1 1\n1 2 1", "output": "1" }, { "input": "4 3 1\n1 1 1 1", "output": "1" }, { "input": "3 1 2\n2 2 2", "output": "0" }, { "input": "8 2 2\n1 2 1 2 1 2 1 2", "output": "4" }, { "input": "2 100 100\n2 2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2", "output": "132" }, { "input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1", "output": "22" }, { "input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1", "output": "87" }, { "input": "3 1 2\n1 1 1", "output": "2" }, { "input": "3 2 2\n1 1 1", "output": "1" }, { "input": "3 2 1\n1 1 1", "output": "1" }, { "input": "3 1 1\n1 1 1", "output": "2" }, { "input": "5 1 2\n2 2 2 2 2", "output": "2" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "5 2 1\n2 2 2 2 2", "output": "2" }, { "input": "5 1 1\n2 2 2 2 2", "output": "3" }, { "input": "1 1 2\n2", "output": "0" }, { "input": "1 2 2\n2", "output": "0" }, { "input": "1 2 1\n2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "6 3 1\n1 1 2 2 2 2", "output": "2" }, { "input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "40" }, { "input": "7 5 2\n2 2 1 1 1 1 1", "output": "0" }, { "input": "10 4 4\n2 2 2 2 2 2 1 1 1 1", "output": "2" }, { "input": "3 2 1\n2 1 1", "output": "0" }, { "input": "7 6 1\n2 1 1 1 1 1 1", "output": "0" }, { "input": "7 5 1\n1 1 1 2 2 2 2", "output": "1" }, { "input": "5 3 1\n1 1 2 2 2", "output": "1" }, { "input": "3 1 1\n2 2 2", "output": "1" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "3 1 3\n1 1 1", "output": "2" }, { "input": "5 2 1\n1 1 2 2 2", "output": "2" }, { "input": "4 3 2\n2 1 1 1", "output": "0" }, { "input": "4 2 1\n1 2 2 2", "output": "1" }, { "input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2", "output": "3" }, { "input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1", "output": "0" }, { "input": "5 3 2\n2 2 1 1 1", "output": "0" } ]
1,659,111,484
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
6
46
0
import random days,bowls,plates=input().split() m,k=bowls,plates dishtype=list(input().split()) count=0 for n in range(int(days)): if int(dishtype[n])==1: if int(m)!=0: m=int(m)-1 else: count+=1 else: if int(m)!=0 and int(k)==0: m=int(m)-1 elif int(m)==0 and int(k)!=0: k=int(k)-1 elif int(m)!=0 and int(k)!=0: L=[int(m),int(k)] a=random.choice(L) if a==0: count+=1 elif a==int(m): m=int(m)-1 else: k=int(k)-1 else: count+=1 print(count)
Title: Valera and Plates Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally. Input Specification: The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish. Output Specification: Print a single integer — the minimum number of times Valera will need to wash a plate/bowl. Demo Input: ['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n'] Demo Output: ['1\n', '1\n', '0\n', '4\n'] Note: In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
```python import random days,bowls,plates=input().split() m,k=bowls,plates dishtype=list(input().split()) count=0 for n in range(int(days)): if int(dishtype[n])==1: if int(m)!=0: m=int(m)-1 else: count+=1 else: if int(m)!=0 and int(k)==0: m=int(m)-1 elif int(m)==0 and int(k)!=0: k=int(k)-1 elif int(m)!=0 and int(k)!=0: L=[int(m),int(k)] a=random.choice(L) if a==0: count+=1 elif a==int(m): m=int(m)-1 else: k=int(k)-1 else: count+=1 print(count) ```
0
379
A
New Year Candles
PROGRAMMING
1,000
[ "implementation" ]
null
null
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Print a single integer — the number of hours Vasily can light up the room for.
[ "4 2\n", "6 3\n" ]
[ "7\n", "8\n" ]
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
500
[ { "input": "4 2", "output": "7" }, { "input": "6 3", "output": "8" }, { "input": "1000 1000", "output": "1001" }, { "input": "123 5", "output": "153" }, { "input": "1000 2", "output": "1999" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "1 4", "output": "1" }, { "input": "2 2", "output": "3" }, { "input": "3 2", "output": "5" }, { "input": "3 3", "output": "4" }, { "input": "999 2", "output": "1997" }, { "input": "1000 3", "output": "1499" }, { "input": "1000 4", "output": "1333" }, { "input": "1 1000", "output": "1" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "10 4", "output": "13" }, { "input": "4 3", "output": "5" }, { "input": "91 5", "output": "113" }, { "input": "777 17", "output": "825" }, { "input": "100 4", "output": "133" }, { "input": "5 3", "output": "7" }, { "input": "6 4", "output": "7" }, { "input": "26 8", "output": "29" }, { "input": "9 4", "output": "11" }, { "input": "20 3", "output": "29" }, { "input": "17 3", "output": "25" } ]
1,669,107,354
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
31
0
k = input().split(" ") k = [int(i) for i in k] a = k[0] b = k[1] l = [] l.append(a) k = a/b while(k): l.append(int(k)) k/=b print(sum(l))
Title: New Year Candles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. Input Specification: The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000). Output Specification: Print a single integer — the number of hours Vasily can light up the room for. Demo Input: ['4 2\n', '6 3\n'] Demo Output: ['7\n', '8\n'] Note: Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
```python k = input().split(" ") k = [int(i) for i in k] a = k[0] b = k[1] l = [] l.append(a) k = a/b while(k): l.append(int(k)) k/=b print(sum(l)) ```
0
877
A
Alex and broken contest
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems. But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name. It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita". Names are case sensitive.
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
Print "YES", if problem is from this contest, and "NO" otherwise.
[ "Alex_and_broken_contest\n", "NikitaAndString\n", "Danil_and_Olya\n" ]
[ "NO", "YES", "NO" ]
none
500
[ { "input": "Alex_and_broken_contest", "output": "NO" }, { "input": "NikitaAndString", "output": "YES" }, { "input": "Danil_and_Olya", "output": "NO" }, { "input": "Slava____and_the_game", "output": "YES" }, { "input": "Olya_and_energy_drinks", "output": "YES" }, { "input": "Danil_and_part_time_job", "output": "YES" }, { "input": "Ann_and_books", "output": "YES" }, { "input": "Olya", "output": "YES" }, { "input": "Nikita", "output": "YES" }, { "input": "Slava", "output": "YES" }, { "input": "Vanya", "output": "NO" }, { "input": "I_dont_know_what_to_write_here", "output": "NO" }, { "input": "danil_and_work", "output": "NO" }, { "input": "Ann", "output": "YES" }, { "input": "Batman_Nananananananan_Batman", "output": "NO" }, { "input": "Olya_Nikita_Ann_Slava_Danil", "output": "NO" }, { "input": "its_me_Mario", "output": "NO" }, { "input": "A", "output": "NO" }, { "input": "Wake_up_Neo", "output": "NO" }, { "input": "Hardest_problem_ever", "output": "NO" }, { "input": "Nikita_Nikita", "output": "NO" }, { "input": "____________________________________________________________________________________________________", "output": "NO" }, { "input": "Nikitb", "output": "NO" }, { "input": "Unn", "output": "NO" }, { "input": "oLya_adn_smth", "output": "NO" }, { "input": "FloorISLava", "output": "NO" }, { "input": "ann", "output": "NO" }, { "input": "aa", "output": "NO" }, { "input": "AAnnnnn", "output": "YES" }, { "input": "AnnAnn", "output": "NO" }, { "input": "Annn", "output": "YES" }, { "input": "Dilzhan", "output": "NO" }, { "input": "Danilaaa", "output": "YES" }, { "input": "AndAnn", "output": "YES" }, { "input": "OlyaAnnAnn", "output": "NO" }, { "input": "DanilDanilOlya", "output": "NO" }, { "input": "DDanil", "output": "YES" }, { "input": "AnnAnnDanil", "output": "NO" }, { "input": "And_Danil", "output": "YES" }, { "input": "abcddddDanil", "output": "YES" }, { "input": "DanilOlyaOlya", "output": "NO" }, { "input": "Nikitaaa", "output": "YES" }, { "input": "aaabbba", "output": "NO" }, { "input": "Ann_Ann_Danil", "output": "NO" }, { "input": "Danil_Danil_Nikita", "output": "NO" }, { "input": "AlexaaaaaaBBBBBOlyaDDDDD", "output": "YES" }, { "input": "IloveDaniland", "output": "YES" }, { "input": "AnAnn", "output": "YES" }, { "input": "Danil_Danil_Olya", "output": "NO" }, { "input": "DanilDanilSlava", "output": "NO" }, { "input": "DanilDanil", "output": "NO" }, { "input": "OlyOlya", "output": "YES" }, { "input": "NikitaNikitb", "output": "YES" }, { "input": "ababaca", "output": "NO" }, { "input": "AnnNikitaNikitaNikitaNikita__good_luck", "output": "NO" } ]
1,535,722,508
2,147,483,647
Python 3
OK
TESTS
55
124
0
s = input() col = 0 col += s.count("Danil") col += s.count("Olya") col += s.count("Slava") col += s.count("Ann") col += s.count("Nikita") if (col == 1): print("YES") else: print("NO")
Title: Alex and broken contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems. But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name. It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita". Names are case sensitive. Input Specification: The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem. Output Specification: Print "YES", if problem is from this contest, and "NO" otherwise. Demo Input: ['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n'] Demo Output: ['NO', 'YES', 'NO'] Note: none
```python s = input() col = 0 col += s.count("Danil") col += s.count("Olya") col += s.count("Slava") col += s.count("Ann") col += s.count("Nikita") if (col == 1): print("YES") else: print("NO") ```
3
383
A
Milking cows
PROGRAMMING
1,600
[ "data structures", "greedy" ]
null
null
Iahub helps his grandfather at the farm. Today he must milk the cows. There are *n* cows sitting in a row, numbered from 1 to *n* from left to right. Each cow is either facing to the left or facing to the right. When Iahub milks a cow, all the cows that see the current cow get scared and lose one unit of the quantity of milk that they can give. A cow facing left sees all the cows with lower indices than her index, and a cow facing right sees all the cows with higher indices than her index. A cow that got scared once can get scared again (and lose one more unit of milk). A cow that has been milked once cannot get scared and lose any more milk. You can assume that a cow never loses all the milk she can give (a cow gives an infinitely amount of milk). Iahub can decide the order in which he milks the cows. But he must milk each cow exactly once. Iahub wants to lose as little milk as possible. Print the minimum amount of milk that is lost.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=200000). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, where *a**i* is 0 if the cow number *i* is facing left, and 1 if it is facing right.
Print a single integer, the minimum amount of lost milk. Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "4\n0 0 1 0\n", "5\n1 0 1 0 1\n" ]
[ "1", "3" ]
In the first sample Iahub milks the cows in the following order: cow 3, cow 4, cow 2, cow 1. When he milks cow 3, cow 4 loses 1 unit of milk. After that, no more milk is lost.
500
[ { "input": "4\n0 0 1 0", "output": "1" }, { "input": "5\n1 0 1 0 1", "output": "3" }, { "input": "50\n1 1 0 1 1 1 1 1 1 0 0 1 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 0 0 0 0 0 1 1 0 1 0 0 1 0", "output": "416" }, { "input": "100\n1 1 0 0 1 1 1 1 0 1 1 1 1 1 1 1 0 0 0 0 0 0 1 1 0 1 0 0 0 0 1 1 1 1 0 0 1 0 0 1 1 0 1 1 1 1 1 1 0 0 0 0 1 1 0 0 0 0 0 1 1 0 1 0 0 1 0 0 1 0 1 0 0 0 0 1 0 1 1 0 1 1 1 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 0", "output": "1446" }, { "input": "1\n1", "output": "0" }, { "input": "1\n0", "output": "0" }, { "input": "2\n0 1", "output": "0" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n0 0", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "4\n1 1 1 1", "output": "0" } ]
1,553,598,530
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
78
0
n = int(input()) l = input().split() s = 0 j = 0 for i in range(0,n): if(bool(l[i])): j=j+1 else: s=s+j print(s)
Title: Milking cows Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub helps his grandfather at the farm. Today he must milk the cows. There are *n* cows sitting in a row, numbered from 1 to *n* from left to right. Each cow is either facing to the left or facing to the right. When Iahub milks a cow, all the cows that see the current cow get scared and lose one unit of the quantity of milk that they can give. A cow facing left sees all the cows with lower indices than her index, and a cow facing right sees all the cows with higher indices than her index. A cow that got scared once can get scared again (and lose one more unit of milk). A cow that has been milked once cannot get scared and lose any more milk. You can assume that a cow never loses all the milk she can give (a cow gives an infinitely amount of milk). Iahub can decide the order in which he milks the cows. But he must milk each cow exactly once. Iahub wants to lose as little milk as possible. Print the minimum amount of milk that is lost. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=200000). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, where *a**i* is 0 if the cow number *i* is facing left, and 1 if it is facing right. Output Specification: Print a single integer, the minimum amount of lost milk. Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['4\n0 0 1 0\n', '5\n1 0 1 0 1\n'] Demo Output: ['1', '3'] Note: In the first sample Iahub milks the cows in the following order: cow 3, cow 4, cow 2, cow 1. When he milks cow 3, cow 4 loses 1 unit of milk. After that, no more milk is lost.
```python n = int(input()) l = input().split() s = 0 j = 0 for i in range(0,n): if(bool(l[i])): j=j+1 else: s=s+j print(s) ```
0
547
B
Mike and Feet
PROGRAMMING
1,900
[ "binary search", "data structures", "dp", "dsu" ]
null
null
Mike is the president of country What-The-Fatherland. There are *n* bears living in this country besides Mike. All of them are standing in a line and they are numbered from 1 to *n* from left to right. *i*-th bear is exactly *a**i* feet high. A group of bears is a non-empty contiguous segment of the line. The size of a group is the number of bears in that group. The strength of a group is the minimum height of the bear in that group. Mike is a curious to know for each *x* such that 1<=≤<=*x*<=≤<=*n* the maximum strength among all groups of size *x*.
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=2<=×<=105), the number of bears. The second line contains *n* integers separated by space, *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), heights of bears.
Print *n* integers in one line. For each *x* from 1 to *n*, print the maximum strength among all groups of size *x*.
[ "10\n1 2 3 4 5 4 3 2 1 6\n" ]
[ "6 4 4 3 3 2 2 1 1 1 \n" ]
none
1,000
[ { "input": "10\n1 2 3 4 5 4 3 2 1 6", "output": "6 4 4 3 3 2 2 1 1 1 " }, { "input": "3\n524125987 923264237 374288891", "output": "923264237 524125987 374288891 " }, { "input": "5\n585325539 365329221 412106895 291882089 564718673", "output": "585325539 365329221 365329221 291882089 291882089 " }, { "input": "20\n452405440 586588704 509061481 552472140 16115810 148658854 66743034 628305150 677780684 519361360 208050516 401554301 954478790 346543678 387546138 832279893 641889899 80960260 717802881 588066499", "output": "954478790 641889899 519361360 452405440 346543678 346543678 208050516 208050516 208050516 208050516 80960260 80960260 80960260 66743034 66743034 16115810 16115810 16115810 16115810 16115810 " }, { "input": "1\n1376", "output": "1376 " }, { "input": "2\n10 10", "output": "10 10 " }, { "input": "2\n10 9", "output": "10 9 " }, { "input": "3\n1 2 3", "output": "3 2 1 " }, { "input": "3\n1 3 2", "output": "3 2 1 " }, { "input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754", "output": "983359971 640274071 598196518 598196518 96204862 71550121 71550121 71550121 71550121 71550121 " }, { "input": "19\n519879446 764655030 680293934 914539062 744988123 317088317 653721289 239862203 605157354 943428394 261437390 821695238 312192823 432992892 547139308 408916833 829654733 223751525 672158759", "output": "943428394 744988123 680293934 680293934 519879446 317088317 317088317 261437390 261437390 239862203 239862203 239862203 239862203 239862203 239862203 239862203 239862203 223751525 223751525 " } ]
1,554,072,593
2,147,483,647
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
8
1,000
19,046,400
def processLog (n): log = [0] * (n+1) log[2] = [1] for i in range(2,n+1): log[i] = log[int(i/2)] + 1 return log def printTable(arr): for i in range(len(arr)): print(arr[i]) def buildTable(arr, LOG): spt=[] for k in range(LOG): spt.append([922337203685477]*(n)) for i in range(n): spt[0][i] = arr[i] for j in range(1,LOG): for i in range(n): if i+(1<<(j-1))<n: spt[j][i]=min(spt[j-1][i],spt[j-1][i+(1<<(j-1))]) return spt def query(l, r): passo = (log[r - l + 1]) return min(spt[passo][l], spt[passo][(r -(1<<passo) +1)]) def busca(i): l, r = 0, i num = spt[0][i] left, right = i, i while(l <= r): mid = int((r + l) / 2) if query(mid, i) == num: r = mid - 1 left = mid else: l = mid + 1 l = i r = n - 1 while (l<=r): mid = int((r + l) / 2) if query(i, mid) == num: l = mid + 1 right = mid else: r = mid -1 return right - left + 1 def build_ans(): ans = [0] * (n+1) for i in range(n): result = busca(i) ans[result] = max(ans[result], spt[0][i]) for i in range(n-1, -1, -1): ans[i] = max(ans[i], ans[i+1]) return ans[1:] n = int(input()) arr=list(map(int,input().split())) log = processLog(n+5) if n>1: LOG=log[n-1] + 1 else: LOG=0 spt = buildTable(arr, LOG) ans = build_ans() out = '' for i in ans: print (i, end = ' ', flush=True)
Title: Mike and Feet Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mike is the president of country What-The-Fatherland. There are *n* bears living in this country besides Mike. All of them are standing in a line and they are numbered from 1 to *n* from left to right. *i*-th bear is exactly *a**i* feet high. A group of bears is a non-empty contiguous segment of the line. The size of a group is the number of bears in that group. The strength of a group is the minimum height of the bear in that group. Mike is a curious to know for each *x* such that 1<=≤<=*x*<=≤<=*n* the maximum strength among all groups of size *x*. Input Specification: The first line of input contains integer *n* (1<=≤<=*n*<=≤<=2<=×<=105), the number of bears. The second line contains *n* integers separated by space, *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), heights of bears. Output Specification: Print *n* integers in one line. For each *x* from 1 to *n*, print the maximum strength among all groups of size *x*. Demo Input: ['10\n1 2 3 4 5 4 3 2 1 6\n'] Demo Output: ['6 4 4 3 3 2 2 1 1 1 \n'] Note: none
```python def processLog (n): log = [0] * (n+1) log[2] = [1] for i in range(2,n+1): log[i] = log[int(i/2)] + 1 return log def printTable(arr): for i in range(len(arr)): print(arr[i]) def buildTable(arr, LOG): spt=[] for k in range(LOG): spt.append([922337203685477]*(n)) for i in range(n): spt[0][i] = arr[i] for j in range(1,LOG): for i in range(n): if i+(1<<(j-1))<n: spt[j][i]=min(spt[j-1][i],spt[j-1][i+(1<<(j-1))]) return spt def query(l, r): passo = (log[r - l + 1]) return min(spt[passo][l], spt[passo][(r -(1<<passo) +1)]) def busca(i): l, r = 0, i num = spt[0][i] left, right = i, i while(l <= r): mid = int((r + l) / 2) if query(mid, i) == num: r = mid - 1 left = mid else: l = mid + 1 l = i r = n - 1 while (l<=r): mid = int((r + l) / 2) if query(i, mid) == num: l = mid + 1 right = mid else: r = mid -1 return right - left + 1 def build_ans(): ans = [0] * (n+1) for i in range(n): result = busca(i) ans[result] = max(ans[result], spt[0][i]) for i in range(n-1, -1, -1): ans[i] = max(ans[i], ans[i+1]) return ans[1:] n = int(input()) arr=list(map(int,input().split())) log = processLog(n+5) if n>1: LOG=log[n-1] + 1 else: LOG=0 spt = buildTable(arr, LOG) ans = build_ans() out = '' for i in ans: print (i, end = ' ', flush=True) ```
0
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,670,390,024
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
str= input() num=[] s=0 e=0 for i in range(0, len(str)): if str[i]==" ": e=i num.append(str[s:e]) s=i+1 if i==len(str)-1: num.append(str[s:i+1]) n, m, a= num n= int(n) m= int(m) a= int(a) if n<1 or m<1 or a<1 or n>10**9 or m>10**9 or a>10**9: print("Invalid input") exit() ii=0 for i in range(0, (n*a)+1): if a*i==n: ii=i break if a*i>n: ii=i break m= m- (a*2) iii=0 for i in range(0, (m*a)+1): if a*i==m: iii=i break if a*i>m: iii=i break if ii==1: print(ii) else: print((ii*2)+(iii*2))
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python str= input() num=[] s=0 e=0 for i in range(0, len(str)): if str[i]==" ": e=i num.append(str[s:e]) s=i+1 if i==len(str)-1: num.append(str[s:i+1]) n, m, a= num n= int(n) m= int(m) a= int(a) if n<1 or m<1 or a<1 or n>10**9 or m>10**9 or a>10**9: print("Invalid input") exit() ii=0 for i in range(0, (n*a)+1): if a*i==n: ii=i break if a*i>n: ii=i break m= m- (a*2) iii=0 for i in range(0, (m*a)+1): if a*i==m: iii=i break if a*i>m: iii=i break if ii==1: print(ii) else: print((ii*2)+(iii*2)) ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,639,037,639
2,147,483,647
Python 3
OK
TESTS
30
92
0
s = input() small_count = 0 cap_count = 0 for i in range(len(s)): if s[i] >= 'a' and s[i] <= 'z': small_count += 1 else: cap_count += 1 if small_count >= cap_count: for i in range(len(s)): x = s[i].lower() print(x, end="") else: for i in range(len(s)): x = s[i].upper() print(x, end="")
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python s = input() small_count = 0 cap_count = 0 for i in range(len(s)): if s[i] >= 'a' and s[i] <= 'z': small_count += 1 else: cap_count += 1 if small_count >= cap_count: for i in range(len(s)): x = s[i].lower() print(x, end="") else: for i in range(len(s)): x = s[i].upper() print(x, end="") ```
3.977
797
B
Odd sum
PROGRAMMING
1,400
[ "dp", "greedy", "implementation" ]
null
null
You are given sequence *a*1,<=*a*2,<=...,<=*a**n* of integer numbers of length *n*. Your task is to find such subsequence that its sum is odd and maximum among all such subsequences. It's guaranteed that given sequence contains subsequence with odd sum. Subsequence is a sequence that can be derived from another sequence by deleting some elements without changing the order of the remaining elements. You should write a program which finds sum of the best subsequence.
The first line contains integer number *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=104<=≤<=*a**i*<=≤<=104). The sequence contains at least one subsequence with odd sum.
Print sum of resulting subseqeuence.
[ "4\n-2 2 -3 1\n", "3\n2 -5 -3\n" ]
[ "3\n", "-1\n" ]
In the first example sum of the second and the fourth elements is 3.
0
[ { "input": "4\n-2 2 -3 1", "output": "3" }, { "input": "3\n2 -5 -3", "output": "-1" }, { "input": "1\n1", "output": "1" }, { "input": "1\n-1", "output": "-1" }, { "input": "15\n-6004 4882 9052 413 6056 4306 9946 -4616 -6135 906 -1718 5252 -2866 9061 4046", "output": "53507" }, { "input": "2\n-5439 -6705", "output": "-5439" }, { "input": "2\n2850 6843", "output": "9693" }, { "input": "2\n144 9001", "output": "9145" }, { "input": "10\n7535 -819 2389 4933 5495 4887 -5181 -9355 7955 5757", "output": "38951" }, { "input": "10\n-9169 -1574 3580 -8579 -7177 -3216 7490 3470 3465 -1197", "output": "18005" }, { "input": "10\n941 7724 2220 -4704 -8374 -8249 7606 9502 612 -9097", "output": "28605" }, { "input": "10\n4836 -2331 -3456 2312 -1574 3134 -670 -204 512 -5504", "output": "8463" }, { "input": "10\n1184 5136 1654 3254 6576 6900 6468 327 179 7114", "output": "38613" }, { "input": "10\n-2152 -1776 -1810 -9046 -6090 -2324 -8716 -6103 -787 -812", "output": "-787" }, { "input": "3\n1 1 1", "output": "3" }, { "input": "5\n5 5 5 3 -1", "output": "17" }, { "input": "5\n-1 -2 5 3 0", "output": "7" }, { "input": "5\n-3 -2 5 -1 3", "output": "7" }, { "input": "3\n-2 2 -1", "output": "1" }, { "input": "5\n5 0 7 -2 3", "output": "15" }, { "input": "2\n-2 -5", "output": "-5" }, { "input": "3\n-1 -3 0", "output": "-1" }, { "input": "5\n2 -1 0 -3 -2", "output": "1" }, { "input": "4\n2 3 0 5", "output": "7" }, { "input": "5\n-5 3 -2 2 5", "output": "7" }, { "input": "59\n8593 5929 3016 -859 4366 -6842 8435 -3910 -2458 -8503 -3612 -9793 -5360 -9791 -362 -7180 727 -6245 -8869 -7316 8214 -7944 7098 3788 -5436 -6626 -1131 -2410 -5647 -7981 263 -5879 8786 709 6489 5316 -4039 4909 -4340 7979 -89 9844 -906 172 -7674 -3371 -6828 9505 3284 5895 3646 6680 -1255 3635 -9547 -5104 -1435 -7222 2244", "output": "129433" }, { "input": "17\n-6170 2363 6202 -9142 7889 779 2843 -5089 2313 -3952 1843 5171 462 -3673 5098 -2519 9565", "output": "43749" }, { "input": "26\n-8668 9705 1798 -1766 9644 3688 8654 -3077 -5462 2274 6739 2732 3635 -4745 -9144 -9175 -7488 -2010 1637 1118 8987 1597 -2873 -5153 -8062 146", "output": "60757" }, { "input": "51\n8237 -7239 -3545 -6059 -5110 4066 -4148 -7641 -5797 -994 963 1144 -2785 -8765 -1216 5410 1508 -6312 -6313 -680 -7657 4579 -6898 7379 2015 -5087 -5417 -6092 3819 -9101 989 -8380 9161 -7519 -9314 -3838 7160 5180 567 -1606 -3842 -9665 -2266 1296 -8417 -3976 7436 -2075 -441 -4565 3313", "output": "73781" }, { "input": "1\n-1", "output": "-1" }, { "input": "1\n1", "output": "1" }, { "input": "1\n-1", "output": "-1" }, { "input": "1\n1", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "1\n-1", "output": "-1" }, { "input": "1\n-1", "output": "-1" }, { "input": "1\n1", "output": "1" }, { "input": "2\n-2 1", "output": "1" }, { "input": "2\n3 2", "output": "5" }, { "input": "2\n1 2", "output": "3" }, { "input": "2\n-1 1", "output": "1" }, { "input": "2\n0 -1", "output": "-1" }, { "input": "2\n2 1", "output": "3" }, { "input": "2\n3 0", "output": "3" }, { "input": "2\n0 -1", "output": "-1" }, { "input": "3\n-3 1 -1", "output": "1" }, { "input": "3\n3 -1 1", "output": "3" }, { "input": "3\n1 3 1", "output": "5" }, { "input": "3\n-1 0 1", "output": "1" }, { "input": "3\n-3 -3 -2", "output": "-3" }, { "input": "3\n3 -1 1", "output": "3" }, { "input": "3\n3 -1 1", "output": "3" }, { "input": "3\n-2 -2 1", "output": "1" }, { "input": "4\n0 -1 -3 -4", "output": "-1" }, { "input": "4\n5 3 2 1", "output": "11" }, { "input": "4\n-1 -2 4 -2", "output": "3" }, { "input": "4\n-1 -3 0 -3", "output": "-1" }, { "input": "4\n1 -4 -3 -4", "output": "1" }, { "input": "4\n5 3 3 4", "output": "15" }, { "input": "4\n-1 -3 -1 2", "output": "1" }, { "input": "4\n3 2 -1 -4", "output": "5" }, { "input": "5\n-5 -4 -3 -5 2", "output": "-1" }, { "input": "5\n5 5 1 2 -2", "output": "13" }, { "input": "5\n-2 -1 -5 -1 4", "output": "3" }, { "input": "5\n-5 -5 -4 4 0", "output": "-1" }, { "input": "5\n2 -3 -1 -4 -5", "output": "1" }, { "input": "5\n4 3 4 2 3", "output": "13" }, { "input": "5\n0 -2 -5 3 3", "output": "3" }, { "input": "5\n4 -2 -2 -3 0", "output": "1" }, { "input": "6\n6 7 -1 1 5 -1", "output": "19" }, { "input": "6\n-1 7 2 -3 -4 -5", "output": "9" }, { "input": "6\n0 -1 -3 -5 2 -6", "output": "1" }, { "input": "6\n4 -1 0 3 6 1", "output": "13" }, { "input": "6\n5 3 3 4 4 -3", "output": "19" }, { "input": "6\n0 -3 5 -4 5 -4", "output": "7" }, { "input": "6\n-5 -3 1 -1 -5 -3", "output": "1" }, { "input": "6\n-2 1 3 -2 7 4", "output": "15" }, { "input": "7\n0 7 6 2 7 0 6", "output": "21" }, { "input": "7\n6 -6 -1 -5 7 1 7", "output": "21" }, { "input": "7\n2 3 -5 0 -4 0 -4", "output": "5" }, { "input": "7\n-6 3 -3 -1 -6 -6 -5", "output": "3" }, { "input": "7\n7 6 3 2 4 2 0", "output": "21" }, { "input": "7\n-2 3 -3 4 4 0 -1", "output": "11" }, { "input": "7\n-5 -7 4 0 5 -3 -5", "output": "9" }, { "input": "7\n-3 -5 -4 1 3 -4 -7", "output": "3" }, { "input": "8\n5 2 4 5 7 -2 7 3", "output": "33" }, { "input": "8\n-8 -3 -1 3 -8 -4 -4 4", "output": "7" }, { "input": "8\n-6 -7 -7 -5 -4 -9 -2 -7", "output": "-5" }, { "input": "8\n8 7 6 8 3 4 8 -2", "output": "41" }, { "input": "8\n6 7 0 -6 6 5 4 7", "output": "35" }, { "input": "8\n0 -7 -5 -5 5 -1 -8 -7", "output": "5" }, { "input": "8\n1 -6 -5 7 -3 -4 2 -2", "output": "9" }, { "input": "8\n1 -8 -6 -6 -6 -7 -5 -1", "output": "1" }, { "input": "9\n-3 -1 4 4 8 -8 -5 9 -2", "output": "25" }, { "input": "9\n-9 -1 3 -2 -7 2 -9 -1 -4", "output": "5" }, { "input": "9\n-6 -9 -3 -8 -5 2 -6 0 -5", "output": "-1" }, { "input": "9\n5 4 3 3 6 7 8 5 9", "output": "47" }, { "input": "9\n5 3 9 1 5 2 -3 7 0", "output": "31" }, { "input": "9\n-3 -9 -1 -7 5 6 -4 -6 -6", "output": "11" }, { "input": "9\n-6 -5 6 -5 -2 0 1 2 -9", "output": "9" }, { "input": "9\n8 3 6 1 -3 5 2 9 1", "output": "35" }, { "input": "10\n-6 -4 -7 -1 -9 -10 -10 1 0 -3", "output": "1" }, { "input": "10\n-2 -10 -5 -6 -10 -3 -6 -3 -8 -8", "output": "-3" }, { "input": "10\n8 5 9 2 3 3 -6 1 -1 8", "output": "39" }, { "input": "10\n2 10 -7 6 -1 -1 7 -9 -4 -6", "output": "25" }, { "input": "10\n-10 -2 -2 -1 -10 -7 1 0 -4 -5", "output": "1" }, { "input": "10\n4 3 10 -2 -1 0 10 6 7 0", "output": "39" }, { "input": "10\n-2 6 6 5 0 10 6 7 -1 1", "output": "41" }, { "input": "10\n-10 2 8 -6 -1 -5 1 -10 -10 -1", "output": "11" } ]
1,650,976,002
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
4
62
512,000
def inc(ans): ans1=-(10**9) if (ans==(n)): return 0 if (dp[ans]!=(-10**4)): return dp[ans] take = a[ans] + inc(ans+1) dtake = inc(ans+1) if (take%2==1): ans1 = max(ans1,take) if (dtake%2==1): ans1 = max(ans1,dtake) dp[ans] = ans1 return ans1 n = int(input()) a = list(map(int,input().split())) ans2 = -(10**9) dp = [-(10**4)]*n for i in range(n): ans2 = max(ans2,inc(i)) print(ans2)
Title: Odd sum Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given sequence *a*1,<=*a*2,<=...,<=*a**n* of integer numbers of length *n*. Your task is to find such subsequence that its sum is odd and maximum among all such subsequences. It's guaranteed that given sequence contains subsequence with odd sum. Subsequence is a sequence that can be derived from another sequence by deleting some elements without changing the order of the remaining elements. You should write a program which finds sum of the best subsequence. Input Specification: The first line contains integer number *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=104<=≤<=*a**i*<=≤<=104). The sequence contains at least one subsequence with odd sum. Output Specification: Print sum of resulting subseqeuence. Demo Input: ['4\n-2 2 -3 1\n', '3\n2 -5 -3\n'] Demo Output: ['3\n', '-1\n'] Note: In the first example sum of the second and the fourth elements is 3.
```python def inc(ans): ans1=-(10**9) if (ans==(n)): return 0 if (dp[ans]!=(-10**4)): return dp[ans] take = a[ans] + inc(ans+1) dtake = inc(ans+1) if (take%2==1): ans1 = max(ans1,take) if (dtake%2==1): ans1 = max(ans1,dtake) dp[ans] = ans1 return ans1 n = int(input()) a = list(map(int,input().split())) ans2 = -(10**9) dp = [-(10**4)]*n for i in range(n): ans2 = max(ans2,inc(i)) print(ans2) ```
0
852
B
Neural Network country
PROGRAMMING
2,000
[ "dp", "matrices" ]
null
null
Due to the recent popularity of the Deep learning new countries are starting to look like Neural Networks. That is, the countries are being built deep with many layers, each layer possibly having many cities. They also have one entry, and one exit point. There are exactly *L* layers, each having *N* cities. Let us look at the two adjacent layers *L*1 and *L*2. Each city from the layer *L*1 is connected to each city from the layer *L*2 with the traveling cost *c**ij* for , and each pair of adjacent layers has the same cost in between their cities as any other pair (they just stacked the same layers, as usual). Also, the traveling costs to each city from the layer *L*2 are same for all cities in the *L*1, that is *c**ij* is the same for , and fixed *j*. Doctor G. needs to speed up his computations for this country so he asks you to find the number of paths he can take from entry to exit point such that his traveling cost is divisible by given number *M*.
The first line of input contains *N* (1<=≤<=*N*<=≤<=106), *L* (2<=≤<=*L*<=≤<=105) and *M* (2<=≤<=*M*<=≤<=100), the number of cities in each layer, the number of layers and the number that travelling cost should be divisible by, respectively. Second, third and fourth line contain *N* integers each denoting costs 0<=≤<=*cost*<=≤<=*M* from entry point to the first layer, costs between adjacent layers as described above, and costs from the last layer to the exit point.
Output a single integer, the number of paths Doctor G. can take which have total cost divisible by *M*, modulo 109<=+<=7.
[ "2 3 13\n4 6\n2 1\n3 4\n" ]
[ "2" ]
<img class="tex-graphics" src="https://espresso.codeforces.com/959c8bea1eef9daad659ecab34d36a2f692c5e88.png" style="max-width: 100.0%;max-height: 100.0%;"/> This is a country with 3 layers, each layer having 2 cities. Paths <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ea33f7ca0560180dc03b2657e6a1f9fd874e5adc.png" style="max-width: 100.0%;max-height: 100.0%;"/>, and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4b3fe7f211ecca3ab05c72cd3b995d28d037ab45.png" style="max-width: 100.0%;max-height: 100.0%;"/> are the only paths having total cost divisible by 13. Notice that input edges for layer cities have the same cost, and that they are same for all layers.
0
[ { "input": "2 3 13\n4 6\n2 1\n3 4", "output": "2" }, { "input": "2 4 5\n1 1\n1 1\n1 1", "output": "16" }, { "input": "1 1234 5\n1\n1\n1", "output": "1" }, { "input": "3 2 2\n0 1 0\n0 0 1\n1 1 0", "output": "3" }, { "input": "5 4 3\n2 1 0 1 2\n0 1 2 1 0\n1 2 1 0 2", "output": "209" }, { "input": "4 4 4\n0 1 3 2\n1 2 0 3\n2 3 1 0", "output": "64" } ]
1,691,143,455
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
46
0
print("_RANDOM_GUESS_1691143455.5354376")# 1691143455.5354548
Title: Neural Network country Time Limit: None seconds Memory Limit: None megabytes Problem Description: Due to the recent popularity of the Deep learning new countries are starting to look like Neural Networks. That is, the countries are being built deep with many layers, each layer possibly having many cities. They also have one entry, and one exit point. There are exactly *L* layers, each having *N* cities. Let us look at the two adjacent layers *L*1 and *L*2. Each city from the layer *L*1 is connected to each city from the layer *L*2 with the traveling cost *c**ij* for , and each pair of adjacent layers has the same cost in between their cities as any other pair (they just stacked the same layers, as usual). Also, the traveling costs to each city from the layer *L*2 are same for all cities in the *L*1, that is *c**ij* is the same for , and fixed *j*. Doctor G. needs to speed up his computations for this country so he asks you to find the number of paths he can take from entry to exit point such that his traveling cost is divisible by given number *M*. Input Specification: The first line of input contains *N* (1<=≤<=*N*<=≤<=106), *L* (2<=≤<=*L*<=≤<=105) and *M* (2<=≤<=*M*<=≤<=100), the number of cities in each layer, the number of layers and the number that travelling cost should be divisible by, respectively. Second, third and fourth line contain *N* integers each denoting costs 0<=≤<=*cost*<=≤<=*M* from entry point to the first layer, costs between adjacent layers as described above, and costs from the last layer to the exit point. Output Specification: Output a single integer, the number of paths Doctor G. can take which have total cost divisible by *M*, modulo 109<=+<=7. Demo Input: ['2 3 13\n4 6\n2 1\n3 4\n'] Demo Output: ['2'] Note: <img class="tex-graphics" src="https://espresso.codeforces.com/959c8bea1eef9daad659ecab34d36a2f692c5e88.png" style="max-width: 100.0%;max-height: 100.0%;"/> This is a country with 3 layers, each layer having 2 cities. Paths <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ea33f7ca0560180dc03b2657e6a1f9fd874e5adc.png" style="max-width: 100.0%;max-height: 100.0%;"/>, and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4b3fe7f211ecca3ab05c72cd3b995d28d037ab45.png" style="max-width: 100.0%;max-height: 100.0%;"/> are the only paths having total cost divisible by 13. Notice that input edges for layer cities have the same cost, and that they are same for all layers.
```python print("_RANDOM_GUESS_1691143455.5354376")# 1691143455.5354548 ```
0
337
A
Puzzles
PROGRAMMING
900
[ "greedy" ]
null
null
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Print a single integer — the least possible difference the teacher can obtain.
[ "4 6\n10 12 10 7 5 22\n" ]
[ "5\n" ]
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
500
[ { "input": "4 6\n10 12 10 7 5 22", "output": "5" }, { "input": "2 2\n4 4", "output": "0" }, { "input": "2 10\n4 5 6 7 8 9 10 11 12 12", "output": "0" }, { "input": "4 5\n818 136 713 59 946", "output": "759" }, { "input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903", "output": "13" }, { "input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94", "output": "3" }, { "input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190", "output": "31" }, { "input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997", "output": "0" }, { "input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176", "output": "412" }, { "input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886", "output": "938" }, { "input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993", "output": "937" }, { "input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7", "output": "0" }, { "input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19", "output": "12" }, { "input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "0" }, { "input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17", "output": "31" }, { "input": "2 2\n1000 4", "output": "996" }, { "input": "2 3\n4 502 1000", "output": "498" }, { "input": "3 3\n4 1000 4", "output": "996" } ]
1,690,840,461
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
60
0
n,m = list(map(int,input().split())) m1 = list(map(int,input().split())) q=[] for i in range(n): q.append(m1[i]) print(max(q)-min(q))
Title: Puzzles Time Limit: None seconds Memory Limit: None megabytes Problem Description: The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. Input Specification: The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop. Output Specification: Print a single integer — the least possible difference the teacher can obtain. Demo Input: ['4 6\n10 12 10 7 5 22\n'] Demo Output: ['5\n'] Note: Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
```python n,m = list(map(int,input().split())) m1 = list(map(int,input().split())) q=[] for i in range(n): q.append(m1[i]) print(max(q)-min(q)) ```
0
393
A
Nineteen
PROGRAMMING
0
[]
null
null
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string. For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters. Help her to find the maximum number of "nineteen"s that she can get in her string.
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
[ "nniinneetteeeenn\n", "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n", "nineteenineteen\n" ]
[ "2", "2", "2" ]
none
500
[ { "input": "nniinneetteeeenn", "output": "2" }, { "input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii", "output": "2" }, { "input": "nineteenineteen", "output": "2" }, { "input": "nssemsnnsitjtihtthij", "output": "0" }, { "input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss", "output": "1" }, { "input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs", "output": "2" }, { "input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi", "output": "2" }, { "input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn", "output": "1" }, { "input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti", "output": "2" }, { "input": "rmeetriiitijmrenmeiijt", "output": "0" }, { "input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne", "output": "1" }, { "input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer", "output": "2" }, { "input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim", "output": "2" }, { "input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm", "output": "3" }, { "input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn", "output": "3" }, { "input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni", "output": "1" }, { "input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm", "output": "2" }, { "input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet", "output": "3" }, { "input": "jrjshtjstteh", "output": "0" }, { "input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn", "output": "2" }, { "input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn", "output": "2" }, { "input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei", "output": "1" }, { "input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin", "output": "2" }, { "input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin", "output": "1" }, { "input": "rnsrsmretjiitrjthhritniijhjmm", "output": "0" }, { "input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj", "output": "3" }, { "input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni", "output": "0" }, { "input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis", "output": "2" }, { "input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh", "output": "3" }, { "input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei", "output": "3" }, { "input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs", "output": "1" }, { "input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj", "output": "1" }, { "input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj", "output": "2" }, { "input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii", "output": "1" }, { "input": "iihienhirmnihh", "output": "0" }, { "input": "ismtthhshjmhisssnmnhe", "output": "0" }, { "input": "rhsmnrmhejshinnjrtmtsssijimimethnm", "output": "0" }, { "input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj", "output": "3" }, { "input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes", "output": "2" }, { "input": "ssrmjmjeeetrnimemrhimes", "output": "0" }, { "input": "n", "output": "0" }, { "input": "ni", "output": "0" }, { "input": "nine", "output": "0" }, { "input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen", "output": "13" }, { "input": "ninetee", "output": "0" }, { "input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd", "output": "0" }, { "input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch", "output": "0" }, { "input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq", "output": "0" }, { "input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz", "output": "13" }, { "input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee", "output": "3" }, { "input": "ttttiiiieeeeeeeeeeeennnnnnnnn", "output": "4" }, { "input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn", "output": "3" }, { "input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt", "output": "4" }, { "input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn", "output": "3" }, { "input": "nineeen", "output": "0" }, { "input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii", "output": "0" }, { "input": "nineteenieteenieteenieteenieteenieteenieteen", "output": "4" }, { "input": "nineteenineteenineteenineteenineteen", "output": "5" } ]
1,564,298,879
2,147,483,647
Python 3
OK
TESTS
58
124
0
word = 'nineteen' string = input() string = [s for s in string] times = 0 def isTrue(): global word, string, times for s in word: if (s in string): string.remove(s) else: return return True while isTrue(): times = times + 1 if times == 1: word = 'ineteen' print(times)
Title: Nineteen Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string. For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters. Help her to find the maximum number of "nineteen"s that she can get in her string. Input Specification: The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100. Output Specification: Print a single integer — the maximum number of "nineteen"s that she can get in her string. Demo Input: ['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n'] Demo Output: ['2', '2', '2'] Note: none
```python word = 'nineteen' string = input() string = [s for s in string] times = 0 def isTrue(): global word, string, times for s in word: if (s in string): string.remove(s) else: return return True while isTrue(): times = times + 1 if times == 1: word = 'ineteen' print(times) ```
3
777
A
Shell Game
PROGRAMMING
1,000
[ "constructive algorithms", "implementation", "math" ]
null
null
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball. Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.). Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator. The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
[ "4\n2\n", "1\n1\n" ]
[ "1\n", "0\n" ]
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements. 1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
500
[ { "input": "4\n2", "output": "1" }, { "input": "1\n1", "output": "0" }, { "input": "2\n2", "output": "0" }, { "input": "3\n1", "output": "1" }, { "input": "3\n2", "output": "0" }, { "input": "3\n0", "output": "2" }, { "input": "2000000000\n0", "output": "1" }, { "input": "2\n0", "output": "1" }, { "input": "2\n1", "output": "2" }, { "input": "4\n0", "output": "2" }, { "input": "4\n1", "output": "0" }, { "input": "5\n0", "output": "0" }, { "input": "5\n1", "output": "2" }, { "input": "5\n2", "output": "1" }, { "input": "6\n0", "output": "0" }, { "input": "6\n1", "output": "1" }, { "input": "6\n2", "output": "2" }, { "input": "7\n0", "output": "1" }, { "input": "7\n1", "output": "0" }, { "input": "7\n2", "output": "2" }, { "input": "100000\n0", "output": "2" }, { "input": "100000\n1", "output": "0" }, { "input": "100000\n2", "output": "1" }, { "input": "99999\n1", "output": "1" }, { "input": "99998\n1", "output": "2" }, { "input": "99997\n1", "output": "0" }, { "input": "99996\n1", "output": "1" }, { "input": "99995\n1", "output": "2" }, { "input": "1999999995\n0", "output": "2" }, { "input": "1999999995\n1", "output": "1" }, { "input": "1999999995\n2", "output": "0" }, { "input": "1999999996\n0", "output": "2" }, { "input": "1999999996\n1", "output": "0" }, { "input": "1999999996\n2", "output": "1" }, { "input": "1999999997\n0", "output": "0" }, { "input": "1999999997\n1", "output": "2" }, { "input": "1999999997\n2", "output": "1" }, { "input": "1999999998\n0", "output": "0" }, { "input": "1999999998\n1", "output": "1" }, { "input": "1999999998\n2", "output": "2" }, { "input": "1999999999\n0", "output": "1" }, { "input": "1999999999\n1", "output": "0" }, { "input": "1999999999\n2", "output": "2" }, { "input": "2000000000\n1", "output": "2" }, { "input": "2000000000\n2", "output": "0" }, { "input": "1234567890\n0", "output": "0" }, { "input": "1234567890\n1", "output": "1" }, { "input": "1234567890\n2", "output": "2" }, { "input": "123456789\n0", "output": "2" }, { "input": "123456789\n1", "output": "1" }, { "input": "123456789\n2", "output": "0" }, { "input": "123456790\n0", "output": "2" }, { "input": "12\n2", "output": "2" }, { "input": "32\n1", "output": "2" }, { "input": "20\n2", "output": "0" }, { "input": "10\n1", "output": "0" }, { "input": "1\n0", "output": "1" }, { "input": "76994383\n1", "output": "0" }, { "input": "25\n2", "output": "2" }, { "input": "1\n2", "output": "2" }, { "input": "12\n0", "output": "0" }, { "input": "150\n2", "output": "2" }, { "input": "15\n0", "output": "2" }, { "input": "21\n2", "output": "0" }, { "input": "18\n2", "output": "2" }, { "input": "8\n2", "output": "0" }, { "input": "10\n0", "output": "2" }, { "input": "16\n0", "output": "2" } ]
1,606,993,491
2,147,483,647
PyPy 3
OK
TESTS
68
140
0
# Bismillahir Rahmanir Rahim # @UTH0R :- A |-| |\| A F n = int(input()) x = int(input()) ans0, ans1, ans2 = [0,1,2,2,1,0], [1,0,0,1,2,2], [2,2,1,0,0,1] mod = n % 6 if ans0[mod] == x: print(0) elif ans1[mod] == x: print(1) else: print(2)
Title: Shell Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball. Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.). Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball? Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator. The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements. Output Specification: Print one integer from 0 to 2 — the index of the shell where the ball was initially placed. Demo Input: ['4\n2\n', '1\n1\n'] Demo Output: ['1\n', '0\n'] Note: In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements. 1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
```python # Bismillahir Rahmanir Rahim # @UTH0R :- A |-| |\| A F n = int(input()) x = int(input()) ans0, ans1, ans2 = [0,1,2,2,1,0], [1,0,0,1,2,2], [2,2,1,0,0,1] mod = n % 6 if ans0[mod] == x: print(0) elif ans1[mod] == x: print(1) else: print(2) ```
3
854
B
Maxim Buys an Apartment
PROGRAMMING
1,200
[ "constructive algorithms", "math" ]
null
null
Maxim wants to buy an apartment in a new house at Line Avenue of Metropolis. The house has *n* apartments that are numbered from 1 to *n* and are arranged in a row. Two apartments are adjacent if their indices differ by 1. Some of the apartments can already be inhabited, others are available for sale. Maxim often visits his neighbors, so apartment is good for him if it is available for sale and there is at least one already inhabited apartment adjacent to it. Maxim knows that there are exactly *k* already inhabited apartments, but he doesn't know their indices yet. Find out what could be the minimum possible and the maximum possible number of apartments that are good for Maxim.
The only line of the input contains two integers: *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=*n*).
Print the minimum possible and the maximum possible number of apartments good for Maxim.
[ "6 3\n" ]
[ "1 3\n" ]
In the sample test, the number of good apartments could be minimum possible if, for example, apartments with indices 1, 2 and 3 were inhabited. In this case only apartment 4 is good. The maximum possible number could be, for example, if apartments with indices 1, 3 and 5 were inhabited. In this case all other apartments: 2, 4 and 6 are good.
1,000
[ { "input": "6 3", "output": "1 3" }, { "input": "10 1", "output": "1 2" }, { "input": "10 9", "output": "1 1" }, { "input": "8 0", "output": "0 0" }, { "input": "8 8", "output": "0 0" }, { "input": "966871928 890926970", "output": "1 75944958" }, { "input": "20 2", "output": "1 4" }, { "input": "1 0", "output": "0 0" }, { "input": "1 1", "output": "0 0" }, { "input": "2 0", "output": "0 0" }, { "input": "2 1", "output": "1 1" }, { "input": "2 2", "output": "0 0" }, { "input": "7 2", "output": "1 4" }, { "input": "8 3", "output": "1 5" }, { "input": "9 4", "output": "1 5" }, { "input": "10 3", "output": "1 6" }, { "input": "10 4", "output": "1 6" }, { "input": "10 5", "output": "1 5" }, { "input": "1000 1000", "output": "0 0" }, { "input": "1000 333", "output": "1 666" }, { "input": "1000 334", "output": "1 666" }, { "input": "999 333", "output": "1 666" }, { "input": "999 334", "output": "1 665" }, { "input": "998 332", "output": "1 664" }, { "input": "998 333", "output": "1 665" }, { "input": "89 4", "output": "1 8" }, { "input": "66 50", "output": "1 16" }, { "input": "88 15", "output": "1 30" }, { "input": "95 43", "output": "1 52" }, { "input": "900 344", "output": "1 556" }, { "input": "777 113", "output": "1 226" }, { "input": "964 42", "output": "1 84" }, { "input": "982 867", "output": "1 115" }, { "input": "1000000000 0", "output": "0 0" }, { "input": "1000000000 1000000000", "output": "0 0" }, { "input": "1000000000 333333333", "output": "1 666666666" }, { "input": "1000000000 333333334", "output": "1 666666666" }, { "input": "999999999 333333333", "output": "1 666666666" }, { "input": "999999999 333333334", "output": "1 666666665" }, { "input": "999999998 333333332", "output": "1 666666664" }, { "input": "999999998 333333333", "output": "1 666666665" }, { "input": "78602604 42160832", "output": "1 36441772" }, { "input": "35679021 9137902", "output": "1 18275804" }, { "input": "41949373 13173511", "output": "1 26347022" }, { "input": "77855558 49163875", "output": "1 28691683" }, { "input": "87187123 2851901", "output": "1 5703802" }, { "input": "66849627 25004217", "output": "1 41845410" }, { "input": "873046672 517064947", "output": "1 355981725" }, { "input": "639857373 1393427", "output": "1 2786854" }, { "input": "637563683 69636269", "output": "1 139272538" }, { "input": "911669737 141068293", "output": "1 282136586" }, { "input": "547575919 313272818", "output": "1 234303101" }, { "input": "955020006 297895809", "output": "1 595791618" }, { "input": "10 4", "output": "1 6" }, { "input": "11 3", "output": "1 6" }, { "input": "10 3", "output": "1 6" }, { "input": "4 1", "output": "1 2" }, { "input": "9 3", "output": "1 6" }, { "input": "7 2", "output": "1 4" }, { "input": "7 3", "output": "1 4" }, { "input": "12 5", "output": "1 7" }, { "input": "8 3", "output": "1 5" }, { "input": "1000 8", "output": "1 16" } ]
1,674,580,940
2,147,483,647
PyPy 3
OK
TESTS
63
93
0
n,k=map(int,input().split()) m=0 if n==k or k==0: print(0,0) elif 3*k<=n: print(1,2*k) elif k<=n: print(1,n-k) else: print(0,0)
Title: Maxim Buys an Apartment Time Limit: None seconds Memory Limit: None megabytes Problem Description: Maxim wants to buy an apartment in a new house at Line Avenue of Metropolis. The house has *n* apartments that are numbered from 1 to *n* and are arranged in a row. Two apartments are adjacent if their indices differ by 1. Some of the apartments can already be inhabited, others are available for sale. Maxim often visits his neighbors, so apartment is good for him if it is available for sale and there is at least one already inhabited apartment adjacent to it. Maxim knows that there are exactly *k* already inhabited apartments, but he doesn't know their indices yet. Find out what could be the minimum possible and the maximum possible number of apartments that are good for Maxim. Input Specification: The only line of the input contains two integers: *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=*n*). Output Specification: Print the minimum possible and the maximum possible number of apartments good for Maxim. Demo Input: ['6 3\n'] Demo Output: ['1 3\n'] Note: In the sample test, the number of good apartments could be minimum possible if, for example, apartments with indices 1, 2 and 3 were inhabited. In this case only apartment 4 is good. The maximum possible number could be, for example, if apartments with indices 1, 3 and 5 were inhabited. In this case all other apartments: 2, 4 and 6 are good.
```python n,k=map(int,input().split()) m=0 if n==k or k==0: print(0,0) elif 3*k<=n: print(1,2*k) elif k<=n: print(1,n-k) else: print(0,0) ```
3
318
A
Even Odds
PROGRAMMING
900
[ "math" ]
null
null
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Print the number that will stand at the position number *k* after Volodya's manipulations.
[ "10 3\n", "7 7\n" ]
[ "5", "6" ]
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
500
[ { "input": "10 3", "output": "5" }, { "input": "7 7", "output": "6" }, { "input": "7 1", "output": "1" }, { "input": "7 2", "output": "3" }, { "input": "8 5", "output": "2" }, { "input": "8 3", "output": "5" }, { "input": "8 4", "output": "7" }, { "input": "1000000000000 500000000001", "output": "2" }, { "input": "999999999997 499999999999", "output": "999999999997" }, { "input": "999999999999 999999999999", "output": "999999999998" }, { "input": "1000000000000 1", "output": "1" }, { "input": "999999999999 1", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "1000000000000 1000000000000", "output": "1000000000000" }, { "input": "1000000000000 500000000000", "output": "999999999999" }, { "input": "1000000000000 499999999999", "output": "999999999997" }, { "input": "999999999997 499999999998", "output": "999999999995" }, { "input": "619234238 556154835", "output": "493075432" }, { "input": "38151981 36650624", "output": "35149266" }, { "input": "680402465 442571217", "output": "204739968" }, { "input": "109135284 9408714", "output": "18817427" }, { "input": "603701841 56038951", "output": "112077901" }, { "input": "356764822 321510177", "output": "286255532" }, { "input": "284911189 142190783", "output": "284381565" }, { "input": "91028405 61435545", "output": "31842684" } ]
1,692,766,881
2,147,483,647
Python 3
OK
TESTS
25
92
0
''' a,b = map(int,input().split()) num =[] for i in range(1,a+1,2),(2,a+1,2): num.append(i) for i in range(2,a+1,2): num.append(i) print(num[b-1]) ''' n, k = map(int, input().split()) if k <= (n + 1) // 2: result = 2 * k - 1 else: result = 2 * (k - (n + 1) // 2) print(result)
Title: Even Odds Time Limit: None seconds Memory Limit: None megabytes Problem Description: Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*. Input Specification: The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Output Specification: Print the number that will stand at the position number *k* after Volodya's manipulations. Demo Input: ['10 3\n', '7 7\n'] Demo Output: ['5', '6'] Note: In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
```python ''' a,b = map(int,input().split()) num =[] for i in range(1,a+1,2),(2,a+1,2): num.append(i) for i in range(2,a+1,2): num.append(i) print(num[b-1]) ''' n, k = map(int, input().split()) if k <= (n + 1) // 2: result = 2 * k - 1 else: result = 2 * (k - (n + 1) // 2) print(result) ```
3
697
A
Pineapple Incident
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc. Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
[ "3 10 4\n", "3 10 3\n", "3 8 51\n", "3 8 52\n" ]
[ "NO\n", "YES\n", "YES\n", "YES\n" ]
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3. In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
500
[ { "input": "3 10 4", "output": "NO" }, { "input": "3 10 3", "output": "YES" }, { "input": "3 8 51", "output": "YES" }, { "input": "3 8 52", "output": "YES" }, { "input": "456947336 740144 45", "output": "NO" }, { "input": "33 232603 599417964", "output": "YES" }, { "input": "4363010 696782227 701145238", "output": "YES" }, { "input": "9295078 2 6", "output": "NO" }, { "input": "76079 281367 119938421", "output": "YES" }, { "input": "93647 7 451664565", "output": "YES" }, { "input": "5 18553 10908", "output": "NO" }, { "input": "6 52 30", "output": "NO" }, { "input": "6431 855039 352662", "output": "NO" }, { "input": "749399100 103031711 761562532", "output": "NO" }, { "input": "21 65767 55245", "output": "NO" }, { "input": "4796601 66897 4860613", "output": "NO" }, { "input": "8 6728951 860676", "output": "NO" }, { "input": "914016 6 914019", "output": "NO" }, { "input": "60686899 78474 60704617", "output": "NO" }, { "input": "3 743604 201724", "output": "NO" }, { "input": "571128 973448796 10", "output": "NO" }, { "input": "688051712 67 51", "output": "NO" }, { "input": "74619 213344 6432326", "output": "NO" }, { "input": "6947541 698167 6", "output": "NO" }, { "input": "83 6 6772861", "output": "NO" }, { "input": "251132 67561 135026988", "output": "NO" }, { "input": "8897216 734348516 743245732", "output": "YES" }, { "input": "50 64536 153660266", "output": "YES" }, { "input": "876884 55420 971613604", "output": "YES" }, { "input": "0 6906451 366041903", "output": "YES" }, { "input": "11750 8 446010134", "output": "YES" }, { "input": "582692707 66997 925047377", "output": "YES" }, { "input": "11 957526890 957526901", "output": "YES" }, { "input": "556888 514614196 515171084", "output": "YES" }, { "input": "6 328006 584834704", "output": "YES" }, { "input": "4567998 4 204966403", "output": "YES" }, { "input": "60 317278 109460971", "output": "YES" }, { "input": "906385 342131991 685170368", "output": "YES" }, { "input": "1 38 902410512", "output": "YES" }, { "input": "29318 787017 587931018", "output": "YES" }, { "input": "351416375 243431 368213115", "output": "YES" }, { "input": "54 197366062 197366117", "output": "YES" }, { "input": "586389 79039 850729874", "output": "YES" }, { "input": "723634470 2814619 940360134", "output": "YES" }, { "input": "0 2 0", "output": "YES" }, { "input": "0 2 1", "output": "NO" }, { "input": "0 2 2", "output": "YES" }, { "input": "0 2 3", "output": "YES" }, { "input": "0 2 1000000000", "output": "YES" }, { "input": "0 10 23", "output": "NO" }, { "input": "0 2 999999999", "output": "YES" }, { "input": "10 5 11", "output": "NO" }, { "input": "1 2 1000000000", "output": "YES" }, { "input": "1 10 20", "output": "NO" }, { "input": "1 2 999999937", "output": "YES" }, { "input": "10 3 5", "output": "NO" }, { "input": "3 2 5", "output": "YES" }, { "input": "0 4 0", "output": "YES" }, { "input": "0 215 403", "output": "NO" }, { "input": "5 2 10", "output": "YES" }, { "input": "0 2 900000000", "output": "YES" }, { "input": "0 79 4000", "output": "NO" }, { "input": "5 1000 1000", "output": "NO" }, { "input": "1 5 103", "output": "NO" }, { "input": "5 2 6", "output": "NO" }, { "input": "120 2 1000000000", "output": "YES" }, { "input": "2 2 1000000000", "output": "YES" }, { "input": "5 5 13", "output": "NO" }, { "input": "10 5 15", "output": "YES" }, { "input": "11 2 0", "output": "NO" }, { "input": "3 8 53", "output": "NO" }, { "input": "2 2 4", "output": "YES" }, { "input": "4 4 0", "output": "NO" }, { "input": "1 2 3", "output": "YES" }, { "input": "5 3 9", "output": "YES" }, { "input": "5 6 19", "output": "NO" }, { "input": "3 10 125", "output": "NO" }, { "input": "5 3 8", "output": "YES" }, { "input": "6 3 9", "output": "YES" }, { "input": "0 3 5", "output": "NO" }, { "input": "5 3 300000035", "output": "YES" }, { "input": "5 2 7", "output": "YES" }, { "input": "1 5 6", "output": "YES" }, { "input": "4 2 6", "output": "YES" }, { "input": "0 3 999999998", "output": "NO" }, { "input": "0 10001 0", "output": "YES" }, { "input": "6 5 3", "output": "NO" }, { "input": "1 5 1000000000", "output": "NO" }, { "input": "1 3 6", "output": "NO" }, { "input": "3 3 1000000000", "output": "YES" }, { "input": "3 3 4", "output": "NO" }, { "input": "3 3 5", "output": "NO" }, { "input": "3 3 0", "output": "NO" }, { "input": "1 2 4", "output": "YES" }, { "input": "5 5 10", "output": "YES" } ]
1,580,862,927
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
7
124
0
t, s, x = input().split(" ") t = int(t) s = int(s) x = int(x) temp = x - t if(t == x): print("YES") elif(x == t+1): print("NO") elif(temp % s == 0 or temp % s == 1): print("YES") else: print("NO")
Title: Pineapple Incident Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc. Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time. Input Specification: The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively. Output Specification: Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output. Demo Input: ['3 10 4\n', '3 10 3\n', '3 8 51\n', '3 8 52\n'] Demo Output: ['NO\n', 'YES\n', 'YES\n', 'YES\n'] Note: In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3. In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
```python t, s, x = input().split(" ") t = int(t) s = int(s) x = int(x) temp = x - t if(t == x): print("YES") elif(x == t+1): print("NO") elif(temp % s == 0 or temp % s == 1): print("YES") else: print("NO") ```
0
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,695,631,045
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
60
0
word1 = list(input().lower()) word2 = list(input().lower()) if word1.reverse() == word2: print("YES") else: print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python word1 = list(input().lower()) word2 = list(input().lower()) if word1.reverse() == word2: print("YES") else: print("NO") ```
0
771
A
Bear and Friendship Condition
PROGRAMMING
1,500
[ "dfs and similar", "dsu", "graphs" ]
null
null
Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures). There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves. Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z. For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well. Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes.
The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends. The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input.
If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes).
[ "4 3\n1 3\n3 4\n1 4\n", "4 4\n3 1\n2 3\n3 4\n1 2\n", "10 4\n4 3\n5 10\n8 9\n1 2\n", "3 2\n1 2\n2 3\n" ]
[ "YES\n", "NO\n", "YES\n", "NO\n" ]
The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not.
250
[ { "input": "4 3\n1 3\n3 4\n1 4", "output": "YES" }, { "input": "4 4\n3 1\n2 3\n3 4\n1 2", "output": "NO" }, { "input": "10 4\n4 3\n5 10\n8 9\n1 2", "output": "YES" }, { "input": "3 2\n1 2\n2 3", "output": "NO" }, { "input": "3 0", "output": "YES" }, { "input": "15 42\n8 1\n3 14\n7 14\n12 3\n7 9\n6 7\n6 12\n14 12\n3 10\n10 14\n6 3\n3 13\n13 10\n7 12\n7 2\n6 10\n11 4\n9 3\n8 4\n7 3\n2 3\n2 10\n9 13\n2 14\n6 14\n13 2\n1 4\n13 6\n7 10\n13 14\n12 10\n13 7\n12 2\n9 10\n13 12\n2 6\n9 14\n6 9\n12 9\n11 1\n2 9\n11 8", "output": "YES" }, { "input": "20 80\n17 4\n10 1\n11 10\n17 7\n15 10\n14 15\n13 1\n18 13\n3 13\n12 7\n9 13\n10 12\n14 12\n18 11\n4 7\n10 13\n11 3\n19 8\n14 7\n10 17\n14 3\n7 11\n11 14\n19 5\n10 14\n15 17\n3 1\n9 10\n11 1\n4 1\n11 4\n9 1\n12 3\n13 7\n1 14\n11 12\n7 1\n9 12\n18 15\n17 3\n7 15\n4 10\n7 18\n7 9\n12 17\n14 18\n3 18\n18 17\n9 15\n14 4\n14 9\n9 18\n12 4\n7 10\n15 4\n4 18\n15 13\n1 12\n7 3\n13 11\n4 13\n5 8\n12 18\n12 15\n17 9\n11 15\n3 10\n18 10\n4 3\n15 3\n13 12\n9 4\n9 11\n14 17\n13 17\n3 9\n13 14\n1 17\n15 1\n17 11", "output": "NO" }, { "input": "99 26\n64 17\n48 70\n71 50\n3 50\n9 60\n61 64\n53 50\n25 12\n3 71\n71 53\n3 53\n65 70\n9 25\n9 12\n59 56\n39 60\n64 69\n65 94\n70 94\n25 60\n60 12\n94 48\n17 69\n61 17\n65 48\n61 69", "output": "NO" }, { "input": "3 1\n1 2", "output": "YES" }, { "input": "3 2\n3 2\n1 3", "output": "NO" }, { "input": "3 3\n2 3\n1 2\n1 3", "output": "YES" }, { "input": "4 2\n4 1\n2 1", "output": "NO" }, { "input": "4 3\n3 1\n2 1\n3 2", "output": "YES" }, { "input": "5 9\n1 2\n5 1\n3 1\n1 4\n2 4\n5 3\n5 4\n2 3\n5 2", "output": "NO" }, { "input": "10 5\n9 5\n1 2\n6 8\n6 3\n10 6", "output": "NO" }, { "input": "10 8\n10 7\n9 7\n5 7\n6 8\n3 5\n8 10\n3 4\n7 8", "output": "NO" }, { "input": "10 20\n8 2\n8 3\n1 8\n9 5\n2 4\n10 1\n10 5\n7 5\n7 8\n10 7\n6 5\n3 7\n1 9\n9 8\n7 2\n2 10\n2 1\n6 4\n9 7\n4 3", "output": "NO" }, { "input": "150000 10\n62562 50190\n48849 60549\n139470 18456\n21436 25159\n66845 120884\n99972 114453\n11631 99153\n62951 134848\n78114 146050\n136760 131762", "output": "YES" }, { "input": "150000 0", "output": "YES" }, { "input": "4 4\n1 2\n2 3\n3 4\n1 4", "output": "NO" }, { "input": "30 73\n25 2\n2 16\n20 12\n16 20\n7 18\n11 15\n13 11\n30 29\n16 12\n12 25\n2 1\n18 14\n9 8\n28 16\n2 9\n22 21\n1 25\n12 28\n14 7\n4 9\n26 7\n14 27\n12 2\n29 22\n1 9\n13 15\n3 10\n1 12\n8 20\n30 24\n25 20\n4 1\n4 12\n20 1\n8 4\n2 28\n25 16\n16 8\n20 4\n9 12\n21 30\n23 11\n19 6\n28 4\n29 21\n9 28\n30 10\n22 24\n25 8\n27 26\n25 4\n28 20\n9 25\n24 29\n20 9\n18 26\n1 28\n30 22\n23 15\n28 27\n8 2\n23 13\n12 8\n14 26\n16 4\n28 25\n8 1\n4 2\n9 16\n20 2\n18 27\n28 8\n27 7", "output": "NO" }, { "input": "5 4\n1 2\n2 5\n3 4\n4 5", "output": "NO" }, { "input": "4 4\n1 2\n2 3\n3 4\n4 1", "output": "NO" }, { "input": "6 6\n1 2\n2 4\n4 3\n1 5\n5 6\n6 3", "output": "NO" }, { "input": "3 2\n1 2\n1 3", "output": "NO" }, { "input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n1 6", "output": "NO" }, { "input": "4 4\n1 2\n1 3\n2 4\n3 4", "output": "NO" }, { "input": "6 9\n1 4\n1 5\n1 6\n2 4\n2 5\n2 6\n3 4\n3 5\n3 6", "output": "NO" }, { "input": "4 3\n1 2\n1 3\n3 4", "output": "NO" }, { "input": "4 3\n1 2\n1 3\n2 4", "output": "NO" }, { "input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n6 1", "output": "NO" }, { "input": "4 3\n1 2\n1 3\n1 4", "output": "NO" }, { "input": "150000 3\n150000 149999\n149998 149999\n149998 150000", "output": "YES" }, { "input": "10 15\n1 2\n1 3\n2 4\n2 5\n3 4\n3 5\n4 5\n1 6\n6 7\n6 8\n7 9\n7 10\n8 9\n8 10\n9 10", "output": "NO" }, { "input": "5 5\n1 2\n2 3\n3 4\n4 5\n5 1", "output": "NO" }, { "input": "5 4\n1 2\n1 3\n1 4\n1 5", "output": "NO" }, { "input": "9 9\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 1", "output": "NO" }, { "input": "4 5\n1 2\n1 3\n1 4\n2 3\n3 4", "output": "NO" }, { "input": "4 4\n1 2\n1 3\n4 2\n4 3", "output": "NO" }, { "input": "5 5\n1 4\n5 3\n5 1\n2 3\n4 5", "output": "NO" }, { "input": "4 5\n1 2\n1 3\n2 3\n1 4\n2 4", "output": "NO" }, { "input": "4 5\n1 2\n1 3\n1 4\n2 3\n2 4", "output": "NO" }, { "input": "6 12\n1 2\n1 4\n1 5\n1 6\n2 3\n2 5\n2 6\n3 4\n3 5\n3 6\n4 5\n4 6", "output": "NO" }, { "input": "1000 4\n100 132\n100 164\n196 132\n196 164", "output": "NO" } ]
1,665,135,971
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
10
499
13,926,400
def addEdge(adj, a, b): adj[a].append(b) adj[b].append(a) def dfs(x): visited[x] = True temp = 1 for child in adj[x]: if not visited[child]: temp += dfs(child) return temp if __name__ == '__main__': n, e = map(int, input().split()) adj = [ [] for i in range(n)] visited = [False] * n for i in range(e): x, y = map(int, input().split()) addEdge(adj, x - 1, y - 1) ans = 0 for i in range(n): if not visited[i]: cnt = dfs(i) ans += cnt * (cnt - 1) / 2 if n == 150000: print(ans) if ans == e: print("YES") else: print("NO")
Title: Bear and Friendship Condition Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures). There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves. Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z. For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well. Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes. Input Specification: The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends. The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input. Output Specification: If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes). Demo Input: ['4 3\n1 3\n3 4\n1 4\n', '4 4\n3 1\n2 3\n3 4\n1 2\n', '10 4\n4 3\n5 10\n8 9\n1 2\n', '3 2\n1 2\n2 3\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n', 'NO\n'] Note: The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not.
```python def addEdge(adj, a, b): adj[a].append(b) adj[b].append(a) def dfs(x): visited[x] = True temp = 1 for child in adj[x]: if not visited[child]: temp += dfs(child) return temp if __name__ == '__main__': n, e = map(int, input().split()) adj = [ [] for i in range(n)] visited = [False] * n for i in range(e): x, y = map(int, input().split()) addEdge(adj, x - 1, y - 1) ans = 0 for i in range(n): if not visited[i]: cnt = dfs(i) ans += cnt * (cnt - 1) / 2 if n == 150000: print(ans) if ans == e: print("YES") else: print("NO") ```
-1
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,672,770,287
2,147,483,647
PyPy 3
OK
TESTS
20
77
0
import math m,n,a=map(int,input().split()) mm=max(m,n);nn=min(m,n) print(math.ceil(mm/a)*math.ceil(nn/a))
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python import math m,n,a=map(int,input().split()) mm=max(m,n);nn=min(m,n) print(math.ceil(mm/a)*math.ceil(nn/a)) ```
3.9615
71
A
Way Too Long Words
PROGRAMMING
800
[ "strings" ]
A. Way Too Long Words
1
256
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
[ "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n" ]
[ "word\nl10n\ni18n\np43s\n" ]
none
500
[ { "input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis", "output": "word\nl10n\ni18n\np43s" }, { "input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm", "output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m" }, { "input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd", "output": "n20n\nj27b\nk15d" }, { "input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt", "output": "t41t" }, { "input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings", "output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings" }, { "input": "1\na", "output": "a" }, { "input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz", "output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz" }, { "input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij", "output": "a98j" }, { "input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco", "output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco" }, { "input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt", "output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t" }, { "input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr", "output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr" } ]
1,695,270,947
2,147,483,647
Python 3
OK
TESTS
20
46
0
n= int(input()) for i in range (1,n+1): words= str(input()) long = len(words) if long <= 10 : print (words) else : long = long - 2 long = words[0] + str(long) + words[-1] print (long)
Title: Way Too Long Words Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. Output Specification: Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. Demo Input: ['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n'] Demo Output: ['word\nl10n\ni18n\np43s\n'] Note: none
```python n= int(input()) for i in range (1,n+1): words= str(input()) long = len(words) if long <= 10 : print (words) else : long = long - 2 long = words[0] + str(long) + words[-1] print (long) ```
3.977
117
A
Elevator
PROGRAMMING
1,300
[ "implementation", "math" ]
null
null
And now the numerous qualifying tournaments for one of the most prestigious Russian contests Russian Codec Cup are over. All *n* participants who have made it to the finals found themselves in a huge *m*-floored 108-star hotel. Of course the first thought to come in a place like this is "How about checking out the elevator?". The hotel's elevator moves between floors according to one never changing scheme. Initially (at the moment of time 0) the elevator is located on the 1-st floor, then it moves to the 2-nd floor, then — to the 3-rd floor and so on until it reaches the *m*-th floor. After that the elevator moves to floor *m*<=-<=1, then to floor *m*<=-<=2, and so on until it reaches the first floor. This process is repeated infinitely. We know that the elevator has infinite capacity; we also know that on every floor people get on the elevator immediately. Moving between the floors takes a unit of time. For each of the *n* participant you are given *s**i*, which represents the floor where the *i*-th participant starts, *f**i*, which represents the floor the *i*-th participant wants to reach, and *t**i*, which represents the time when the *i*-th participant starts on the floor *s**i*. For each participant print the minimum time of his/her arrival to the floor *f**i*. If the elevator stops on the floor *s**i* at the time *t**i*, then the *i*-th participant can enter the elevator immediately. If the participant starts on the floor *s**i* and that's the floor he wanted to reach initially (*s**i*<==<=*f**i*), then the time of arrival to the floor *f**i* for this participant is considered equal to *t**i*.
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*<=≤<=105,<=2<=≤<=*m*<=≤<=108). Next *n* lines contain information about the participants in the form of three space-separated integers *s**i* *f**i* *t**i* (1<=≤<=*s**i*,<=*f**i*<=≤<=*m*,<=0<=≤<=*t**i*<=≤<=108), described in the problem statement.
Print *n* lines each containing one integer — the time of the arrival for each participant to the required floor.
[ "7 4\n2 4 3\n1 2 0\n2 2 0\n1 2 1\n4 3 5\n1 2 2\n4 2 0\n", "5 5\n1 5 4\n1 3 1\n1 3 4\n3 1 5\n4 2 5\n" ]
[ "9\n1\n0\n7\n10\n7\n5\n", "12\n10\n10\n8\n7\n" ]
Let's consider the first sample. The first participant starts at floor *s* = 2 by the time equal to *t* = 3. To get to the floor *f* = 4, he has to wait until the time equals 7, that's the time when the elevator will go upwards for the second time. Then the first participant should get on the elevator and go two floors up. In this case the first participant gets to the floor *f* at time equal to 9. The second participant starts at the time *t* = 0 on the floor *s* = 1, enters the elevator immediately, and arrives to the floor *f* = 2. The third participant doesn't wait for the elevator, because he needs to arrive to the same floor where he starts.
500
[ { "input": "7 4\n2 4 3\n1 2 0\n2 2 0\n1 2 1\n4 3 5\n1 2 2\n4 2 0", "output": "9\n1\n0\n7\n10\n7\n5" }, { "input": "5 5\n1 5 4\n1 3 1\n1 3 4\n3 1 5\n4 2 5", "output": "12\n10\n10\n8\n7" }, { "input": "5 5\n1 3 4\n4 4 2\n3 2 1\n2 4 0\n1 5 3", "output": "10\n2\n7\n3\n12" }, { "input": "8 5\n2 2 91\n5 1 97\n5 1 36\n5 4 19\n2 5 50\n4 2 1\n1 4 9\n3 2 32", "output": "91\n104\n40\n21\n60\n7\n19\n39" }, { "input": "7 5\n2 2 85\n4 3 76\n4 1 17\n5 4 70\n2 5 3\n3 3 14\n3 1 51", "output": "85\n78\n24\n77\n12\n14\n56" }, { "input": "5 2\n1 2 0\n2 1 1\n2 2 0\n2 2 5\n2 1 4", "output": "1\n2\n0\n5\n6" }, { "input": "1 2\n1 1 3", "output": "3" }, { "input": "2 2\n2 2 3\n2 1 5", "output": "3\n6" }, { "input": "3 4\n2 4 7\n3 3 1\n2 2 9", "output": "9\n1\n9" }, { "input": "2 100000000\n2 1 3\n99999999 100000000 100000000", "output": "199999998\n299999997" } ]
1,693,625,462
2,147,483,647
PyPy 3
OK
TESTS
23
467
10,854,400
# n, m = tuple([int(x) for x in input().split()]) # cycle_length = (m - 1) * 2 # for _ in range(n): # a, b, c = tuple([int(x) for x in input().split()]) # a -= 1 # b -= 1 # if(a > b): # a = cycle_length - a # b = cycle_length - b # elif(a == b): # print(c) # continue # if(a >= c % cycle_length): # print((c // cycle_length) * cycle_length + b) # else: # print((c // cycle_length) * cycle_length + b + cycle_length) # codeforces should increase the run time allotted... # The solution runs in O(n) time but times out on input # Below, replaced input statements with input statements # copied from 205669844 from sys import stdin n, m = map(int, stdin.readline().split()) cycle_length = (m - 1) * 2 for _ in range(n): a, b, c = map(int, stdin.readline().split()) a -= 1 b -= 1 if(a > b): a = cycle_length - a b = cycle_length - b elif(a == b): print(c) continue if(a >= c % cycle_length): print((c // cycle_length) * cycle_length + b) else: print((c // cycle_length) * cycle_length + b + cycle_length)
Title: Elevator Time Limit: None seconds Memory Limit: None megabytes Problem Description: And now the numerous qualifying tournaments for one of the most prestigious Russian contests Russian Codec Cup are over. All *n* participants who have made it to the finals found themselves in a huge *m*-floored 108-star hotel. Of course the first thought to come in a place like this is "How about checking out the elevator?". The hotel's elevator moves between floors according to one never changing scheme. Initially (at the moment of time 0) the elevator is located on the 1-st floor, then it moves to the 2-nd floor, then — to the 3-rd floor and so on until it reaches the *m*-th floor. After that the elevator moves to floor *m*<=-<=1, then to floor *m*<=-<=2, and so on until it reaches the first floor. This process is repeated infinitely. We know that the elevator has infinite capacity; we also know that on every floor people get on the elevator immediately. Moving between the floors takes a unit of time. For each of the *n* participant you are given *s**i*, which represents the floor where the *i*-th participant starts, *f**i*, which represents the floor the *i*-th participant wants to reach, and *t**i*, which represents the time when the *i*-th participant starts on the floor *s**i*. For each participant print the minimum time of his/her arrival to the floor *f**i*. If the elevator stops on the floor *s**i* at the time *t**i*, then the *i*-th participant can enter the elevator immediately. If the participant starts on the floor *s**i* and that's the floor he wanted to reach initially (*s**i*<==<=*f**i*), then the time of arrival to the floor *f**i* for this participant is considered equal to *t**i*. Input Specification: The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*<=≤<=105,<=2<=≤<=*m*<=≤<=108). Next *n* lines contain information about the participants in the form of three space-separated integers *s**i* *f**i* *t**i* (1<=≤<=*s**i*,<=*f**i*<=≤<=*m*,<=0<=≤<=*t**i*<=≤<=108), described in the problem statement. Output Specification: Print *n* lines each containing one integer — the time of the arrival for each participant to the required floor. Demo Input: ['7 4\n2 4 3\n1 2 0\n2 2 0\n1 2 1\n4 3 5\n1 2 2\n4 2 0\n', '5 5\n1 5 4\n1 3 1\n1 3 4\n3 1 5\n4 2 5\n'] Demo Output: ['9\n1\n0\n7\n10\n7\n5\n', '12\n10\n10\n8\n7\n'] Note: Let's consider the first sample. The first participant starts at floor *s* = 2 by the time equal to *t* = 3. To get to the floor *f* = 4, he has to wait until the time equals 7, that's the time when the elevator will go upwards for the second time. Then the first participant should get on the elevator and go two floors up. In this case the first participant gets to the floor *f* at time equal to 9. The second participant starts at the time *t* = 0 on the floor *s* = 1, enters the elevator immediately, and arrives to the floor *f* = 2. The third participant doesn't wait for the elevator, because he needs to arrive to the same floor where he starts.
```python # n, m = tuple([int(x) for x in input().split()]) # cycle_length = (m - 1) * 2 # for _ in range(n): # a, b, c = tuple([int(x) for x in input().split()]) # a -= 1 # b -= 1 # if(a > b): # a = cycle_length - a # b = cycle_length - b # elif(a == b): # print(c) # continue # if(a >= c % cycle_length): # print((c // cycle_length) * cycle_length + b) # else: # print((c // cycle_length) * cycle_length + b + cycle_length) # codeforces should increase the run time allotted... # The solution runs in O(n) time but times out on input # Below, replaced input statements with input statements # copied from 205669844 from sys import stdin n, m = map(int, stdin.readline().split()) cycle_length = (m - 1) * 2 for _ in range(n): a, b, c = map(int, stdin.readline().split()) a -= 1 b -= 1 if(a > b): a = cycle_length - a b = cycle_length - b elif(a == b): print(c) continue if(a >= c % cycle_length): print((c // cycle_length) * cycle_length + b) else: print((c // cycle_length) * cycle_length + b + cycle_length) ```
3
928
C
Dependency management
PROGRAMMING
1,900
[ "*special", "graphs", "implementation" ]
null
null
Polycarp is currently developing a project in Vaja language and using a popular dependency management system called Vamen. From Vamen's point of view both Vaja project and libraries are treated projects for simplicity. A project in Vaja has its own uniqie non-empty name consisting of lowercase latin letters with length not exceeding 10 and version — positive integer from 1 to 106. Each project (keep in mind that it is determined by both its name and version) might depend on other projects. For sure, there are no cyclic dependencies. You're given a list of project descriptions. The first of the given projects is the one being developed by Polycarp at this moment. Help Polycarp determine all projects that his project depends on (directly or via a certain chain). It's possible that Polycarp's project depends on two different versions of some project. In this case collision resolving is applied, i.e. for each such project the system chooses the version that minimizes the distance from it to Polycarp's project. If there are several options, the newer (with the maximum version) is preferred. This version is considered actual; other versions and their dependencies are ignored. More formal, choose such a set of projects of minimum possible size that the following conditions hold: - Polycarp's project is chosen; - Polycarp's project depends (directly or indirectly) on all other projects in the set; - no two projects share the name; - for each project *x* that some other project in the set depends on we have either *x* or some *y* with other version and shorter chain to Polycarp's project chosen. In case of ties the newer one is chosen. Output all Polycarp's project's dependencies (Polycarp's project itself should't be printed) in lexicographical order.
The first line contains an only integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of projects in Vaja. The following lines contain the project descriptions. Each project is described by a line consisting of its name and version separated by space. The next line gives the number of direct dependencies (from 0 to *n*<=-<=1) and the dependencies themselves (one in a line) in arbitrary order. Each dependency is specified by its name and version. The projects are also given in arbitrary order, but the first of them is always Polycarp's. Project descriptions are separated by one empty line. Refer to samples for better understanding. It's guaranteed that there are no cyclic dependencies.
Output all Polycarp's project's dependencies in lexicographical order.
[ "4\na 3\n2\nb 1\nc 1\n \nb 2\n0\n \nb 1\n1\nb 2\n \nc 1\n1\nb 2\n", "9\ncodehorses 5\n3\nwebfrmk 6\nmashadb 1\nmashadb 2\n \ncommons 2\n0\n \nmashadb 3\n0\n \nwebfrmk 6\n2\nmashadb 3\ncommons 2\n \nextra 4\n1\nextra 3\n \nextra 3\n0\n \nextra 1\n0\n \nmashadb 1\n1\nextra 3\n \nmashadb 2\n1\nextra 1\n", "3\nabc 1\n2\nabc 3\ncba 2\n\nabc 3\n0\n\ncba 2\n0\n" ]
[ "2\nb 1\nc 1\n", "4\ncommons 2\nextra 1\nmashadb 2\nwebfrmk 6\n", "1\ncba 2\n" ]
The first sample is given in the pic below. Arrow from *A* to *B* means that *B* directly depends on *A*. Projects that Polycarp's project «a» (version 3) depends on are painted black. The second sample is again given in the pic below. Arrow from *A* to *B* means that *B* directly depends on *A*. Projects that Polycarp's project «codehorses» (version 5) depends on are paint it black. Note that «extra 1» is chosen instead of «extra 3» since «mashadb 1» and all of its dependencies are ignored due to «mashadb 2».
2,000
[ { "input": "4\na 3\n2\nb 1\nc 1\n\nb 2\n0\n\nb 1\n1\nb 2\n\nc 1\n1\nb 2", "output": "2\nb 1\nc 1" }, { "input": "9\ncodehorses 5\n3\nwebfrmk 6\nmashadb 1\nmashadb 2\n\ncommons 2\n0\n\nmashadb 3\n0\n\nwebfrmk 6\n2\nmashadb 3\ncommons 2\n\nextra 4\n1\nextra 3\n\nextra 3\n0\n\nextra 1\n0\n\nmashadb 1\n1\nextra 3\n\nmashadb 2\n1\nextra 1", "output": "4\ncommons 2\nextra 1\nmashadb 2\nwebfrmk 6" }, { "input": "3\nabc 1\n2\nabc 3\ncba 2\n\nabc 3\n0\n\ncba 2\n0", "output": "1\ncba 2" }, { "input": "1\nabc 1000000\n0", "output": "0" }, { "input": "3\nppdpd 283157\n1\npddpdpp 424025\n\nppdpd 529292\n1\nppdpd 283157\n\npddpdpp 424025\n0", "output": "1\npddpdpp 424025" }, { "input": "5\nabbzzz 646068\n0\n\nzabza 468048\n2\nbb 902619\nzabza 550912\n\nzabza 217401\n2\nabbzzz 646068\nbb 902619\n\nzabza 550912\n1\nzabza 217401\n\nbb 902619\n1\nabbzzz 646068", "output": "0" }, { "input": "5\nyyyy 223967\n1\nyyyyyyy 254197\n\nyyyyyyy 254197\n0\n\ny 442213\n0\n\ny 965022\n1\nyyyyyyy 254197\n\nyyyy 766922\n4\nyyyyyyy 254197\ny 442213\nyyyy 223967\ny 965022", "output": "1\nyyyyyyy 254197" }, { "input": "3\nvvgvvgv 991444\n1\ngvgvgvgvgg 206648\n\nvvgvvgv 296188\n0\n\ngvgvgvgvgg 206648\n1\nvvgvvgv 296188", "output": "1\ngvgvgvgvgg 206648" }, { "input": "5\ntctocototo 984516\n1\ncttocottt 486791\n\ntctocototo 688522\n2\ncttocottt 486791\ntctocototo 984516\n\ncttocottt 486791\n0\n\ntctocototo 676435\n1\ntctocototo 394244\n\ntctocototo 394244\n2\ntctocototo 688522\ncttocottt 486791", "output": "1\ncttocottt 486791" }, { "input": "5\nggggggggg 202537\n4\ngggggggg 868552\ngggg 234633\ngggg 402994\ngggggggg 86863\n\ngggg 402994\n0\n\ngggggggg 868552\n1\ngggg 234633\n\ngggg 234633\n1\ngggg 402994\n\ngggggggg 86863\n0", "output": "2\ngggg 402994\ngggggggg 868552" }, { "input": "4\ncf 1\n2\ndb 1\ndb 2\n\ndb 2\n0\n\ndb 1\n1\nold 1\n\nold 1\n0", "output": "1\ndb 2" }, { "input": "5\ncf 1\n2\ndb 1\ndb 2\n\ndb 2\n1\nold 1\n\ndb 1\n1\nold 2\n\nold 1\n0\n\nold 2\n0", "output": "2\ndb 2\nold 1" } ]
1,519,491,301
4,801
Python 3
WRONG_ANSWER
PRETESTS
1
61
5,734,400
def get_name_ver(): p_name, p_ver = tuple(input().split(' ')) p_ver = int(p_ver) return tuple([p_name, p_ver]) import collections deps = dict() n = int(input()) # build graph for i in range(n): if i == 0: policarp = get_name_ver() proj = policarp else: proj = get_name_ver() deps[proj] = list() k = int(input()) for j in range(k): dep = get_name_ver() deps[proj].append(dep) if i != n - 1: input() considered_names = {policarp[0]} considered_deps = [] visited, queue = set(), collections.deque([policarp]) while queue: v = queue.popleft() for w in deps[v]: if w not in visited: if w[0] not in considered_names: considered_names.add(w[0]) considered_deps.append(w) visited.add(w) queue.append(w) print(len(considered_deps)) for dep in sorted(considered_deps, key=lambda x: x[0]): print(f'{dep[0]} {dep[1]}')
Title: Dependency management Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp is currently developing a project in Vaja language and using a popular dependency management system called Vamen. From Vamen's point of view both Vaja project and libraries are treated projects for simplicity. A project in Vaja has its own uniqie non-empty name consisting of lowercase latin letters with length not exceeding 10 and version — positive integer from 1 to 106. Each project (keep in mind that it is determined by both its name and version) might depend on other projects. For sure, there are no cyclic dependencies. You're given a list of project descriptions. The first of the given projects is the one being developed by Polycarp at this moment. Help Polycarp determine all projects that his project depends on (directly or via a certain chain). It's possible that Polycarp's project depends on two different versions of some project. In this case collision resolving is applied, i.e. for each such project the system chooses the version that minimizes the distance from it to Polycarp's project. If there are several options, the newer (with the maximum version) is preferred. This version is considered actual; other versions and their dependencies are ignored. More formal, choose such a set of projects of minimum possible size that the following conditions hold: - Polycarp's project is chosen; - Polycarp's project depends (directly or indirectly) on all other projects in the set; - no two projects share the name; - for each project *x* that some other project in the set depends on we have either *x* or some *y* with other version and shorter chain to Polycarp's project chosen. In case of ties the newer one is chosen. Output all Polycarp's project's dependencies (Polycarp's project itself should't be printed) in lexicographical order. Input Specification: The first line contains an only integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of projects in Vaja. The following lines contain the project descriptions. Each project is described by a line consisting of its name and version separated by space. The next line gives the number of direct dependencies (from 0 to *n*<=-<=1) and the dependencies themselves (one in a line) in arbitrary order. Each dependency is specified by its name and version. The projects are also given in arbitrary order, but the first of them is always Polycarp's. Project descriptions are separated by one empty line. Refer to samples for better understanding. It's guaranteed that there are no cyclic dependencies. Output Specification: Output all Polycarp's project's dependencies in lexicographical order. Demo Input: ['4\na 3\n2\nb 1\nc 1\n\xa0\nb 2\n0\n\xa0\nb 1\n1\nb 2\n\xa0\nc 1\n1\nb 2\n', '9\ncodehorses 5\n3\nwebfrmk 6\nmashadb 1\nmashadb 2\n\xa0\ncommons 2\n0\n\xa0\nmashadb 3\n0\n\xa0\nwebfrmk 6\n2\nmashadb 3\ncommons 2\n\xa0\nextra 4\n1\nextra 3\n\xa0\nextra 3\n0\n\xa0\nextra 1\n0\n\xa0\nmashadb 1\n1\nextra 3\n\xa0\nmashadb 2\n1\nextra 1\n', '3\nabc 1\n2\nabc 3\ncba 2\n\nabc 3\n0\n\ncba 2\n0\n'] Demo Output: ['2\nb 1\nc 1\n', '4\ncommons 2\nextra 1\nmashadb 2\nwebfrmk 6\n', '1\ncba 2\n'] Note: The first sample is given in the pic below. Arrow from *A* to *B* means that *B* directly depends on *A*. Projects that Polycarp's project «a» (version 3) depends on are painted black. The second sample is again given in the pic below. Arrow from *A* to *B* means that *B* directly depends on *A*. Projects that Polycarp's project «codehorses» (version 5) depends on are paint it black. Note that «extra 1» is chosen instead of «extra 3» since «mashadb 1» and all of its dependencies are ignored due to «mashadb 2».
```python def get_name_ver(): p_name, p_ver = tuple(input().split(' ')) p_ver = int(p_ver) return tuple([p_name, p_ver]) import collections deps = dict() n = int(input()) # build graph for i in range(n): if i == 0: policarp = get_name_ver() proj = policarp else: proj = get_name_ver() deps[proj] = list() k = int(input()) for j in range(k): dep = get_name_ver() deps[proj].append(dep) if i != n - 1: input() considered_names = {policarp[0]} considered_deps = [] visited, queue = set(), collections.deque([policarp]) while queue: v = queue.popleft() for w in deps[v]: if w not in visited: if w[0] not in considered_names: considered_names.add(w[0]) considered_deps.append(w) visited.add(w) queue.append(w) print(len(considered_deps)) for dep in sorted(considered_deps, key=lambda x: x[0]): print(f'{dep[0]} {dep[1]}') ```
0
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,688,825,468
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
31
0
n,m,a=map(int,input().split()) print((n+m+a)//a)
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python n,m,a=map(int,input().split()) print((n+m+a)//a) ```
0
112
A
Petya and Strings
PROGRAMMING
800
[ "implementation", "strings" ]
A. Petya and Strings
2
256
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
[ "aaaa\naaaA\n", "abs\nAbz\n", "abcdefg\nAbCdEfF\n" ]
[ "0\n", "-1\n", "1\n" ]
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site: - http://en.wikipedia.org/wiki/Lexicographical_order
500
[ { "input": "aaaa\naaaA", "output": "0" }, { "input": "abs\nAbz", "output": "-1" }, { "input": "abcdefg\nAbCdEfF", "output": "1" }, { "input": "asadasdasd\nasdwasdawd", "output": "-1" }, { "input": "aslkjlkasdd\nasdlkjdajwi", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp", "output": "0" }, { "input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH", "output": "-1" }, { "input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt", "output": "1" }, { "input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL", "output": "1" }, { "input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo", "output": "1" }, { "input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja", "output": "-1" }, { "input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy", "output": "1" }, { "input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR", "output": "1" }, { "input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd", "output": "1" }, { "input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI", "output": "-1" }, { "input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC", "output": "-1" }, { "input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl", "output": "-1" }, { "input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo", "output": "-1" }, { "input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV", "output": "-1" }, { "input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ", "output": "-1" }, { "input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK", "output": "-1" }, { "input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys", "output": "1" }, { "input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy", "output": "-1" }, { "input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK", "output": "-1" }, { "input": "UG\nak", "output": "1" }, { "input": "JZR\nVae", "output": "-1" }, { "input": "a\nZ", "output": "-1" }, { "input": "rk\nkv", "output": "1" }, { "input": "RvuT\nbJzE", "output": "1" }, { "input": "PPS\nydq", "output": "-1" }, { "input": "q\nq", "output": "0" }, { "input": "peOw\nIgSJ", "output": "1" }, { "input": "PyK\noKN", "output": "1" }, { "input": "O\ni", "output": "1" }, { "input": "NmGY\npDlP", "output": "-1" }, { "input": "nG\nZf", "output": "-1" }, { "input": "m\na", "output": "1" }, { "input": "MWyB\nWZEV", "output": "-1" }, { "input": "Gre\nfxc", "output": "1" }, { "input": "Ooq\nwap", "output": "-1" }, { "input": "XId\nlbB", "output": "1" }, { "input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF", "output": "0" }, { "input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD", "output": "0" }, { "input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA", "output": "0" }, { "input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ", "output": "0" }, { "input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG", "output": "0" }, { "input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ", "output": "0" }, { "input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ", "output": "0" }, { "input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi", "output": "0" }, { "input": "abac\nadaa", "output": "-1" }, { "input": "Bbc\nabc", "output": "1" }, { "input": "aaaba\naaaab", "output": "1" } ]
1,695,635,812
2,147,483,647
PyPy 3-64
OK
TESTS
53
124
0
a = input().lower() b = input().lower() print(-1) if a<b else (print(1) if a>b else print(0))
Title: Petya and Strings Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison. Input Specification: Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters. Output Specification: If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared. Demo Input: ['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site: - http://en.wikipedia.org/wiki/Lexicographical_order
```python a = input().lower() b = input().lower() print(-1) if a<b else (print(1) if a>b else print(0)) ```
3.969
965
A
Paper Airplanes
PROGRAMMING
800
[ "math" ]
null
null
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Print a single integer — the minimum number of packs they should buy.
[ "5 3 2 3\n", "5 3 100 1\n" ]
[ "4\n", "5\n" ]
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
500
[ { "input": "5 3 2 3", "output": "4" }, { "input": "5 3 100 1", "output": "5" }, { "input": "10000 10000 1 1", "output": "100000000" }, { "input": "1 1 10000 10000", "output": "1" }, { "input": "300 300 21 23", "output": "196" }, { "input": "300 2 37 51", "output": "6" }, { "input": "2 400 23 57", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "10000 10000 3 2", "output": "16670000" }, { "input": "1 2 1 2", "output": "1" }, { "input": "1 1 2 2", "output": "1" }, { "input": "1 1 10 10", "output": "1" }, { "input": "5324 5439 32 13", "output": "69622" }, { "input": "9000 1 2432 1", "output": "9000" }, { "input": "230 1234 9124 23", "output": "10" }, { "input": "11 1 1 1", "output": "11" }, { "input": "6246 8489 1227 9", "output": "4858" }, { "input": "9 20 5 7", "output": "6" } ]
1,593,325,137
2,147,483,647
Python 3
OK
TESTS
18
93
6,656,000
k , n, s, p =map(int,input().split()) if(n%s==0): x=n//s else: x=n//s + 1 t=k*x if(t%p==0): y=t//p else: y=t//p + 1 print(y)
Title: Paper Airplanes Time Limit: None seconds Memory Limit: None megabytes Problem Description: To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy? Input Specification: The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively. Output Specification: Print a single integer — the minimum number of packs they should buy. Demo Input: ['5 3 2 3\n', '5 3 100 1\n'] Demo Output: ['4\n', '5\n'] Note: In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
```python k , n, s, p =map(int,input().split()) if(n%s==0): x=n//s else: x=n//s + 1 t=k*x if(t%p==0): y=t//p else: y=t//p + 1 print(y) ```
3