contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
8
|
A
|
Train and Peter
|
PROGRAMMING
| 1,200
|
[
"strings"
] |
A. Train and Peter
|
1
|
64
|
Peter likes to travel by train. He likes it so much that on the train he falls asleep.
Once in summer Peter was going by train from city A to city B, and as usual, was sleeping. Then he woke up, started to look through the window and noticed that every railway station has a flag of a particular colour.
The boy started to memorize the order of the flags' colours that he had seen. But soon he fell asleep again. Unfortunately, he didn't sleep long, he woke up and went on memorizing the colours. Then he fell asleep again, and that time he slept till the end of the journey.
At the station he told his parents about what he was doing, and wrote two sequences of the colours that he had seen before and after his sleep, respectively.
Peter's parents know that their son likes to fantasize. They give you the list of the flags' colours at the stations that the train passes sequentially on the way from A to B, and ask you to find out if Peter could see those sequences on the way from A to B, or from B to A. Remember, please, that Peter had two periods of wakefulness.
Peter's parents put lowercase Latin letters for colours. The same letter stands for the same colour, different letters — for different colours.
|
The input data contains three lines. The first line contains a non-empty string, whose length does not exceed 105, the string consists of lowercase Latin letters — the flags' colours at the stations on the way from A to B. On the way from B to A the train passes the same stations, but in reverse order.
The second line contains the sequence, written by Peter during the first period of wakefulness. The third line contains the sequence, written during the second period of wakefulness. Both sequences are non-empty, consist of lowercase Latin letters, and the length of each does not exceed 100 letters. Each of the sequences is written in chronological order.
|
Output one of the four words without inverted commas:
- «forward» — if Peter could see such sequences only on the way from A to B; - «backward» — if Peter could see such sequences on the way from B to A; - «both» — if Peter could see such sequences both on the way from A to B, and on the way from B to A; - «fantasy» — if Peter could not see such sequences.
|
[
"atob\na\nb\n",
"aaacaaa\naca\naa\n"
] |
[
"forward\n",
"both\n"
] |
It is assumed that the train moves all the time, so one flag cannot be seen twice. There are no flags at stations A and B.
| 0
|
[
{
"input": "atob\na\nb",
"output": "forward"
},
{
"input": "aaacaaa\naca\naa",
"output": "both"
},
{
"input": "aaa\naa\naa",
"output": "fantasy"
},
{
"input": "astalavista\nastla\nlavista",
"output": "fantasy"
},
{
"input": "abacabadabacaba\nabacaba\nabacaba",
"output": "both"
},
{
"input": "a\na\na",
"output": "fantasy"
},
{
"input": "ab\nb\na",
"output": "backward"
},
{
"input": "aaa\naaaa\naaaa",
"output": "fantasy"
},
{
"input": "bbabbbbababbaabaabaa\nabb\nbaab",
"output": "forward"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb\nbbbb\nbbbbb",
"output": "both"
},
{
"input": "babaabababaaaababaabababaabababababababbababbbabbaabababaababbaabbababaababaaabababaabbaababaaababaa\nabaabababaa\nabaabbaa",
"output": "forward"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb\nbbbb\nbbbbb",
"output": "both"
},
{
"input": "aababaaababaabbaabababaaababaabababbaabbabaabababaabbabbbababbababababababaabababaababaaaabababaabab\nabaabababaa\nabaabbaa",
"output": "backward"
},
{
"input": "aaaa\naaa\naa",
"output": "fantasy"
},
{
"input": "zzzz\nzz\nzzz",
"output": "fantasy"
},
{
"input": "zzzz\nzzzz\nzzzz",
"output": "fantasy"
},
{
"input": "zzzz\nzz\nzz",
"output": "both"
},
{
"input": "aabaa\naab\nbaa",
"output": "fantasy"
},
{
"input": "aabaab\naba\nab",
"output": "forward"
},
{
"input": "aab\nb\naa",
"output": "backward"
},
{
"input": "abacaba\naca\nba",
"output": "both"
}
] | 1,652,793,134
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 6
| 92
| 28,364,800
|
s, x, y=[input() for i in range(3)]
t=s[::-1]
op=0
pos=0
if x in s:
pos=s.index(x)+len(x)
if y in s[pos:]: op+=1
if y in t[pos:]:
pos=s.index(x)+len(x)
if y in s[pos:]: op+=2
ans=['fantasy', 'forward', 'backward', 'both']
print(ans[op])
|
Title: Train and Peter
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Peter likes to travel by train. He likes it so much that on the train he falls asleep.
Once in summer Peter was going by train from city A to city B, and as usual, was sleeping. Then he woke up, started to look through the window and noticed that every railway station has a flag of a particular colour.
The boy started to memorize the order of the flags' colours that he had seen. But soon he fell asleep again. Unfortunately, he didn't sleep long, he woke up and went on memorizing the colours. Then he fell asleep again, and that time he slept till the end of the journey.
At the station he told his parents about what he was doing, and wrote two sequences of the colours that he had seen before and after his sleep, respectively.
Peter's parents know that their son likes to fantasize. They give you the list of the flags' colours at the stations that the train passes sequentially on the way from A to B, and ask you to find out if Peter could see those sequences on the way from A to B, or from B to A. Remember, please, that Peter had two periods of wakefulness.
Peter's parents put lowercase Latin letters for colours. The same letter stands for the same colour, different letters — for different colours.
Input Specification:
The input data contains three lines. The first line contains a non-empty string, whose length does not exceed 105, the string consists of lowercase Latin letters — the flags' colours at the stations on the way from A to B. On the way from B to A the train passes the same stations, but in reverse order.
The second line contains the sequence, written by Peter during the first period of wakefulness. The third line contains the sequence, written during the second period of wakefulness. Both sequences are non-empty, consist of lowercase Latin letters, and the length of each does not exceed 100 letters. Each of the sequences is written in chronological order.
Output Specification:
Output one of the four words without inverted commas:
- «forward» — if Peter could see such sequences only on the way from A to B; - «backward» — if Peter could see such sequences on the way from B to A; - «both» — if Peter could see such sequences both on the way from A to B, and on the way from B to A; - «fantasy» — if Peter could not see such sequences.
Demo Input:
['atob\na\nb\n', 'aaacaaa\naca\naa\n']
Demo Output:
['forward\n', 'both\n']
Note:
It is assumed that the train moves all the time, so one flag cannot be seen twice. There are no flags at stations A and B.
|
```python
s, x, y=[input() for i in range(3)]
t=s[::-1]
op=0
pos=0
if x in s:
pos=s.index(x)+len(x)
if y in s[pos:]: op+=1
if y in t[pos:]:
pos=s.index(x)+len(x)
if y in s[pos:]: op+=2
ans=['fantasy', 'forward', 'backward', 'both']
print(ans[op])
```
| 0
|
219
|
A
|
k-String
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string.
You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
|
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
|
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them.
If the solution doesn't exist, print "-1" (without quotes).
|
[
"2\naazz\n",
"3\nabcabcabz\n"
] |
[
"azaz\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "2\naazz",
"output": "azaz"
},
{
"input": "3\nabcabcabz",
"output": "-1"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "2\nabba",
"output": "abab"
},
{
"input": "2\naaab",
"output": "-1"
},
{
"input": "7\nabacaba",
"output": "-1"
},
{
"input": "5\naaaaa",
"output": "aaaaa"
},
{
"input": "3\naabaaaaabb",
"output": "-1"
},
{
"input": "2\naaab",
"output": "-1"
},
{
"input": "2\nbabac",
"output": "-1"
},
{
"input": "3\nbbbccc",
"output": "bcbcbc"
},
{
"input": "2\naa",
"output": "aa"
},
{
"input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece",
"output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece"
},
{
"input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa",
"output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc"
},
{
"input": "1\naaa",
"output": "aaa"
},
{
"input": "1\naabaab",
"output": "aaaabb"
},
{
"input": "2\naabbbbccccccdddddddd",
"output": "abbcccddddabbcccdddd"
},
{
"input": "3\naaaaaaaaacccdddddd",
"output": "aaacddaaacddaaacdd"
},
{
"input": "3\naaaaaaaaacccbbbbbb",
"output": "aaabbcaaabbcaaabbc"
},
{
"input": "2\naazzzz",
"output": "azzazz"
},
{
"input": "2\naaaa",
"output": "aaaa"
},
{
"input": "2\naaaazz",
"output": "aazaaz"
},
{
"input": "2\naaaabb",
"output": "aabaab"
},
{
"input": "2\naabbbb",
"output": "abbabb"
},
{
"input": "2\naaaazzzz",
"output": "aazzaazz"
},
{
"input": "2\naaazz",
"output": "-1"
},
{
"input": "2\nbbbbaa",
"output": "abbabb"
},
{
"input": "2\naaaaaabbbb",
"output": "aaabbaaabb"
},
{
"input": "2\naaaaaazz",
"output": "aaazaaaz"
},
{
"input": "2\naaaabbbb",
"output": "aabbaabb"
},
{
"input": "2\naabaab",
"output": "aabaab"
},
{
"input": "1\naaaaa",
"output": "aaaaa"
},
{
"input": "2\nbbaaaa",
"output": "aabaab"
},
{
"input": "2\nacaccc",
"output": "accacc"
}
] | 1,668,747,318
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 92
| 0
|
def solve()-> str:
k=int(input())
s=input()
d={}
c=0
for i in s:
d[i] = d.get(i, 0)+1
c= d[i]
for v in d.values():
if c!=v:
return "-1"
res="".join(d.keys())*c
return res
print(solve())
|
Title: k-String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string.
You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
Input Specification:
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Output Specification:
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them.
If the solution doesn't exist, print "-1" (without quotes).
Demo Input:
['2\naazz\n', '3\nabcabcabz\n']
Demo Output:
['azaz\n', '-1\n']
Note:
none
|
```python
def solve()-> str:
k=int(input())
s=input()
d={}
c=0
for i in s:
d[i] = d.get(i, 0)+1
c= d[i]
for v in d.values():
if c!=v:
return "-1"
res="".join(d.keys())*c
return res
print(solve())
```
| 0
|
|
614
|
B
|
Gena's Code
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
It's the year 4527 and the tanks game that we all know and love still exists. There also exists Great Gena's code, written in 2016. The problem this code solves is: given the number of tanks that go into the battle from each country, find their product. If it is turns to be too large, then the servers might have not enough time to assign tanks into teams and the whole game will collapse!
There are exactly *n* distinct countries in the world and the *i*-th country added *a**i* tanks to the game. As the developers of the game are perfectionists, the number of tanks from each country is beautiful. A beautiful number, according to the developers, is such number that its decimal representation consists only of digits '1' and '0', moreover it contains at most one digit '1'. However, due to complaints from players, some number of tanks of one country was removed from the game, hence the number of tanks of this country may not remain beautiful.
Your task is to write the program that solves exactly the same problem in order to verify Gena's code correctness. Just in case.
|
The first line of the input contains the number of countries *n* (1<=≤<=*n*<=≤<=100<=000). The second line contains *n* non-negative integers *a**i* without leading zeroes — the number of tanks of the *i*-th country.
It is guaranteed that the second line contains at least *n*<=-<=1 beautiful numbers and the total length of all these number's representations doesn't exceed 100<=000.
|
Print a single number without leading zeroes — the product of the number of tanks presented by each country.
|
[
"3\n5 10 1\n",
"4\n1 1 10 11\n",
"5\n0 3 1 100 1\n"
] |
[
"50",
"110",
"0"
] |
In sample 1 numbers 10 and 1 are beautiful, number 5 is not not.
In sample 2 number 11 is not beautiful (contains two '1's), all others are beautiful.
In sample 3 number 3 is not beautiful, all others are beautiful.
| 1,000
|
[
{
"input": "3\n5 10 1",
"output": "50"
},
{
"input": "4\n1 1 10 11",
"output": "110"
},
{
"input": "5\n0 3 1 100 1",
"output": "0"
},
{
"input": "40\n10 100 10 1 10 10 100 10 10 100 10 100 100 10 1824868942 100 100 1 10 100 100 10 100 100 10 100 10 1 10 100 100 100 10 1 10 1 10 10 100 100",
"output": "1824868942000000000000000000000000000000000000000000000000000"
},
{
"input": "6\n1000000000000000000000000000000000000 6643573784 1000000000000000000000000000000000000 1000000000000000000000000000000000000 1000000000000000000000000000000000000 1000000000000000000000000000000000000",
"output": "6643573784000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n9",
"output": "9"
},
{
"input": "2\n10 50",
"output": "500"
},
{
"input": "3\n500 1 10",
"output": "5000"
}
] | 1,559,630,183
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 9
| 500
| 512,000
|
n=int(input())
a=list(map(int,input().split()))
p=1
for i in a:
p=p*i
print(p)
|
Title: Gena's Code
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's the year 4527 and the tanks game that we all know and love still exists. There also exists Great Gena's code, written in 2016. The problem this code solves is: given the number of tanks that go into the battle from each country, find their product. If it is turns to be too large, then the servers might have not enough time to assign tanks into teams and the whole game will collapse!
There are exactly *n* distinct countries in the world and the *i*-th country added *a**i* tanks to the game. As the developers of the game are perfectionists, the number of tanks from each country is beautiful. A beautiful number, according to the developers, is such number that its decimal representation consists only of digits '1' and '0', moreover it contains at most one digit '1'. However, due to complaints from players, some number of tanks of one country was removed from the game, hence the number of tanks of this country may not remain beautiful.
Your task is to write the program that solves exactly the same problem in order to verify Gena's code correctness. Just in case.
Input Specification:
The first line of the input contains the number of countries *n* (1<=≤<=*n*<=≤<=100<=000). The second line contains *n* non-negative integers *a**i* without leading zeroes — the number of tanks of the *i*-th country.
It is guaranteed that the second line contains at least *n*<=-<=1 beautiful numbers and the total length of all these number's representations doesn't exceed 100<=000.
Output Specification:
Print a single number without leading zeroes — the product of the number of tanks presented by each country.
Demo Input:
['3\n5 10 1\n', '4\n1 1 10 11\n', '5\n0 3 1 100 1\n']
Demo Output:
['50', '110', '0']
Note:
In sample 1 numbers 10 and 1 are beautiful, number 5 is not not.
In sample 2 number 11 is not beautiful (contains two '1's), all others are beautiful.
In sample 3 number 3 is not beautiful, all others are beautiful.
|
```python
n=int(input())
a=list(map(int,input().split()))
p=1
for i in a:
p=p*i
print(p)
```
| 0
|
|
665
|
C
|
Simple Strings
|
PROGRAMMING
| 1,300
|
[
"dp",
"greedy",
"strings"
] | null | null |
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
|
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
|
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
|
[
"aab\n",
"caaab\n",
"zscoder\n"
] |
[
"bab\n",
"cabab\n",
"zscoder\n"
] |
none
| 0
|
[
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,554,060,646
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 108
| 0
|
mod = 10 ** 9 + 7
ii = lambda : int(input())
si = lambda : input()
dgl = lambda : list(map(int, input()))
f = lambda : map(int, input().split())
il = lambda : list(map(int, input().split()))
ls = lambda : list(input())
s=ls()
n=len(s)
if n==1:
print(''.join(s))
elif n==2:
if s[0]==s[1]:
if s[1]=='z':
s[1]='a'
else:
s[1]=chr(ord(s[1])+1)
print(''.join(s))
else:
for i in range(1,n-1):
if s[i-1]==s[i]:
x=chr(max(ord(s[i-1]), ord(s[i+1])))
if x=='z':
x='a'
else:
x=chr(ord(x)+1)
s[i]=x
print(''.join(s))
|
Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none
|
```python
mod = 10 ** 9 + 7
ii = lambda : int(input())
si = lambda : input()
dgl = lambda : list(map(int, input()))
f = lambda : map(int, input().split())
il = lambda : list(map(int, input().split()))
ls = lambda : list(input())
s=ls()
n=len(s)
if n==1:
print(''.join(s))
elif n==2:
if s[0]==s[1]:
if s[1]=='z':
s[1]='a'
else:
s[1]=chr(ord(s[1])+1)
print(''.join(s))
else:
for i in range(1,n-1):
if s[i-1]==s[i]:
x=chr(max(ord(s[i-1]), ord(s[i+1])))
if x=='z':
x='a'
else:
x=chr(ord(x)+1)
s[i]=x
print(''.join(s))
```
| 0
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,664,034,993
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 124
| 0
|
n=int(input())
x=list(map(int,input().split()))
k=sum(x)%(n+1)
if k==0:
print(2)
else:
print(1)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
n=int(input())
x=list(map(int,input().split()))
k=sum(x)%(n+1)
if k==0:
print(2)
else:
print(1)
```
| 0
|
|
1,004
|
B
|
Sonya and Exhibition
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"greedy",
"implementation",
"math"
] | null | null |
Sonya decided to organize an exhibition of flowers. Since the girl likes only roses and lilies, she decided that only these two kinds of flowers should be in this exhibition.
There are $n$ flowers in a row in the exhibition. Sonya can put either a rose or a lily in the $i$-th position. Thus each of $n$ positions should contain exactly one flower: a rose or a lily.
She knows that exactly $m$ people will visit this exhibition. The $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. The girl knows that each segment has its own beauty that is equal to the product of the number of roses and the number of lilies.
Sonya wants her exhibition to be liked by a lot of people. That is why she wants to put the flowers in such way that the sum of beauties of all segments would be maximum possible.
|
The first line contains two integers $n$ and $m$ ($1\leq n, m\leq 10^3$) — the number of flowers and visitors respectively.
Each of the next $m$ lines contains two integers $l_i$ and $r_i$ ($1\leq l_i\leq r_i\leq n$), meaning that $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive.
|
Print the string of $n$ characters. The $i$-th symbol should be «0» if you want to put a rose in the $i$-th position, otherwise «1» if you want to put a lily.
If there are multiple answers, print any.
|
[
"5 3\n1 3\n2 4\n2 5\n",
"6 3\n5 6\n1 4\n4 6\n"
] |
[
"01100",
"110010"
] |
In the first example, Sonya can put roses in the first, fourth, and fifth positions, and lilies in the second and third positions;
- in the segment $[1\ldots3]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots4]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots5]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$.
The total beauty is equal to $2+2+4=8$.
In the second example, Sonya can put roses in the third, fourth, and sixth positions, and lilies in the first, second, and fifth positions;
- in the segment $[5\ldots6]$, there are one rose and one lily, so the beauty is equal to $1\cdot 1=1$; - in the segment $[1\ldots4]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$; - in the segment $[4\ldots6]$, there are two roses and one lily, so the beauty is equal to $2\cdot 1=2$.
The total beauty is equal to $1+4+2=7$.
| 1,000
|
[
{
"input": "5 3\n1 3\n2 4\n2 5",
"output": "01010"
},
{
"input": "6 3\n5 6\n1 4\n4 6",
"output": "010101"
},
{
"input": "10 4\n3 3\n1 6\n9 9\n10 10",
"output": "0101010101"
},
{
"input": "1 1\n1 1",
"output": "0"
},
{
"input": "1000 10\n3 998\n2 1000\n1 999\n2 1000\n3 998\n2 1000\n3 998\n1 1000\n2 1000\n3 999",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 20\n50 109\n317 370\n710 770\n440 488\n711 757\n236 278\n314 355\n131 190\n115 162\n784 834\n16 56\n677 730\n802 844\n632 689\n23 74\n647 702\n930 986\n926 983\n769 822\n508 558",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 10\n138 238\n160 260\n716 816\n504 604\n98 198\n26 126\n114 214\n217 317\n121 221\n489 589",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 5\n167 296\n613 753\n650 769\n298 439\n71 209",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 5\n349 415\n714 773\n125 179\n1 80\n148 242",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "914 10\n587 646\n770 843\n825 875\n439 485\n465 521\n330 387\n405 480\n477 521\n336 376\n715 771",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "571 10\n13 94\n450 510\n230 293\n302 375\n304 354\n421 504\n24 87\n122 181\n221 296\n257 307",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "6 2\n1 6\n1 4",
"output": "010101"
},
{
"input": "2 1\n1 2",
"output": "01"
}
] | 1,632,893,821
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 27
| 93
| 20,172,800
|
n,m=map(int,input().split())
print('10'*(n//2)+('1' if n%2 else ''))
|
Title: Sonya and Exhibition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided to organize an exhibition of flowers. Since the girl likes only roses and lilies, she decided that only these two kinds of flowers should be in this exhibition.
There are $n$ flowers in a row in the exhibition. Sonya can put either a rose or a lily in the $i$-th position. Thus each of $n$ positions should contain exactly one flower: a rose or a lily.
She knows that exactly $m$ people will visit this exhibition. The $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. The girl knows that each segment has its own beauty that is equal to the product of the number of roses and the number of lilies.
Sonya wants her exhibition to be liked by a lot of people. That is why she wants to put the flowers in such way that the sum of beauties of all segments would be maximum possible.
Input Specification:
The first line contains two integers $n$ and $m$ ($1\leq n, m\leq 10^3$) — the number of flowers and visitors respectively.
Each of the next $m$ lines contains two integers $l_i$ and $r_i$ ($1\leq l_i\leq r_i\leq n$), meaning that $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive.
Output Specification:
Print the string of $n$ characters. The $i$-th symbol should be «0» if you want to put a rose in the $i$-th position, otherwise «1» if you want to put a lily.
If there are multiple answers, print any.
Demo Input:
['5 3\n1 3\n2 4\n2 5\n', '6 3\n5 6\n1 4\n4 6\n']
Demo Output:
['01100', '110010']
Note:
In the first example, Sonya can put roses in the first, fourth, and fifth positions, and lilies in the second and third positions;
- in the segment $[1\ldots3]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots4]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots5]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$.
The total beauty is equal to $2+2+4=8$.
In the second example, Sonya can put roses in the third, fourth, and sixth positions, and lilies in the first, second, and fifth positions;
- in the segment $[5\ldots6]$, there are one rose and one lily, so the beauty is equal to $1\cdot 1=1$; - in the segment $[1\ldots4]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$; - in the segment $[4\ldots6]$, there are two roses and one lily, so the beauty is equal to $2\cdot 1=2$.
The total beauty is equal to $1+4+2=7$.
|
```python
n,m=map(int,input().split())
print('10'*(n//2)+('1' if n%2 else ''))
```
| 3
|
|
78
|
D
|
Archer's Shot
|
PROGRAMMING
| 2,300
|
[
"binary search",
"geometry",
"math",
"two pointers"
] |
D. Archer's Shot
|
2
|
256
|
A breakthrough among computer games, "Civilization XIII", is striking in its scale and elaborate details. Let's take a closer look at one of them.
The playing area in the game is split into congruent cells that are regular hexagons. The side of each cell is equal to 1. Each unit occupies exactly one cell of the playing field. The field can be considered infinite.
Let's take a look at the battle unit called an "Archer". Each archer has a parameter "shot range". It's a positive integer that determines the radius of the circle in which the archer can hit a target. The center of the circle coincides with the center of the cell in which the archer stays. A cell is considered to be under the archer’s fire if and only if all points of this cell, including border points are located inside the circle or on its border.
The picture below shows the borders for shot ranges equal to 3, 4 and 5. The archer is depicted as *A*.
Find the number of cells that are under fire for some archer.
|
The first and only line of input contains a single positive integer *k* — the archer's shot range (1<=≤<=*k*<=≤<=106).
|
Print the single number, the number of cells that are under fire.
Please do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cout stream (also you may use the %I64d specificator).
|
[
"3\n",
"4\n",
"5\n"
] |
[
"7",
"13",
"19"
] |
none
| 2,000
|
[
{
"input": "3",
"output": "7"
},
{
"input": "4",
"output": "13"
},
{
"input": "5",
"output": "19"
},
{
"input": "9",
"output": "85"
},
{
"input": "11",
"output": "121"
},
{
"input": "51",
"output": "3037"
},
{
"input": "101",
"output": "12109"
},
{
"input": "911",
"output": "1001425"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "8",
"output": "61"
},
{
"input": "6",
"output": "31"
},
{
"input": "7",
"output": "43"
},
{
"input": "10",
"output": "97"
},
{
"input": "13",
"output": "175"
},
{
"input": "43",
"output": "2137"
},
{
"input": "88",
"output": "9151"
},
{
"input": "217",
"output": "56425"
},
{
"input": "301",
"output": "108847"
},
{
"input": "403",
"output": "195457"
},
{
"input": "1034",
"output": "1290385"
},
{
"input": "1249",
"output": "1883353"
},
{
"input": "2749",
"output": "9131485"
},
{
"input": "5832",
"output": "41114119"
},
{
"input": "6486",
"output": "50854039"
},
{
"input": "6726",
"output": "54687523"
},
{
"input": "8910",
"output": "95975509"
},
{
"input": "9654",
"output": "112674937"
},
{
"input": "9991",
"output": "120678955"
},
{
"input": "10000",
"output": "120896557"
},
{
"input": "10264",
"output": "127364821"
},
{
"input": "21352",
"output": "551234029"
},
{
"input": "40094",
"output": "1943730367"
},
{
"input": "47248",
"output": "2699275123"
},
{
"input": "100000",
"output": "12091764163"
},
{
"input": "225481",
"output": "61477218007"
},
{
"input": "498598",
"output": "300605820001"
},
{
"input": "777777",
"output": "731487842995"
},
{
"input": "999811",
"output": "1208740231393"
},
{
"input": "999998",
"output": "1209192430093"
},
{
"input": "999999",
"output": "1209194850235"
},
{
"input": "1000000",
"output": "1209197264797"
}
] | 1,500,136,196
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 77
| 5,529,600
|
from sys import stdin, stdout
from decimal import Decimal
n = int(stdin.readline())
ans = 0
l = 1
label = 1
x = -1
while l and x <= n:
x += 1.5
l, r = 0, n
while (r - l > 1):
m = (r + l) // 2
if label % 2:
y = 3 ** 0.5 * (m - 1) + (3 ** 0.5) / 2
else:
y = 3 ** 0.5 * m
if x ** 2 + y ** 2 <= n ** 2:
l = m
else:
r = m
if l:
if label % 2:
if x == 0.5:
ans += l * 2 - 1
else:
ans += (l * 2 - 1) * 2
else:
ans += 4 * l
label += 1
stdout.write(str(ans))
|
Title: Archer's Shot
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A breakthrough among computer games, "Civilization XIII", is striking in its scale and elaborate details. Let's take a closer look at one of them.
The playing area in the game is split into congruent cells that are regular hexagons. The side of each cell is equal to 1. Each unit occupies exactly one cell of the playing field. The field can be considered infinite.
Let's take a look at the battle unit called an "Archer". Each archer has a parameter "shot range". It's a positive integer that determines the radius of the circle in which the archer can hit a target. The center of the circle coincides with the center of the cell in which the archer stays. A cell is considered to be under the archer’s fire if and only if all points of this cell, including border points are located inside the circle or on its border.
The picture below shows the borders for shot ranges equal to 3, 4 and 5. The archer is depicted as *A*.
Find the number of cells that are under fire for some archer.
Input Specification:
The first and only line of input contains a single positive integer *k* — the archer's shot range (1<=≤<=*k*<=≤<=106).
Output Specification:
Print the single number, the number of cells that are under fire.
Please do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cout stream (also you may use the %I64d specificator).
Demo Input:
['3\n', '4\n', '5\n']
Demo Output:
['7', '13', '19']
Note:
none
|
```python
from sys import stdin, stdout
from decimal import Decimal
n = int(stdin.readline())
ans = 0
l = 1
label = 1
x = -1
while l and x <= n:
x += 1.5
l, r = 0, n
while (r - l > 1):
m = (r + l) // 2
if label % 2:
y = 3 ** 0.5 * (m - 1) + (3 ** 0.5) / 2
else:
y = 3 ** 0.5 * m
if x ** 2 + y ** 2 <= n ** 2:
l = m
else:
r = m
if l:
if label % 2:
if x == 0.5:
ans += l * 2 - 1
else:
ans += (l * 2 - 1) * 2
else:
ans += 4 * l
label += 1
stdout.write(str(ans))
```
| 0
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
The main road in Bytecity is a straight line from south to north. Conveniently, there are coordinates measured in meters from the southernmost building in north direction.
At some points on the road there are *n* friends, and *i*-th of them is standing at the point *x**i* meters and can move with any speed no greater than *v**i* meters per second in any of the two directions along the road: south or north.
You are to compute the minimum time needed to gather all the *n* friends at some point on the road. Note that the point they meet at doesn't need to have integer coordinate.
|
The first line contains single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of friends.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109) — the current coordinates of the friends, in meters.
The third line contains *n* integers *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109) — the maximum speeds of the friends, in meters per second.
|
Print the minimum time (in seconds) needed for all the *n* friends to meet at some point on the road.
Your answer will be considered correct, if its absolute or relative error isn't greater than 10<=-<=6. Formally, let your answer be *a*, while jury's answer be *b*. Your answer will be considered correct if holds.
|
[
"3\n7 1 3\n1 2 1\n",
"4\n5 10 3 2\n2 3 2 4\n"
] |
[
"2.000000000000\n",
"1.400000000000\n"
] |
In the first sample, all friends can gather at the point 5 within 2 seconds. In order to achieve this, the first friend should go south all the time at his maximum speed, while the second and the third friends should go north at their maximum speeds.
| 0
|
[
{
"input": "3\n7 1 3\n1 2 1",
"output": "2.000000000000"
},
{
"input": "4\n5 10 3 2\n2 3 2 4",
"output": "1.400000000000"
},
{
"input": "3\n1 1000000000 2\n1 2 1000000000",
"output": "333333332.999999999971"
},
{
"input": "2\n4 5\n10 8",
"output": "0.055555555556"
},
{
"input": "4\n14 12 10 17\n8 6 5 10",
"output": "0.466666666667"
},
{
"input": "5\n1 15 61 29 43\n15 11 19 19 19",
"output": "1.764705882353"
},
{
"input": "10\n20 11 17 38 15 27 2 40 24 37\n22 30 22 30 28 16 7 20 22 13",
"output": "1.750000000000"
},
{
"input": "2\n1000000000 1000000000\n1 1",
"output": "0.000000000000"
},
{
"input": "3\n1 1 1\n1 1 1",
"output": "0.000000000000"
}
] | 1,627,172,903
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 2,963
| 13,619,200
|
def check(second):
second = second * 0.000001
# 1^-2 = 0.01
lower_bound = 0
higher_bound = 999999999999999
for i in range(len(friends)):
lower_bound = max(lower_bound, friends[i] - speed[i] * second)
higher_bound = min(higher_bound, friends[i] + speed[i] * second)
if lower_bound <= higher_bound:
return True
return False
n = int(input().strip())
friends = [int(x) for x in input().strip().split()]
speed = [int(x) for x in input().strip().split()]
# print(friends)
# print(speed)
lo = 0
hi = 10 ** 15
ans = 0
while lo < hi:
mid = lo + (hi - lo) // 2
if check(mid):
hi = mid
ans = mid
else:
lo = mid + 1
print(ans * 0.000001)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The main road in Bytecity is a straight line from south to north. Conveniently, there are coordinates measured in meters from the southernmost building in north direction.
At some points on the road there are *n* friends, and *i*-th of them is standing at the point *x**i* meters and can move with any speed no greater than *v**i* meters per second in any of the two directions along the road: south or north.
You are to compute the minimum time needed to gather all the *n* friends at some point on the road. Note that the point they meet at doesn't need to have integer coordinate.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of friends.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109) — the current coordinates of the friends, in meters.
The third line contains *n* integers *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109) — the maximum speeds of the friends, in meters per second.
Output Specification:
Print the minimum time (in seconds) needed for all the *n* friends to meet at some point on the road.
Your answer will be considered correct, if its absolute or relative error isn't greater than 10<=-<=6. Formally, let your answer be *a*, while jury's answer be *b*. Your answer will be considered correct if holds.
Demo Input:
['3\n7 1 3\n1 2 1\n', '4\n5 10 3 2\n2 3 2 4\n']
Demo Output:
['2.000000000000\n', '1.400000000000\n']
Note:
In the first sample, all friends can gather at the point 5 within 2 seconds. In order to achieve this, the first friend should go south all the time at his maximum speed, while the second and the third friends should go north at their maximum speeds.
|
```python
def check(second):
second = second * 0.000001
# 1^-2 = 0.01
lower_bound = 0
higher_bound = 999999999999999
for i in range(len(friends)):
lower_bound = max(lower_bound, friends[i] - speed[i] * second)
higher_bound = min(higher_bound, friends[i] + speed[i] * second)
if lower_bound <= higher_bound:
return True
return False
n = int(input().strip())
friends = [int(x) for x in input().strip().split()]
speed = [int(x) for x in input().strip().split()]
# print(friends)
# print(speed)
lo = 0
hi = 10 ** 15
ans = 0
while lo < hi:
mid = lo + (hi - lo) // 2
if check(mid):
hi = mid
ans = mid
else:
lo = mid + 1
print(ans * 0.000001)
```
| 3
|
|
123
|
D
|
String
|
PROGRAMMING
| 2,300
|
[
"string suffix structures"
] | null | null |
You are given a string *s*. Each pair of numbers *l* and *r* that fulfill the condition 1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|, correspond to a substring of the string *s*, starting in the position *l* and ending in the position *r* (inclusive).
Let's define the function of two strings *F*(*x*,<=*y*) like this. We'll find a list of such pairs of numbers for which the corresponding substrings of string *x* are equal to string *y*. Let's sort this list of pairs according to the pair's first number's increasing. The value of function *F*(*x*,<=*y*) equals the number of non-empty continuous sequences in the list.
For example: *F*(*babbabbababbab*,<=*babb*)<==<=6. The list of pairs is as follows:
(1,<=4),<=(4,<=7),<=(9,<=12)
Its continuous sequences are:
- (1,<=4) - (4,<=7) - (9,<=12) - (1,<=4),<=(4,<=7) - (4,<=7),<=(9,<=12) - (1,<=4),<=(4,<=7),<=(9,<=12)
Your task is to calculate for the given string *s* the sum *F*(*s*,<=*x*) for all *x*, that *x* belongs to the set of all substrings of a string *s*.
|
The only line contains the given string *s*, consisting only of small Latin letters (1<=≤<=|*s*|<=≤<=105).
|
Print the single number — the sought sum.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
[
"aaaa\n",
"abcdef\n",
"abacabadabacaba\n"
] |
[
"20\n",
"21\n",
"188\n"
] |
In the first sample the function values at *x* equal to "a", "aa", "aaa" and "aaaa" equal 10, 6, 3 and 1 correspondingly.
In the second sample for any satisfying *x* the function value is 1.
| 2,000
|
[
{
"input": "aaaa",
"output": "20"
},
{
"input": "abcdef",
"output": "21"
},
{
"input": "abacabadabacaba",
"output": "188"
},
{
"input": "tkth",
"output": "11"
},
{
"input": "eqkrqe",
"output": "23"
},
{
"input": "cwuiax",
"output": "21"
},
{
"input": "hhhhqhqh",
"output": "59"
},
{
"input": "gmxfmcgp",
"output": "38"
},
{
"input": "eleellleeee",
"output": "104"
},
{
"input": "usussubuubbbbs",
"output": "138"
},
{
"input": "lhmpaugvnqzrfxke",
"output": "136"
},
{
"input": "xkkkkkkkkkkkkkkkkxkkkk",
"output": "1098"
},
{
"input": "pprppppriiriiiirprppprriir",
"output": "512"
},
{
"input": "jsoxkutcvyshsinfmtrpujedcbmyqlojzco",
"output": "646"
},
{
"input": "emcegmekgnlefkeguqkfffnduqhfhhhndlfhlfdqdncefnn",
"output": "1227"
},
{
"input": "ffffdjfddffdjdfffddjfffffffjfffjdjfffjfjfdjjfjdjjdjjjdffd",
"output": "2564"
},
{
"input": "cxvhmeyouudwuglhbwndzwmjjsgrnuwnzwaycfspyyrdckjcidfsabvdxzjkvm",
"output": "2023"
},
{
"input": "cahdktuxuukmbuqcqactqhqdcxpkqcuumckttdpmpqxxkacpappxuqkxbuahqdphhddhquthqaapm",
"output": "3258"
},
{
"input": "hhwhhwhhhwhwwhhwwwhwhhhwhwwwhhwhwhhhhhhwhwhwwwhhwwwhhwhhhhwhwwhwhwwwwhhwwhwhwwwhhhwwhwhwhhwwwhwhhhwwwhwhw",
"output": "10856"
},
{
"input": "cnrkvxbljhitbvoysdpghhhnymktvburpvxybnvugkzudmnmpuhevzyjpbtraaepszhhssmcozkgbjayztrvqwdfmjlhtvarkkdsbnjrabqexpfjozmjzfbmdsihovoxmmtjgtfyaisllysnekdxozhdwu",
"output": "12399"
},
{
"input": "qasiyhdivaiyyhdqiqsvqhtqsetxqvaeqatxesxehisyqiivhvayaxvsxhsydiesaxydysqhedxqhsqivvidqtsitiiveexiehsqdteahyxtsyqetahviyhqvytexethsqssxiytqhxxxdihxietsyxqhtitheyeateeyhythxhhqaad",
"output": "17103"
},
{
"input": "ggwgwwgwwkggwgwwkgwwwggwwwggkgkgwkwgkkgkwwgwkkggwggkwgwgkgwwkwkkkkwggwwkwkkkgwkwwwwwgwkwkkwkggwwgggkkwwkgkgkwgkgkwggkwgggwwkgkwgkwkkgwkkkkggwwwgkggkwwgkwkgwgggkggkkkwwwwwkkgkwggwgkwwwwggwwgkkggwkkwkkgkwggggggkkwkkgkkkwkwwkwggwkkwggggwg",
"output": "41166"
},
{
"input": "tmoqyzoikohtgkybnwjizgjypzycmtstmsizrqrmczmqmpewxiwlqzcaufxkchqyjegktxihlksisbgogpyxkltioovelwaqcbebgcyygxsshsirkwvtsvhpqtbomueaszkrlixueyeiccvfiuoogomjlhjkacnxtimkprmjttpmeaminvmcqagrpjighsvaosojymcjoyopsvkrphzbnckcvvckicmjwpvawjuzkofnuvcahwhzjpfngwyobiufivsjnekjcloobvzawrvosnkvalmr",
"output": "42165"
},
{
"input": "rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrbrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrbrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr",
"output": "2214420"
},
{
"input": "zzzzooozzzoozozoozzzzzzozooozoozoozzozzozoooozzzzzzoooozzozooozoozzzozozoooooozzzozozooooozozozozzooozozzooozzzzozozoozoozzzozooozzzzoozzzzozzzzoooozozozozozzoooozzzooozzoooooooozozzozozooozzzooooozozooozozzozozoozzozzzzooozzoozozozzozozoozozzzoozozoooozzooozozooooozzzzzoozoozzzozzzoozzoozozzooozzzzzzoozzozzoozzzoozozzooozoozzzozooozozzoozoozozzzzzoozoozzzooooozooooooozooooozzoozoozzzooooozoozozozozzzoozzzzzoozzzzzzooooooozzzzozzozzo",
"output": "190205"
}
] | 1,693,834,773
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
def count_substrings(s):
n = len(s)
result = 0
occurrences = [0] * 26
for i in range(n):
count = 0
for j in range(i, n):
char_idx = ord(s[j]) - ord('a')
if occurrences[char_idx] == 0:
count += 1
occurrences[char_idx] += 1
else:
occurrences[char_idx] += 1
if occurrences[char_idx] == 2:
count -= 1
result += count
return result
s = input().strip()
result = count_substrings(s)
print(result)
|
Title: String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s*. Each pair of numbers *l* and *r* that fulfill the condition 1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|, correspond to a substring of the string *s*, starting in the position *l* and ending in the position *r* (inclusive).
Let's define the function of two strings *F*(*x*,<=*y*) like this. We'll find a list of such pairs of numbers for which the corresponding substrings of string *x* are equal to string *y*. Let's sort this list of pairs according to the pair's first number's increasing. The value of function *F*(*x*,<=*y*) equals the number of non-empty continuous sequences in the list.
For example: *F*(*babbabbababbab*,<=*babb*)<==<=6. The list of pairs is as follows:
(1,<=4),<=(4,<=7),<=(9,<=12)
Its continuous sequences are:
- (1,<=4) - (4,<=7) - (9,<=12) - (1,<=4),<=(4,<=7) - (4,<=7),<=(9,<=12) - (1,<=4),<=(4,<=7),<=(9,<=12)
Your task is to calculate for the given string *s* the sum *F*(*s*,<=*x*) for all *x*, that *x* belongs to the set of all substrings of a string *s*.
Input Specification:
The only line contains the given string *s*, consisting only of small Latin letters (1<=≤<=|*s*|<=≤<=105).
Output Specification:
Print the single number — the sought sum.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['aaaa\n', 'abcdef\n', 'abacabadabacaba\n']
Demo Output:
['20\n', '21\n', '188\n']
Note:
In the first sample the function values at *x* equal to "a", "aa", "aaa" and "aaaa" equal 10, 6, 3 and 1 correspondingly.
In the second sample for any satisfying *x* the function value is 1.
|
```python
def count_substrings(s):
n = len(s)
result = 0
occurrences = [0] * 26
for i in range(n):
count = 0
for j in range(i, n):
char_idx = ord(s[j]) - ord('a')
if occurrences[char_idx] == 0:
count += 1
occurrences[char_idx] += 1
else:
occurrences[char_idx] += 1
if occurrences[char_idx] == 2:
count -= 1
result += count
return result
s = input().strip()
result = count_substrings(s)
print(result)
```
| 0
|
|
676
|
A
|
Nicholas and Permutation
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
|
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
|
[
"5\n4 5 1 3 2\n",
"7\n1 6 5 3 4 7 2\n",
"6\n6 5 4 3 2 1\n"
] |
[
"3\n",
"6\n",
"5\n"
] |
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
| 500
|
[
{
"input": "5\n4 5 1 3 2",
"output": "3"
},
{
"input": "7\n1 6 5 3 4 7 2",
"output": "6"
},
{
"input": "6\n6 5 4 3 2 1",
"output": "5"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "5\n1 4 5 2 3",
"output": "4"
},
{
"input": "6\n4 6 3 5 2 1",
"output": "5"
},
{
"input": "7\n1 5 3 6 2 4 7",
"output": "6"
},
{
"input": "100\n76 70 67 54 40 1 48 63 64 36 42 90 99 27 47 17 93 7 13 84 16 57 74 5 83 61 19 56 52 92 38 91 82 79 34 66 71 28 37 98 35 94 77 53 73 10 26 80 15 32 8 81 3 95 44 46 72 6 33 11 21 85 4 30 24 51 49 96 87 55 14 31 12 60 45 9 29 22 58 18 88 2 50 59 20 86 23 41 100 39 62 68 69 97 78 43 25 89 65 75",
"output": "94"
},
{
"input": "8\n4 5 3 8 6 7 1 2",
"output": "6"
},
{
"input": "9\n6 8 5 3 4 7 9 2 1",
"output": "8"
},
{
"input": "10\n8 7 10 1 2 3 4 6 5 9",
"output": "7"
},
{
"input": "11\n5 4 6 9 10 11 7 3 1 2 8",
"output": "8"
},
{
"input": "12\n3 6 7 8 9 10 12 5 4 2 11 1",
"output": "11"
},
{
"input": "13\n8 4 3 7 5 11 9 1 10 2 13 12 6",
"output": "10"
},
{
"input": "14\n6 10 13 9 7 1 12 14 3 2 5 4 11 8",
"output": "8"
},
{
"input": "15\n3 14 13 12 7 2 4 11 15 1 8 6 5 10 9",
"output": "9"
},
{
"input": "16\n11 6 9 8 7 14 12 13 10 15 2 5 3 1 4 16",
"output": "15"
},
{
"input": "17\n13 12 5 3 9 16 8 14 2 4 10 1 6 11 7 15 17",
"output": "16"
},
{
"input": "18\n8 6 14 17 9 11 15 13 5 3 18 1 2 7 12 16 4 10",
"output": "11"
},
{
"input": "19\n12 19 3 11 15 6 18 14 5 10 2 13 9 7 4 8 17 16 1",
"output": "18"
},
{
"input": "20\n15 17 10 20 7 2 16 9 13 6 18 5 19 8 11 14 4 12 3 1",
"output": "19"
},
{
"input": "21\n1 9 14 18 13 12 11 20 16 2 4 19 15 7 6 17 8 5 3 10 21",
"output": "20"
},
{
"input": "22\n8 3 17 4 16 21 14 11 10 15 6 18 13 12 22 20 5 2 9 7 19 1",
"output": "21"
},
{
"input": "23\n1 23 11 20 9 3 12 4 7 17 5 15 2 10 18 16 8 22 14 13 19 21 6",
"output": "22"
},
{
"input": "24\n2 10 23 22 20 19 18 16 11 12 15 17 21 8 24 13 1 5 6 7 14 3 9 4",
"output": "16"
},
{
"input": "25\n12 13 22 17 1 18 14 5 21 2 10 4 3 23 11 6 20 8 24 16 15 19 9 7 25",
"output": "24"
},
{
"input": "26\n6 21 20 16 26 17 11 2 24 4 1 12 14 8 25 7 15 10 22 5 13 18 9 23 19 3",
"output": "21"
},
{
"input": "27\n20 14 18 10 5 3 9 4 24 22 21 27 17 15 26 2 23 7 12 11 6 8 19 25 16 13 1",
"output": "26"
},
{
"input": "28\n28 13 16 6 1 12 4 27 22 7 18 3 21 26 25 11 5 10 20 24 19 15 14 8 23 17 9 2",
"output": "27"
},
{
"input": "29\n21 11 10 25 2 5 9 16 29 8 17 4 15 13 6 22 7 24 19 12 18 20 1 3 23 28 27 14 26",
"output": "22"
},
{
"input": "30\n6 19 14 22 26 17 27 8 25 3 24 30 4 18 23 16 9 13 29 20 15 2 5 11 28 12 1 10 21 7",
"output": "26"
},
{
"input": "31\n29 13 26 27 9 28 2 16 30 21 12 11 3 31 23 6 22 20 1 5 14 24 19 18 8 4 10 17 15 25 7",
"output": "18"
},
{
"input": "32\n15 32 11 3 18 23 19 14 5 8 6 21 13 24 25 4 16 9 27 20 17 31 2 22 7 12 30 1 26 10 29 28",
"output": "30"
},
{
"input": "33\n22 13 10 33 8 25 15 14 21 28 27 19 26 24 1 12 5 11 32 20 30 31 18 4 6 23 7 29 16 2 17 9 3",
"output": "29"
},
{
"input": "34\n34 30 7 16 6 1 10 23 29 13 15 25 32 26 18 11 28 3 14 21 19 5 31 33 4 17 8 9 24 20 27 22 2 12",
"output": "33"
},
{
"input": "35\n24 33 20 8 34 11 31 25 2 4 18 13 9 35 16 30 23 32 17 1 14 22 19 21 28 26 3 15 5 12 27 29 10 6 7",
"output": "21"
},
{
"input": "36\n1 32 27 35 22 7 34 15 18 36 31 28 13 2 10 21 20 17 16 4 3 24 19 29 11 12 25 5 33 26 14 6 9 23 30 8",
"output": "35"
},
{
"input": "37\n24 1 12 23 11 6 30 15 4 21 13 20 25 17 5 8 36 19 32 26 14 9 7 18 10 29 37 35 16 2 22 34 3 27 31 33 28",
"output": "35"
},
{
"input": "38\n9 35 37 28 36 21 10 25 19 4 26 5 22 7 27 18 6 14 15 24 1 17 11 34 20 8 2 16 3 23 32 31 13 12 38 33 30 29",
"output": "34"
},
{
"input": "39\n16 28 4 33 26 36 25 23 22 30 27 7 12 34 17 6 3 38 10 24 13 31 29 39 14 32 9 20 35 11 18 21 8 2 15 37 5 19 1",
"output": "38"
},
{
"input": "40\n35 39 28 11 9 31 36 8 5 32 26 19 38 33 2 22 23 25 6 37 12 7 3 10 17 24 20 16 27 4 34 15 40 14 18 13 29 21 30 1",
"output": "39"
},
{
"input": "41\n24 18 7 23 3 15 1 17 25 5 30 10 34 36 2 14 9 21 41 40 20 28 33 35 12 22 11 8 19 16 31 27 26 32 29 4 13 38 37 39 6",
"output": "34"
},
{
"input": "42\n42 15 24 26 4 34 19 29 38 32 31 33 14 41 21 3 11 39 25 6 5 20 23 10 16 36 18 28 27 1 7 40 22 30 9 2 37 17 8 12 13 35",
"output": "41"
},
{
"input": "43\n43 24 20 13 22 29 28 4 30 3 32 40 31 8 7 9 35 27 18 5 42 6 17 19 23 12 41 21 16 37 33 34 2 14 36 38 25 10 15 39 26 11 1",
"output": "42"
},
{
"input": "44\n4 38 6 40 29 3 44 2 30 35 25 36 34 10 11 31 21 7 14 23 37 19 27 18 5 22 1 16 17 9 39 13 15 32 43 8 41 26 42 12 24 33 20 28",
"output": "37"
},
{
"input": "45\n45 29 24 2 31 5 34 41 26 44 33 43 15 3 4 11 21 37 27 12 14 39 23 42 16 6 13 19 8 38 20 9 25 22 40 17 32 35 18 10 28 7 30 36 1",
"output": "44"
},
{
"input": "46\n29 3 12 33 45 40 19 17 25 27 28 1 16 23 24 46 31 8 44 15 5 32 22 11 4 36 34 10 35 26 21 7 14 2 18 9 20 41 6 43 42 37 38 13 39 30",
"output": "34"
},
{
"input": "47\n7 3 8 12 24 16 29 10 28 38 1 20 37 40 21 5 15 6 45 23 36 44 25 43 41 4 11 42 18 35 32 31 39 33 27 30 22 34 14 13 17 47 19 9 46 26 2",
"output": "41"
},
{
"input": "48\n29 26 14 18 34 33 13 39 32 1 37 20 35 19 28 48 30 23 46 27 5 22 24 38 12 15 8 36 43 45 16 47 6 9 31 40 44 17 2 41 11 42 25 4 21 3 10 7",
"output": "38"
},
{
"input": "49\n16 7 42 32 11 35 15 8 23 41 6 20 47 24 9 45 49 2 37 48 25 28 5 18 3 19 12 4 22 33 13 14 10 36 44 17 40 38 30 26 1 43 29 46 21 34 27 39 31",
"output": "40"
},
{
"input": "50\n31 45 3 34 13 43 32 4 42 9 7 8 24 14 35 6 19 46 44 17 18 1 25 20 27 41 2 16 12 10 11 47 38 21 28 49 30 15 50 36 29 26 22 39 48 5 23 37 33 40",
"output": "38"
},
{
"input": "51\n47 29 2 11 43 44 27 1 39 14 25 30 33 21 38 45 34 51 16 50 42 31 41 46 15 48 13 19 6 37 35 7 22 28 20 4 17 10 5 8 24 40 9 36 18 49 12 26 23 3 32",
"output": "43"
},
{
"input": "52\n16 45 23 7 15 19 43 20 4 32 35 36 9 50 5 26 38 46 13 33 12 2 48 37 41 31 10 28 8 42 3 21 11 1 17 27 34 30 44 40 6 51 49 47 25 22 18 24 52 29 14 39",
"output": "48"
},
{
"input": "53\n53 30 50 22 51 31 32 38 12 7 39 43 1 23 6 8 24 52 2 21 34 13 3 35 5 15 19 11 47 18 9 20 29 4 36 45 27 41 25 48 16 46 44 17 10 14 42 26 40 28 33 37 49",
"output": "52"
},
{
"input": "54\n6 39 17 3 45 52 16 21 23 48 42 36 13 37 46 10 43 27 49 7 38 32 31 30 15 25 2 29 8 51 54 19 41 44 24 34 22 5 20 14 12 1 33 40 4 26 9 35 18 28 47 50 11 53",
"output": "41"
},
{
"input": "55\n26 15 31 21 32 43 34 51 7 12 5 44 17 54 18 25 48 47 20 3 41 24 45 2 11 22 29 39 37 53 35 28 36 9 50 10 30 38 19 13 4 8 27 1 42 6 49 23 55 40 33 16 46 14 52",
"output": "48"
},
{
"input": "56\n6 20 38 46 10 11 40 19 5 1 47 33 4 18 32 36 37 45 56 49 48 52 12 26 31 14 2 9 24 3 16 51 41 43 23 17 34 7 29 50 55 25 39 44 22 27 54 8 28 35 30 42 13 53 21 15",
"output": "46"
},
{
"input": "57\n39 28 53 36 3 6 12 56 55 20 50 19 43 42 18 40 24 52 38 17 33 23 22 41 14 7 26 44 45 16 35 1 8 47 31 5 30 51 32 4 37 25 13 34 54 21 46 10 15 11 2 27 29 48 49 9 57",
"output": "56"
},
{
"input": "58\n1 26 28 14 22 33 57 40 9 42 44 37 24 19 58 12 48 3 34 31 49 4 16 47 55 52 27 23 46 18 20 32 56 6 39 36 41 38 13 43 45 21 53 54 29 17 5 10 25 30 2 35 11 7 15 51 8 50",
"output": "57"
},
{
"input": "59\n1 27 10 37 53 9 14 49 46 26 50 42 59 11 47 15 24 56 43 45 44 38 5 8 58 30 52 12 23 32 22 3 31 41 2 25 29 6 54 16 35 33 18 55 4 51 57 28 40 19 13 21 7 39 36 48 34 17 20",
"output": "58"
},
{
"input": "60\n60 27 34 32 54 55 33 12 40 3 47 44 50 39 38 59 11 25 17 15 16 30 21 31 10 52 5 23 4 48 6 26 36 57 14 22 8 56 58 9 24 7 37 53 42 43 20 49 51 19 2 46 28 18 35 13 29 45 41 1",
"output": "59"
},
{
"input": "61\n61 11 26 29 31 40 32 30 35 3 18 52 9 53 42 4 50 54 20 58 28 49 22 12 2 19 16 15 57 34 51 43 7 17 25 41 56 47 55 60 46 14 44 45 24 27 33 1 48 13 59 23 38 39 6 5 36 10 8 37 21",
"output": "60"
},
{
"input": "62\n21 23 34 38 11 61 55 30 37 48 54 51 46 47 6 56 36 49 1 35 12 28 29 20 43 42 5 8 22 57 44 4 53 10 58 33 27 25 16 45 50 40 18 15 3 41 39 2 7 60 59 13 32 24 52 31 14 9 19 26 17 62",
"output": "61"
},
{
"input": "63\n2 5 29 48 31 26 21 16 47 24 43 22 61 28 6 39 60 27 14 52 37 7 53 8 62 56 63 10 50 18 44 13 4 9 25 11 23 42 45 41 59 12 32 36 40 51 1 35 49 54 57 20 19 34 38 46 33 3 55 15 30 58 17",
"output": "46"
},
{
"input": "64\n23 5 51 40 12 46 44 8 64 31 58 55 45 24 54 39 21 19 52 61 30 42 16 18 15 32 53 22 28 26 11 25 48 56 27 9 29 41 35 49 59 38 62 7 34 1 20 33 60 17 2 3 43 37 57 14 6 36 13 10 50 4 63 47",
"output": "55"
},
{
"input": "65\n10 11 55 43 53 25 35 26 16 37 41 38 59 21 48 2 65 49 17 23 18 30 62 36 3 4 47 15 28 63 57 54 31 46 44 12 51 7 29 13 56 52 14 22 39 19 8 27 45 5 6 34 32 61 20 50 9 24 33 58 60 40 1 42 64",
"output": "62"
},
{
"input": "66\n66 39 3 2 55 53 60 54 12 49 10 30 59 26 32 46 50 56 7 13 43 36 24 28 11 8 6 21 35 25 42 57 23 45 64 5 34 61 27 51 52 9 15 1 38 17 63 48 37 20 58 14 47 19 22 41 31 44 33 65 4 62 40 18 16 29",
"output": "65"
},
{
"input": "67\n66 16 2 53 35 38 49 28 18 6 36 58 21 47 27 5 50 62 44 12 52 37 11 56 15 31 25 65 17 29 59 41 7 42 4 43 39 10 1 40 24 13 20 54 19 67 46 60 51 45 64 30 8 33 26 9 3 22 34 23 57 48 55 14 63 61 32",
"output": "45"
},
{
"input": "68\n13 6 27 21 65 23 59 14 62 43 33 31 38 41 67 20 16 25 42 4 28 40 29 9 64 17 2 26 32 58 60 53 46 48 47 54 44 50 39 19 30 57 61 1 11 18 37 24 55 15 63 34 8 52 56 7 10 12 35 66 5 36 45 49 68 22 51 3",
"output": "64"
},
{
"input": "69\n29 49 25 51 21 35 11 61 39 54 40 37 60 42 27 33 59 53 34 10 46 2 23 69 8 47 58 36 1 38 19 12 7 48 13 3 6 22 18 5 65 24 50 41 66 44 67 57 4 56 62 43 9 30 14 15 28 31 64 26 16 55 68 17 32 20 45 52 63",
"output": "45"
},
{
"input": "70\n19 12 15 18 36 16 61 69 24 7 11 13 3 48 55 21 37 17 43 31 41 22 28 32 27 63 38 49 59 56 30 25 67 51 52 45 50 44 66 57 26 60 5 46 33 6 23 34 8 40 2 68 14 39 65 64 62 42 47 54 10 53 9 1 70 58 20 4 29 35",
"output": "64"
},
{
"input": "71\n40 6 62 3 41 52 31 66 27 16 35 5 17 60 2 15 51 22 67 61 71 53 1 64 8 45 28 18 50 30 12 69 20 26 10 37 36 49 70 32 33 11 57 14 9 55 4 58 29 25 44 65 39 48 24 47 19 46 56 38 34 42 59 63 54 23 7 68 43 13 21",
"output": "50"
},
{
"input": "72\n52 64 71 40 32 10 62 21 11 37 38 13 22 70 1 66 41 50 27 20 42 47 25 68 49 12 15 72 44 60 53 5 23 14 43 29 65 36 51 54 35 67 7 19 55 48 58 46 39 24 33 30 61 45 57 2 31 3 18 59 6 9 4 63 8 16 26 34 28 69 17 56",
"output": "57"
},
{
"input": "73\n58 38 47 34 39 64 69 66 72 57 9 4 67 22 35 13 61 14 28 52 56 20 31 70 27 24 36 1 62 17 10 5 12 33 16 73 18 49 63 71 44 65 23 30 40 8 50 46 60 25 11 26 37 55 29 68 42 2 3 32 59 7 15 43 41 48 51 53 6 45 54 19 21",
"output": "45"
},
{
"input": "74\n19 51 59 34 8 40 42 55 65 16 74 26 49 63 64 70 35 72 7 12 43 18 61 27 47 31 13 32 71 22 25 67 9 1 48 50 33 10 21 46 11 45 17 37 28 60 69 66 38 2 30 3 39 15 53 68 57 41 6 36 24 73 4 23 5 62 44 14 20 29 52 54 56 58",
"output": "63"
},
{
"input": "75\n75 28 60 19 59 17 65 26 32 23 18 64 8 62 4 11 42 16 47 5 72 46 9 1 25 21 2 50 33 6 36 68 30 12 20 40 53 45 34 7 37 39 38 44 63 61 67 3 66 51 29 73 24 57 70 27 10 56 22 55 13 49 35 15 54 41 14 74 69 48 52 31 71 43 58",
"output": "74"
},
{
"input": "76\n1 47 54 17 38 37 12 32 14 48 43 71 60 56 4 13 64 41 52 57 62 24 23 49 20 10 63 3 25 66 59 40 58 33 53 46 70 7 35 61 72 74 73 19 30 5 29 6 15 28 21 27 51 55 50 9 65 8 67 39 76 42 31 34 16 2 36 11 26 44 22 45 75 18 69 68",
"output": "75"
},
{
"input": "77\n10 20 57 65 53 69 59 45 58 32 28 72 4 14 1 33 40 47 7 5 51 76 37 16 41 61 42 2 21 26 38 74 35 64 43 77 71 50 39 48 27 63 73 44 52 66 9 18 23 54 25 6 8 56 13 67 36 22 15 46 62 75 55 11 31 17 24 29 60 68 12 30 3 70 49 19 34",
"output": "62"
},
{
"input": "78\n7 61 69 47 68 42 65 78 70 3 32 59 49 51 23 71 11 63 22 18 43 34 24 13 27 16 19 40 21 46 48 77 28 66 54 67 60 15 75 62 9 26 52 58 4 25 8 37 41 76 1 6 30 50 44 36 5 14 29 53 17 12 2 57 73 35 64 39 56 10 33 20 45 74 31 55 38 72",
"output": "70"
},
{
"input": "79\n75 79 43 66 72 52 29 65 74 38 24 1 5 51 13 7 71 33 4 61 2 36 63 47 64 44 34 27 3 21 17 37 54 53 49 20 28 60 39 10 16 76 6 77 73 22 50 48 78 30 67 56 31 26 40 59 41 11 18 45 69 62 15 23 32 70 19 55 68 57 35 25 12 46 14 42 9 8 58",
"output": "77"
},
{
"input": "80\n51 20 37 12 68 11 28 52 76 21 7 5 3 16 64 34 25 2 6 40 60 62 75 13 45 17 56 29 32 47 79 73 49 72 15 46 30 54 80 27 43 24 74 18 42 71 14 4 44 63 65 33 1 77 55 57 41 59 58 70 69 35 19 67 10 36 26 23 48 50 39 61 9 66 38 8 31 22 53 78",
"output": "52"
},
{
"input": "81\n63 22 4 41 43 74 64 39 10 35 20 81 11 28 70 67 53 79 16 61 68 52 27 37 58 9 50 49 18 30 72 47 7 60 78 51 23 48 73 66 44 13 15 57 56 38 1 76 25 45 36 34 42 8 75 26 59 14 71 21 6 77 5 17 2 32 40 54 46 24 29 3 31 19 65 62 33 69 12 80 55",
"output": "69"
},
{
"input": "82\n50 24 17 41 49 18 80 11 79 72 57 31 21 35 2 51 36 66 20 65 38 3 45 32 59 81 28 30 70 55 29 76 73 6 33 39 8 7 19 48 63 1 77 43 4 13 78 54 69 9 40 46 74 82 60 71 16 64 12 14 47 26 44 5 10 75 53 25 27 15 56 42 58 34 23 61 67 62 68 22 37 52",
"output": "53"
},
{
"input": "83\n64 8 58 17 67 46 3 82 23 70 72 16 53 45 13 20 12 48 40 4 6 47 76 60 19 44 30 78 28 22 75 15 25 29 63 74 55 32 14 51 35 31 62 77 27 42 65 71 56 61 66 41 68 49 7 34 2 83 36 5 33 26 37 80 59 50 1 9 54 21 18 24 38 73 81 52 10 39 43 79 57 11 69",
"output": "66"
},
{
"input": "84\n75 8 66 21 61 63 72 51 52 13 59 25 28 58 64 53 79 41 34 7 67 11 39 56 44 24 50 9 49 55 1 80 26 6 73 74 27 69 65 37 18 43 36 17 30 3 47 29 76 78 32 22 12 68 46 5 42 81 57 31 33 83 54 48 14 62 10 16 4 20 71 70 35 15 45 19 60 77 2 23 84 40 82 38",
"output": "80"
},
{
"input": "85\n1 18 58 8 22 76 3 61 12 33 54 41 6 24 82 15 10 17 38 64 26 4 62 28 47 14 66 9 84 75 2 71 67 43 37 32 85 21 69 52 55 63 81 51 74 59 65 34 29 36 30 45 27 53 13 79 39 57 5 70 19 40 7 42 68 48 16 80 83 23 46 35 72 31 11 44 73 77 50 56 49 25 60 20 78",
"output": "84"
},
{
"input": "86\n64 56 41 10 31 69 47 39 37 36 27 19 9 42 15 6 78 59 52 17 71 45 72 14 2 54 38 79 4 18 16 8 46 75 50 82 44 24 20 55 58 86 61 43 35 32 33 40 63 30 28 60 13 53 12 57 77 81 76 66 73 84 85 62 68 22 51 5 49 7 1 70 80 65 34 48 23 21 83 11 74 26 29 67 25 3",
"output": "70"
},
{
"input": "87\n14 20 82 47 39 75 71 45 3 37 63 19 32 68 7 41 48 76 27 46 84 49 4 44 26 69 17 64 1 18 58 33 11 23 21 86 67 52 70 16 77 78 6 74 15 87 10 59 13 34 22 2 65 38 66 61 51 57 35 60 81 40 36 80 31 43 83 56 79 55 29 5 12 8 50 30 53 72 54 9 24 25 42 62 73 28 85",
"output": "58"
},
{
"input": "88\n1 83 73 46 61 31 39 86 57 43 16 29 26 80 82 7 36 42 13 20 6 64 19 40 24 12 47 87 8 34 75 9 69 3 11 52 14 25 84 59 27 10 54 51 81 74 65 77 70 17 60 35 23 44 49 2 4 88 5 21 41 32 68 66 15 55 48 58 78 53 22 38 45 33 30 50 85 76 37 79 63 18 28 62 72 56 71 67",
"output": "87"
},
{
"input": "89\n68 40 14 58 56 25 8 44 49 55 9 76 66 54 33 81 42 15 59 17 21 30 75 60 4 48 64 6 52 63 61 27 12 57 72 67 23 86 77 80 22 13 43 73 26 78 50 51 18 62 1 29 82 16 74 2 87 24 3 41 11 46 47 69 10 84 65 39 35 79 70 32 34 31 20 19 53 71 36 28 83 88 38 85 7 5 37 45 89",
"output": "88"
},
{
"input": "90\n2 67 26 58 9 49 76 22 60 30 77 20 13 7 37 81 47 16 19 12 14 45 41 68 85 54 28 24 46 1 27 43 32 89 53 35 59 75 18 51 17 64 66 80 31 88 87 90 38 72 55 71 42 11 73 69 62 78 23 74 65 79 84 4 86 52 10 6 3 82 56 5 48 33 21 57 40 29 61 63 34 36 83 8 15 44 50 70 39 25",
"output": "60"
},
{
"input": "91\n91 69 56 16 73 55 14 82 80 46 57 81 22 71 63 76 43 37 77 75 70 3 26 2 28 17 51 38 30 67 41 47 54 62 34 25 84 11 87 39 32 52 31 36 50 19 21 53 29 24 79 8 74 64 44 7 6 18 10 42 13 9 83 58 4 88 65 60 20 90 66 49 86 89 78 48 5 27 23 59 61 15 72 45 40 33 68 85 35 12 1",
"output": "90"
},
{
"input": "92\n67 57 76 78 25 89 6 82 11 16 26 17 59 48 73 10 21 31 27 80 4 5 22 13 92 55 45 85 63 28 75 60 54 88 91 47 29 35 7 87 1 39 43 51 71 84 83 81 46 9 38 56 90 24 37 41 19 86 50 61 79 20 18 14 69 23 62 65 49 52 58 53 36 2 68 64 15 42 30 34 66 32 44 40 8 33 3 77 74 12 70 72",
"output": "67"
},
{
"input": "93\n76 35 5 87 7 21 59 71 24 37 2 73 31 74 4 52 28 20 56 27 65 86 16 45 85 67 68 70 47 72 91 88 14 32 62 69 78 41 15 22 57 18 50 13 39 58 17 83 64 51 25 11 38 77 82 90 8 26 29 61 10 43 79 53 48 6 23 55 63 49 81 92 80 44 89 60 66 30 1 9 36 33 19 46 75 93 3 12 42 84 40 54 34",
"output": "85"
},
{
"input": "94\n29 85 82 78 61 83 80 63 11 38 50 43 9 24 4 87 79 45 3 17 90 7 34 27 1 76 26 39 84 47 22 41 81 19 44 23 56 92 35 31 72 62 70 53 40 88 13 14 73 2 59 86 46 94 15 12 77 57 89 42 75 48 18 51 32 55 71 30 49 91 20 60 5 93 33 64 21 36 10 28 8 65 66 69 74 58 6 52 25 67 16 37 54 68",
"output": "69"
},
{
"input": "95\n36 73 18 77 15 71 50 57 79 65 94 88 9 69 52 70 26 66 78 89 55 20 72 83 75 68 32 28 45 74 19 22 54 23 84 90 86 12 42 58 11 81 39 31 85 47 60 44 59 43 21 7 30 41 64 76 93 46 87 48 10 40 3 14 38 49 29 35 2 67 5 34 13 37 27 56 91 17 62 80 8 61 53 95 24 92 6 82 63 33 51 25 4 16 1",
"output": "94"
},
{
"input": "96\n64 3 47 83 19 10 72 61 73 95 16 40 54 84 8 86 28 4 37 42 92 48 63 76 67 1 59 66 20 35 93 2 43 7 45 70 34 33 26 91 85 89 13 29 58 68 44 25 87 75 49 71 41 17 55 36 32 31 74 22 52 79 30 88 50 78 38 39 65 27 69 77 81 94 82 53 21 80 57 60 24 46 51 9 18 15 96 62 6 23 11 12 90 5 14 56",
"output": "86"
},
{
"input": "97\n40 63 44 64 84 92 38 41 28 91 3 70 76 67 94 96 35 79 29 22 78 88 85 8 21 1 93 54 71 80 37 17 13 26 62 59 75 87 69 33 89 49 77 61 12 39 6 36 58 18 73 50 82 45 74 52 11 34 95 7 23 30 15 32 31 16 55 19 20 83 60 72 10 53 51 14 27 9 68 47 5 2 81 46 57 86 56 43 48 66 24 25 4 42 65 97 90",
"output": "95"
},
{
"input": "98\n85 94 69 86 22 52 27 79 53 91 35 55 33 88 8 75 76 95 64 54 67 30 70 49 6 16 2 48 80 32 25 90 98 46 9 96 36 81 10 92 28 11 37 97 15 41 38 40 83 44 29 47 23 3 31 61 87 39 78 20 68 12 17 73 59 18 77 72 43 51 84 24 89 65 26 7 74 93 21 19 5 14 50 42 82 71 60 56 34 62 58 57 45 66 13 63 4 1",
"output": "97"
},
{
"input": "99\n33 48 19 41 59 64 16 12 17 13 7 1 9 6 4 92 61 49 60 25 74 65 22 97 30 32 10 62 14 55 80 66 82 78 31 23 87 93 27 98 20 29 88 84 77 34 83 96 79 90 56 89 58 72 52 47 21 76 24 70 44 94 5 39 8 18 57 36 40 68 43 75 3 2 35 99 63 26 67 73 15 11 53 28 42 46 69 50 51 95 38 37 54 85 81 91 45 86 71",
"output": "87"
},
{
"input": "100\n28 30 77 4 81 67 31 25 66 56 88 73 83 51 57 34 21 90 38 76 22 99 53 70 91 3 64 54 6 94 8 5 97 80 50 45 61 40 16 95 36 98 9 2 17 44 72 55 18 58 47 12 87 24 7 32 14 23 65 41 63 48 62 39 92 27 43 19 46 13 42 52 96 84 26 69 100 79 93 49 35 60 71 59 68 15 10 29 20 1 78 33 75 86 11 85 74 82 89 37",
"output": "89"
},
{
"input": "100\n100 97 35 55 45 3 46 98 77 64 94 85 73 43 49 79 72 9 70 62 80 88 29 58 61 20 89 83 66 86 82 15 6 87 42 96 90 75 63 38 81 40 5 23 4 18 41 19 99 60 8 12 76 51 39 93 53 26 21 50 47 28 13 30 68 59 34 54 24 56 31 27 65 16 32 10 36 52 44 91 22 14 33 25 7 78 67 17 57 37 92 11 2 69 84 95 74 71 48 1",
"output": "99"
},
{
"input": "100\n83 96 73 70 30 25 7 77 58 89 76 85 49 82 45 51 14 62 50 9 31 32 16 15 97 64 4 37 20 93 24 10 80 71 100 39 75 72 78 74 8 29 53 86 79 48 3 68 90 99 56 87 63 94 36 1 40 65 6 44 43 84 17 52 34 95 38 47 60 57 98 59 33 41 46 81 23 27 19 2 54 91 55 35 26 12 92 18 28 66 69 21 5 67 13 11 22 88 61 42",
"output": "65"
},
{
"input": "100\n96 80 47 60 56 9 78 20 37 72 68 15 100 94 51 26 65 38 50 19 4 70 25 63 22 30 13 58 43 69 18 33 5 66 39 73 12 55 95 92 97 1 14 83 10 28 64 31 46 91 32 86 74 54 29 52 89 53 90 44 62 40 16 24 67 81 36 34 7 23 79 87 75 98 84 3 41 77 76 42 71 35 49 61 2 27 59 82 99 85 21 11 45 6 88 48 17 57 8 93",
"output": "87"
},
{
"input": "100\n5 6 88 37 97 51 25 81 54 17 57 98 99 44 67 24 30 93 100 36 8 38 84 42 21 4 75 31 85 48 70 77 43 50 65 94 29 32 68 86 56 39 69 47 20 60 52 53 10 34 79 2 95 40 89 64 71 26 22 46 1 62 91 76 83 41 9 78 16 63 13 3 28 92 27 49 7 12 96 72 80 23 14 19 18 66 59 87 90 45 73 82 33 74 35 61 55 15 58 11",
"output": "81"
},
{
"input": "100\n100 97 92 12 62 17 19 58 37 26 30 95 31 35 87 10 13 43 98 61 28 89 76 1 23 21 11 22 50 56 91 74 3 24 96 55 64 67 14 4 71 16 18 9 77 68 51 81 32 82 46 88 86 60 29 66 72 85 70 7 53 63 33 45 83 2 25 94 52 93 5 69 20 47 49 54 57 39 34 27 90 80 78 59 40 42 79 6 38 8 48 15 65 73 99 44 41 84 36 75",
"output": "99"
},
{
"input": "100\n22 47 34 65 69 5 68 78 53 54 41 23 80 51 11 8 2 85 81 75 25 58 29 73 30 49 10 71 17 96 76 89 79 20 12 15 55 7 46 32 19 3 82 35 74 44 38 40 92 14 6 50 97 63 45 93 37 18 62 77 87 36 83 9 90 61 57 28 39 43 52 42 24 56 21 84 26 99 88 59 33 70 4 60 98 95 94 100 13 48 66 72 16 31 64 91 1 86 27 67",
"output": "96"
},
{
"input": "100\n41 67 94 18 14 83 59 12 19 54 13 68 75 26 15 65 80 40 23 30 34 78 47 21 63 79 4 70 3 31 86 69 92 10 61 74 97 100 9 99 32 27 91 55 85 52 16 17 28 1 64 29 58 76 98 25 84 7 2 96 20 72 36 46 49 82 93 44 45 6 38 87 57 50 53 35 60 33 8 89 39 42 37 48 62 81 73 43 95 11 66 88 90 22 24 77 71 51 5 56",
"output": "62"
},
{
"input": "100\n1 88 38 56 62 99 39 80 12 33 57 24 28 84 37 42 10 95 83 58 8 40 20 2 30 78 60 79 36 71 51 31 27 65 22 47 6 19 61 94 75 4 74 35 15 23 92 9 70 13 11 59 90 18 66 81 64 72 16 32 34 67 46 91 21 87 77 97 82 41 7 86 26 43 45 3 93 17 52 96 50 63 48 5 53 44 29 25 98 54 49 14 73 69 89 55 76 85 68 100",
"output": "99"
},
{
"input": "100\n22 59 25 77 68 79 32 45 20 28 61 60 38 86 33 10 100 15 53 75 78 39 67 13 66 34 96 4 63 23 73 29 31 35 71 55 16 14 72 56 94 97 17 93 47 84 57 8 21 51 54 85 26 76 49 81 2 92 62 44 91 87 11 24 95 69 5 7 99 6 65 48 70 12 41 18 74 27 42 3 80 30 50 98 58 37 82 89 83 36 40 52 19 9 88 46 43 1 90 64",
"output": "97"
},
{
"input": "100\n12 1 76 78 97 82 59 80 48 8 91 51 54 74 16 10 89 99 83 63 93 90 55 25 30 33 29 6 9 65 92 79 44 39 15 58 37 46 32 19 27 3 75 49 62 71 98 42 69 50 26 81 96 5 7 61 60 21 20 36 18 34 40 4 47 85 64 38 22 84 2 68 11 56 31 66 17 14 95 43 53 35 23 52 70 13 72 45 41 77 73 87 88 94 28 86 24 67 100 57",
"output": "98"
},
{
"input": "100\n66 100 53 88 7 73 54 41 31 42 8 46 65 90 78 14 94 30 79 39 89 5 83 50 38 61 37 86 22 95 60 98 34 57 91 10 75 25 15 43 23 17 96 35 93 48 87 47 56 13 19 9 82 62 67 80 11 55 99 70 18 26 58 85 12 44 16 45 4 49 20 71 92 24 81 2 76 32 6 21 84 36 52 97 59 63 40 51 27 64 68 3 77 72 28 33 29 1 74 69",
"output": "98"
},
{
"input": "100\n56 64 1 95 72 39 9 49 87 29 94 7 32 6 30 48 50 25 31 78 90 45 60 44 80 68 17 20 73 15 75 98 83 13 71 22 36 26 96 88 35 3 85 54 16 41 92 99 69 86 93 33 43 62 77 46 47 37 12 10 18 40 27 4 63 55 28 59 23 34 61 53 76 42 51 91 21 70 8 58 38 19 5 66 84 11 52 24 81 82 79 67 97 65 57 74 2 89 100 14",
"output": "98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "4\n1 2 3 4",
"output": "3"
},
{
"input": "4\n1 2 4 3",
"output": "3"
},
{
"input": "4\n1 3 2 4",
"output": "3"
},
{
"input": "4\n1 3 4 2",
"output": "3"
},
{
"input": "4\n1 4 2 3",
"output": "3"
},
{
"input": "4\n1 4 3 2",
"output": "3"
},
{
"input": "4\n2 1 3 4",
"output": "3"
},
{
"input": "4\n2 1 4 3",
"output": "2"
},
{
"input": "4\n2 4 1 3",
"output": "2"
},
{
"input": "4\n2 4 3 1",
"output": "3"
},
{
"input": "4\n3 1 2 4",
"output": "3"
},
{
"input": "4\n3 1 4 2",
"output": "2"
},
{
"input": "4\n3 2 1 4",
"output": "3"
},
{
"input": "4\n3 2 4 1",
"output": "3"
},
{
"input": "4\n3 4 1 2",
"output": "2"
},
{
"input": "4\n3 4 2 1",
"output": "3"
},
{
"input": "4\n4 1 2 3",
"output": "3"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "4\n4 2 1 3",
"output": "3"
},
{
"input": "4\n4 2 3 1",
"output": "3"
},
{
"input": "4\n4 3 1 2",
"output": "3"
},
{
"input": "4\n4 3 2 1",
"output": "3"
},
{
"input": "8\n2 5 6 4 8 3 1 7",
"output": "6"
},
{
"input": "5\n2 3 1 5 4",
"output": "3"
},
{
"input": "6\n2 5 3 6 4 1",
"output": "5"
},
{
"input": "6\n5 4 2 6 1 3",
"output": "4"
},
{
"input": "6\n4 2 3 1 6 5",
"output": "4"
},
{
"input": "6\n5 4 2 1 6 3",
"output": "4"
},
{
"input": "9\n7 2 3 4 5 6 1 9 8",
"output": "7"
},
{
"input": "6\n3 2 1 4 6 5",
"output": "4"
},
{
"input": "6\n2 3 4 1 6 5",
"output": "4"
},
{
"input": "10\n5 2 3 4 1 6 7 8 10 9",
"output": "8"
},
{
"input": "6\n5 2 3 1 6 4",
"output": "4"
},
{
"input": "10\n2 9 3 4 1 10 5 6 7 8",
"output": "5"
},
{
"input": "10\n2 3 4 5 6 7 1 8 10 9",
"output": "8"
},
{
"input": "8\n2 3 4 5 1 6 8 7",
"output": "6"
},
{
"input": "6\n2 1 3 4 5 6",
"output": "5"
}
] | 1,607,546,359
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 307,200
|
#Codeforces: solution to problem 676A. Difficulty: 900 (constructive algorithms, implementation)
#Input
n = input()
a = input()
a = a.split()
#Core
low= int()
high= int()
for i in range(int(n)):
if a[i] == '1':
low=i+1
if a[i] == n:
high=i+1
if low < high:
if (low-1) <= (int(n)-high):
print(int(n)-low)
else:
print(high-1)
else:
if (high-1) <= (int(n)-low):
print(int(n)-high)
else:
print(low-1)
print(a)
print(high)
print(low)
|
Title: Nicholas and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
Output Specification:
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
Demo Input:
['5\n4 5 1 3 2\n', '7\n1 6 5 3 4 7 2\n', '6\n6 5 4 3 2 1\n']
Demo Output:
['3\n', '6\n', '5\n']
Note:
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
|
```python
#Codeforces: solution to problem 676A. Difficulty: 900 (constructive algorithms, implementation)
#Input
n = input()
a = input()
a = a.split()
#Core
low= int()
high= int()
for i in range(int(n)):
if a[i] == '1':
low=i+1
if a[i] == n:
high=i+1
if low < high:
if (low-1) <= (int(n)-high):
print(int(n)-low)
else:
print(high-1)
else:
if (high-1) <= (int(n)-low):
print(int(n)-high)
else:
print(low-1)
print(a)
print(high)
print(low)
```
| 0
|
|
165
|
B
|
Burning Midnight Oil
|
PROGRAMMING
| 1,500
|
[
"binary search",
"implementation"
] | null | null |
One day a highly important task was commissioned to Vasya — writing a program in a night. The program consists of *n* lines of code. Vasya is already exhausted, so he works like that: first he writes *v* lines of code, drinks a cup of tea, then he writes as much as lines, drinks another cup of tea, then he writes lines and so on: , , , ...
The expression is regarded as the integral part from dividing number *a* by number *b*.
The moment the current value equals 0, Vasya immediately falls asleep and he wakes up only in the morning, when the program should already be finished.
Vasya is wondering, what minimum allowable value *v* can take to let him write not less than *n* lines of code before he falls asleep.
|
The input consists of two integers *n* and *k*, separated by spaces — the size of the program in lines and the productivity reduction coefficient, 1<=≤<=*n*<=≤<=109, 2<=≤<=*k*<=≤<=10.
|
Print the only integer — the minimum value of *v* that lets Vasya write the program in one night.
|
[
"7 2\n",
"59 9\n"
] |
[
"4\n",
"54\n"
] |
In the first sample the answer is *v* = 4. Vasya writes the code in the following portions: first 4 lines, then 2, then 1, and then Vasya falls asleep. Thus, he manages to write 4 + 2 + 1 = 7 lines in a night and complete the task.
In the second sample the answer is *v* = 54. Vasya writes the code in the following portions: 54, 6. The total sum is 54 + 6 = 60, that's even more than *n* = 59.
| 1,000
|
[
{
"input": "7 2",
"output": "4"
},
{
"input": "59 9",
"output": "54"
},
{
"input": "1 9",
"output": "1"
},
{
"input": "11 2",
"output": "7"
},
{
"input": "747 2",
"output": "376"
},
{
"input": "6578 2",
"output": "3293"
},
{
"input": "37212 2",
"output": "18609"
},
{
"input": "12357 2",
"output": "6181"
},
{
"input": "7998332 2",
"output": "3999172"
},
{
"input": "86275251 2",
"output": "43137632"
},
{
"input": "75584551 2",
"output": "37792280"
},
{
"input": "6 3",
"output": "5"
},
{
"input": "43 4",
"output": "33"
},
{
"input": "811 3",
"output": "543"
},
{
"input": "3410 4",
"output": "2560"
},
{
"input": "21341 4",
"output": "16009"
},
{
"input": "696485 4",
"output": "522368"
},
{
"input": "8856748 3",
"output": "5904504"
},
{
"input": "2959379 4",
"output": "2219538"
},
{
"input": "831410263 3",
"output": "554273516"
},
{
"input": "2 5",
"output": "2"
},
{
"input": "19 6",
"output": "17"
},
{
"input": "715 7",
"output": "615"
},
{
"input": "9122 5",
"output": "7300"
},
{
"input": "89117 6",
"output": "74268"
},
{
"input": "689973 7",
"output": "591408"
},
{
"input": "3024524 5",
"output": "2419624"
},
{
"input": "67127156 6",
"output": "55939302"
},
{
"input": "412262167 7",
"output": "353367574"
},
{
"input": "6 8",
"output": "6"
},
{
"input": "59 9",
"output": "54"
},
{
"input": "246 10",
"output": "222"
},
{
"input": "5314 8",
"output": "4651"
},
{
"input": "15309 9",
"output": "13609"
},
{
"input": "35648 10",
"output": "32085"
},
{
"input": "3018012 8",
"output": "2640764"
},
{
"input": "92153348 9",
"output": "81914089"
},
{
"input": "177583558 10",
"output": "159825206"
},
{
"input": "1000000000 2",
"output": "500000008"
},
{
"input": "1000000000 3",
"output": "666666672"
},
{
"input": "1000000000 4",
"output": "750000005"
},
{
"input": "1000000000 5",
"output": "800000003"
},
{
"input": "1000000000 6",
"output": "833333338"
},
{
"input": "1000000000 7",
"output": "857142861"
},
{
"input": "1000000000 8",
"output": "875000004"
},
{
"input": "1000000000 9",
"output": "888888894"
},
{
"input": "1000000000 10",
"output": "900000001"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 10",
"output": "2"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "6 8",
"output": "6"
},
{
"input": "987862820 9",
"output": "878100288"
},
{
"input": "979591791 9",
"output": "870748262"
},
{
"input": "948889213 9",
"output": "843457081"
},
{
"input": "8 9",
"output": "8"
},
{
"input": "999999999 10",
"output": "900000000"
}
] | 1,674,447,153
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 4
| 122
| 0
|
def first_match(n,k,start,end,decide):
res = -1
while start <=end :
mid = (start+end)//2
if decide(n,k,mid):
res = mid
end = mid -1
else :
start = mid +1
return res
def decide(n,k,tst):
wrote = tst
while wrote < n :
today = tst // ( k )
if today == 0 :
return False
wrote += today
k *=k
return True
n,k = map(int,input().split())
print(first_match(n,k,1,n,decide))
|
Title: Burning Midnight Oil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day a highly important task was commissioned to Vasya — writing a program in a night. The program consists of *n* lines of code. Vasya is already exhausted, so he works like that: first he writes *v* lines of code, drinks a cup of tea, then he writes as much as lines, drinks another cup of tea, then he writes lines and so on: , , , ...
The expression is regarded as the integral part from dividing number *a* by number *b*.
The moment the current value equals 0, Vasya immediately falls asleep and he wakes up only in the morning, when the program should already be finished.
Vasya is wondering, what minimum allowable value *v* can take to let him write not less than *n* lines of code before he falls asleep.
Input Specification:
The input consists of two integers *n* and *k*, separated by spaces — the size of the program in lines and the productivity reduction coefficient, 1<=≤<=*n*<=≤<=109, 2<=≤<=*k*<=≤<=10.
Output Specification:
Print the only integer — the minimum value of *v* that lets Vasya write the program in one night.
Demo Input:
['7 2\n', '59 9\n']
Demo Output:
['4\n', '54\n']
Note:
In the first sample the answer is *v* = 4. Vasya writes the code in the following portions: first 4 lines, then 2, then 1, and then Vasya falls asleep. Thus, he manages to write 4 + 2 + 1 = 7 lines in a night and complete the task.
In the second sample the answer is *v* = 54. Vasya writes the code in the following portions: 54, 6. The total sum is 54 + 6 = 60, that's even more than *n* = 59.
|
```python
def first_match(n,k,start,end,decide):
res = -1
while start <=end :
mid = (start+end)//2
if decide(n,k,mid):
res = mid
end = mid -1
else :
start = mid +1
return res
def decide(n,k,tst):
wrote = tst
while wrote < n :
today = tst // ( k )
if today == 0 :
return False
wrote += today
k *=k
return True
n,k = map(int,input().split())
print(first_match(n,k,1,n,decide))
```
| 0
|
|
215
|
A
|
Bicycle Chain
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
|
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
|
[
"2\n4 5\n3\n12 13 15\n",
"4\n1 2 3 4\n5\n10 11 12 13 14\n"
] |
[
"2\n",
"1\n"
] |
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
| 500
|
[
{
"input": "2\n4 5\n3\n12 13 15",
"output": "2"
},
{
"input": "4\n1 2 3 4\n5\n10 11 12 13 14",
"output": "1"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n2\n1 2",
"output": "1"
},
{
"input": "4\n3 7 11 13\n4\n51 119 187 221",
"output": "4"
},
{
"input": "4\n2 3 4 5\n3\n1 2 3",
"output": "2"
},
{
"input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97",
"output": "1"
},
{
"input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28",
"output": "1"
},
{
"input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958",
"output": "1"
},
{
"input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20",
"output": "1"
},
{
"input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50",
"output": "1"
},
{
"input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38",
"output": "4"
},
{
"input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100",
"output": "1"
},
{
"input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149",
"output": "1"
},
{
"input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193",
"output": "1"
},
{
"input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245",
"output": "1"
},
{
"input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298",
"output": "1"
},
{
"input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350",
"output": "1"
},
{
"input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388",
"output": "1"
},
{
"input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999",
"output": "8"
},
{
"input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813",
"output": "3"
},
{
"input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217",
"output": "3"
},
{
"input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555",
"output": "8"
},
{
"input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345",
"output": "20"
},
{
"input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735",
"output": "23"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968",
"output": "12"
},
{
"input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706",
"output": "1"
},
{
"input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394",
"output": "1"
},
{
"input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284",
"output": "1"
},
{
"input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790",
"output": "4"
},
{
"input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902",
"output": "17"
},
{
"input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991",
"output": "28"
},
{
"input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862",
"output": "15"
},
{
"input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691",
"output": "8"
},
{
"input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673",
"output": "38"
},
{
"input": "3\n3 4 5\n3\n6 20 25",
"output": "2"
},
{
"input": "4\n2 3 5 8\n4\n2 6 8 10",
"output": "1"
},
{
"input": "4\n3 5 7 11\n4\n3 5 7 22",
"output": "1"
},
{
"input": "2\n2 3\n3\n20 30 50",
"output": "1"
},
{
"input": "3\n1 2 3\n4\n2 4 6 49",
"output": "1"
},
{
"input": "2\n4 5\n3\n12 15 20",
"output": "1"
},
{
"input": "3\n2 5 7\n3\n4 5 7",
"output": "1"
},
{
"input": "3\n3 5 8\n3\n6 8 10",
"output": "2"
},
{
"input": "2\n2 3\n4\n4 6 9 33",
"output": "1"
},
{
"input": "2\n2 3\n4\n4 6 21 40",
"output": "1"
},
{
"input": "3\n4 9 10\n3\n8 9 10",
"output": "1"
},
{
"input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000",
"output": "1"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14",
"output": "1"
}
] | 1,690,814,353
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 92
| 0
|
n = int(input())
p = input().split()
a = [int(i) for i in p]
m = int(input())
q = input().split()
b = [int(i) for i in q]
c = []
for i in a:
for j in b:
if int(j/i) == j/i:
c.append(j/i)
k=0
for i in c:
if i == max(c):
k+=1
print(k)
|
Title: Bicycle Chain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Output Specification:
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
Demo Input:
['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
|
```python
n = int(input())
p = input().split()
a = [int(i) for i in p]
m = int(input())
q = input().split()
b = [int(i) for i in q]
c = []
for i in a:
for j in b:
if int(j/i) == j/i:
c.append(j/i)
k=0
for i in c:
if i == max(c):
k+=1
print(k)
```
| 3
|
|
702
|
A
|
Maximum Increase
|
PROGRAMMING
| 800
|
[
"dp",
"greedy",
"implementation"
] | null | null |
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
|
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print the maximum length of an increasing subarray of the given array.
|
[
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] |
[
"3\n",
"1\n",
"3\n"
] |
none
| 0
|
[
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,657,551,117
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
n = int(input())
x = [int(x) for x in input().split()]
cnt = 0
j = 1
for i in range(1,len(x)):
if x[i-1] < x[i]:
cnt = cnt + 1
print(cnt+1)
|
Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none
|
```python
n = int(input())
x = [int(x) for x in input().split()]
cnt = 0
j = 1
for i in range(1,len(x)):
if x[i-1] < x[i]:
cnt = cnt + 1
print(cnt+1)
```
| 0
|
|
719
|
A
|
Vitya in the Countryside
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Every summer Vitya comes to visit his grandmother in the countryside. This summer, he got a huge wart. Every grandma knows that one should treat warts when the moon goes down. Thus, Vitya has to catch the moment when the moon is down.
Moon cycle lasts 30 days. The size of the visible part of the moon (in Vitya's units) for each day is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, and then cycle repeats, thus after the second 1 again goes 0.
As there is no internet in the countryside, Vitya has been watching the moon for *n* consecutive days and for each of these days he wrote down the size of the visible part of the moon. Help him find out whether the moon will be up or down next day, or this cannot be determined by the data he has.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=92) — the number of consecutive days Vitya was watching the size of the visible part of the moon.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=15) — Vitya's records.
It's guaranteed that the input data is consistent.
|
If Vitya can be sure that the size of visible part of the moon on day *n*<=+<=1 will be less than the size of the visible part on day *n*, then print "DOWN" at the only line of the output. If he might be sure that the size of the visible part will increase, then print "UP". If it's impossible to determine what exactly will happen with the moon, print -1.
|
[
"5\n3 4 5 6 7\n",
"7\n12 13 14 15 14 13 12\n",
"1\n8\n"
] |
[
"UP\n",
"DOWN\n",
"-1\n"
] |
In the first sample, the size of the moon on the next day will be equal to 8, thus the answer is "UP".
In the second sample, the size of the moon on the next day will be 11, thus the answer is "DOWN".
In the third sample, there is no way to determine whether the size of the moon on the next day will be 7 or 9, thus the answer is -1.
| 500
|
[
{
"input": "5\n3 4 5 6 7",
"output": "UP"
},
{
"input": "7\n12 13 14 15 14 13 12",
"output": "DOWN"
},
{
"input": "1\n8",
"output": "-1"
},
{
"input": "44\n7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10",
"output": "DOWN"
},
{
"input": "92\n3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4",
"output": "UP"
},
{
"input": "6\n10 11 12 13 14 15",
"output": "DOWN"
},
{
"input": "27\n11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15",
"output": "DOWN"
},
{
"input": "6\n8 7 6 5 4 3",
"output": "DOWN"
},
{
"input": "27\n14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10",
"output": "UP"
},
{
"input": "79\n7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5",
"output": "DOWN"
},
{
"input": "25\n1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7",
"output": "DOWN"
},
{
"input": "21\n3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7",
"output": "DOWN"
},
{
"input": "56\n1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6",
"output": "DOWN"
},
{
"input": "19\n4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14",
"output": "UP"
},
{
"input": "79\n5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13",
"output": "UP"
},
{
"input": "87\n14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10",
"output": "UP"
},
{
"input": "13\n10 9 8 7 6 5 4 3 2 1 0 1 2",
"output": "UP"
},
{
"input": "2\n8 9",
"output": "UP"
},
{
"input": "3\n10 11 12",
"output": "UP"
},
{
"input": "1\n1",
"output": "-1"
},
{
"input": "1\n2",
"output": "-1"
},
{
"input": "1\n3",
"output": "-1"
},
{
"input": "1\n4",
"output": "-1"
},
{
"input": "1\n5",
"output": "-1"
},
{
"input": "1\n6",
"output": "-1"
},
{
"input": "1\n7",
"output": "-1"
},
{
"input": "1\n9",
"output": "-1"
},
{
"input": "1\n10",
"output": "-1"
},
{
"input": "1\n11",
"output": "-1"
},
{
"input": "1\n12",
"output": "-1"
},
{
"input": "1\n13",
"output": "-1"
},
{
"input": "1\n14",
"output": "-1"
},
{
"input": "1\n15",
"output": "DOWN"
},
{
"input": "1\n0",
"output": "UP"
},
{
"input": "3\n11 12 13",
"output": "UP"
},
{
"input": "2\n10 9",
"output": "DOWN"
},
{
"input": "92\n10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11",
"output": "UP"
},
{
"input": "92\n7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6",
"output": "DOWN"
},
{
"input": "2\n14 15",
"output": "DOWN"
},
{
"input": "2\n1 0",
"output": "UP"
},
{
"input": "2\n15 14",
"output": "DOWN"
},
{
"input": "92\n7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8",
"output": "UP"
},
{
"input": "92\n13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12",
"output": "DOWN"
},
{
"input": "92\n4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3",
"output": "DOWN"
},
{
"input": "92\n14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15",
"output": "DOWN"
},
{
"input": "92\n1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0",
"output": "UP"
},
{
"input": "2\n2 1",
"output": "DOWN"
},
{
"input": "3\n2 1 0",
"output": "UP"
},
{
"input": "5\n4 3 2 1 0",
"output": "UP"
},
{
"input": "2\n5 4",
"output": "DOWN"
},
{
"input": "4\n3 2 1 0",
"output": "UP"
},
{
"input": "3\n13 12 11",
"output": "DOWN"
},
{
"input": "2\n1 2",
"output": "UP"
},
{
"input": "2\n0 1",
"output": "UP"
},
{
"input": "2\n13 14",
"output": "UP"
},
{
"input": "14\n13 12 11 10 9 8 7 6 5 4 3 2 1 0",
"output": "UP"
}
] | 1,474,636,466
| 566
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 2
| 61
| 0
|
n = int(input())
zikl = [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1] * 2
l = list(map(int, input().split()))
if n == 1:
if l[0] == 0:
print("UP")
else:
print(-1)
for i in range(len(zikl)):
curr = 0
for j in range(len(l)):
if zikl[i + j] == l[j]:
curr += 1
if curr == n:
if zikl[i + n] > zikl[i + n - 1]:
print("UP")
exit()
else:
print("DOWN")
exit()
|
Title: Vitya in the Countryside
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Every summer Vitya comes to visit his grandmother in the countryside. This summer, he got a huge wart. Every grandma knows that one should treat warts when the moon goes down. Thus, Vitya has to catch the moment when the moon is down.
Moon cycle lasts 30 days. The size of the visible part of the moon (in Vitya's units) for each day is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, and then cycle repeats, thus after the second 1 again goes 0.
As there is no internet in the countryside, Vitya has been watching the moon for *n* consecutive days and for each of these days he wrote down the size of the visible part of the moon. Help him find out whether the moon will be up or down next day, or this cannot be determined by the data he has.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=92) — the number of consecutive days Vitya was watching the size of the visible part of the moon.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=15) — Vitya's records.
It's guaranteed that the input data is consistent.
Output Specification:
If Vitya can be sure that the size of visible part of the moon on day *n*<=+<=1 will be less than the size of the visible part on day *n*, then print "DOWN" at the only line of the output. If he might be sure that the size of the visible part will increase, then print "UP". If it's impossible to determine what exactly will happen with the moon, print -1.
Demo Input:
['5\n3 4 5 6 7\n', '7\n12 13 14 15 14 13 12\n', '1\n8\n']
Demo Output:
['UP\n', 'DOWN\n', '-1\n']
Note:
In the first sample, the size of the moon on the next day will be equal to 8, thus the answer is "UP".
In the second sample, the size of the moon on the next day will be 11, thus the answer is "DOWN".
In the third sample, there is no way to determine whether the size of the moon on the next day will be 7 or 9, thus the answer is -1.
|
```python
n = int(input())
zikl = [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1] * 2
l = list(map(int, input().split()))
if n == 1:
if l[0] == 0:
print("UP")
else:
print(-1)
for i in range(len(zikl)):
curr = 0
for j in range(len(l)):
if zikl[i + j] == l[j]:
curr += 1
if curr == n:
if zikl[i + n] > zikl[i + n - 1]:
print("UP")
exit()
else:
print("DOWN")
exit()
```
| 0
|
|
99
|
A
|
Help Far Away Kingdom
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Help Far Away Kingdom
|
2
|
256
|
In a far away kingdom lived the King, the Prince, the Shoemaker, the Dressmaker and many other citizens. They lived happily until great trouble came into the Kingdom. The ACMers settled there.
Most damage those strange creatures inflicted upon the kingdom was that they loved high precision numbers. As a result, the Kingdom healers had already had three appointments with the merchants who were asked to sell, say, exactly 0.273549107 beer barrels. To deal with the problem somehow, the King issued an order obliging rounding up all numbers to the closest integer to simplify calculations. Specifically, the order went like this:
- If a number's integer part does not end with digit 9 and its fractional part is strictly less than 0.5, then the rounded up number coincides with the number’s integer part. - If a number's integer part does not end with digit 9 and its fractional part is not less than 0.5, the rounded up number is obtained if we add 1 to the last digit of the number’s integer part.- If the number’s integer part ends with digit 9, to round up the numbers one should go to Vasilisa the Wise. In the whole Kingdom she is the only one who can perform the tricky operation of carrying into the next position.
Merchants found the algorithm very sophisticated and they asked you (the ACMers) to help them. Can you write a program that would perform the rounding according to the King’s order?
|
The first line contains a single number to round up — the integer part (a non-empty set of decimal digits that do not start with 0 — with the exception of a case when the set consists of a single digit — in this case 0 can go first), then follows character «.» (a dot), and then follows the fractional part (any non-empty set of decimal digits). The number's length does not exceed 1000 characters, including the dot. There are no other characters in the input data.
|
If the last number of the integer part is not equal to 9, print the rounded-up number without leading zeroes. Otherwise, print the message "GOTO Vasilisa." (without the quotes).
|
[
"0.0\n",
"1.49\n",
"1.50\n",
"2.71828182845904523536\n",
"3.14159265358979323846\n",
"12345678901234567890.1\n",
"123456789123456789.999\n"
] |
[
"0",
"1",
"2",
"3",
"3",
"12345678901234567890",
"GOTO Vasilisa."
] |
none
| 500
|
[
{
"input": "0.0",
"output": "0"
},
{
"input": "1.49",
"output": "1"
},
{
"input": "1.50",
"output": "2"
},
{
"input": "2.71828182845904523536",
"output": "3"
},
{
"input": "3.14159265358979323846",
"output": "3"
},
{
"input": "12345678901234567890.1",
"output": "12345678901234567890"
},
{
"input": "123456789123456789.999",
"output": "GOTO Vasilisa."
},
{
"input": "12345678901234567890.9",
"output": "12345678901234567891"
},
{
"input": "123456789123456788.999",
"output": "123456789123456789"
},
{
"input": "9.000",
"output": "GOTO Vasilisa."
},
{
"input": "0.1",
"output": "0"
},
{
"input": "0.2",
"output": "0"
},
{
"input": "0.3",
"output": "0"
},
{
"input": "0.4",
"output": "0"
},
{
"input": "0.5",
"output": "1"
},
{
"input": "0.6",
"output": "1"
},
{
"input": "0.7",
"output": "1"
},
{
"input": "0.8",
"output": "1"
},
{
"input": "0.9",
"output": "1"
},
{
"input": "1.0",
"output": "1"
},
{
"input": "1.1",
"output": "1"
},
{
"input": "1.2",
"output": "1"
},
{
"input": "1.3",
"output": "1"
},
{
"input": "1.4",
"output": "1"
},
{
"input": "1.5",
"output": "2"
},
{
"input": "1.6",
"output": "2"
},
{
"input": "1.7",
"output": "2"
},
{
"input": "1.8",
"output": "2"
},
{
"input": "1.9",
"output": "2"
},
{
"input": "2.0",
"output": "2"
},
{
"input": "2.1",
"output": "2"
},
{
"input": "2.2",
"output": "2"
},
{
"input": "2.3",
"output": "2"
},
{
"input": "2.4",
"output": "2"
},
{
"input": "2.5",
"output": "3"
},
{
"input": "2.6",
"output": "3"
},
{
"input": "2.7",
"output": "3"
},
{
"input": "2.8",
"output": "3"
},
{
"input": "2.9",
"output": "3"
},
{
"input": "3.0",
"output": "3"
},
{
"input": "3.1",
"output": "3"
},
{
"input": "3.2",
"output": "3"
},
{
"input": "3.3",
"output": "3"
},
{
"input": "3.4",
"output": "3"
},
{
"input": "3.5",
"output": "4"
},
{
"input": "3.6",
"output": "4"
},
{
"input": "3.7",
"output": "4"
},
{
"input": "3.8",
"output": "4"
},
{
"input": "3.9",
"output": "4"
},
{
"input": "4.0",
"output": "4"
},
{
"input": "4.1",
"output": "4"
},
{
"input": "4.2",
"output": "4"
},
{
"input": "4.3",
"output": "4"
},
{
"input": "4.4",
"output": "4"
},
{
"input": "4.5",
"output": "5"
},
{
"input": "4.6",
"output": "5"
},
{
"input": "4.7",
"output": "5"
},
{
"input": "4.8",
"output": "5"
},
{
"input": "4.9",
"output": "5"
},
{
"input": "5.0",
"output": "5"
},
{
"input": "5.1",
"output": "5"
},
{
"input": "5.2",
"output": "5"
},
{
"input": "5.3",
"output": "5"
},
{
"input": "5.4",
"output": "5"
},
{
"input": "5.5",
"output": "6"
},
{
"input": "5.6",
"output": "6"
},
{
"input": "5.7",
"output": "6"
},
{
"input": "5.8",
"output": "6"
},
{
"input": "5.9",
"output": "6"
},
{
"input": "6.0",
"output": "6"
},
{
"input": "6.1",
"output": "6"
},
{
"input": "6.2",
"output": "6"
},
{
"input": "6.3",
"output": "6"
},
{
"input": "6.4",
"output": "6"
},
{
"input": "6.5",
"output": "7"
},
{
"input": "6.6",
"output": "7"
},
{
"input": "6.7",
"output": "7"
},
{
"input": "6.8",
"output": "7"
},
{
"input": "6.9",
"output": "7"
},
{
"input": "7.0",
"output": "7"
},
{
"input": "7.1",
"output": "7"
},
{
"input": "7.2",
"output": "7"
},
{
"input": "7.3",
"output": "7"
},
{
"input": "7.4",
"output": "7"
},
{
"input": "7.5",
"output": "8"
},
{
"input": "7.6",
"output": "8"
},
{
"input": "7.7",
"output": "8"
},
{
"input": "7.8",
"output": "8"
},
{
"input": "7.9",
"output": "8"
},
{
"input": "8.0",
"output": "8"
},
{
"input": "8.1",
"output": "8"
},
{
"input": "8.2",
"output": "8"
},
{
"input": "8.3",
"output": "8"
},
{
"input": "8.4",
"output": "8"
},
{
"input": "8.5",
"output": "9"
},
{
"input": "8.6",
"output": "9"
},
{
"input": "8.7",
"output": "9"
},
{
"input": "8.8",
"output": "9"
},
{
"input": "8.9",
"output": "9"
},
{
"input": "9.0",
"output": "GOTO Vasilisa."
},
{
"input": "9.1",
"output": "GOTO Vasilisa."
},
{
"input": "9.2",
"output": "GOTO Vasilisa."
},
{
"input": "9.3",
"output": "GOTO Vasilisa."
},
{
"input": "9.4",
"output": "GOTO Vasilisa."
},
{
"input": "9.5",
"output": "GOTO Vasilisa."
},
{
"input": "9.6",
"output": "GOTO Vasilisa."
},
{
"input": "9.7",
"output": "GOTO Vasilisa."
},
{
"input": "9.8",
"output": "GOTO Vasilisa."
},
{
"input": "9.9",
"output": "GOTO Vasilisa."
},
{
"input": "609942239104813108618306232517836377583566292129955473517174437591594761209877970062547641606473593416245554763832875919009472288995880898848455284062760160557686724163817329189799336769669146848904803188614226720978399787805489531837751080926098.1664915772983166314490532653577560222779830866949001942720729759794777105570672781798092416748052690224813237139640723361527601154465287615917169132637313918577673651098507390501962",
"output": "609942239104813108618306232517836377583566292129955473517174437591594761209877970062547641606473593416245554763832875919009472288995880898848455284062760160557686724163817329189799336769669146848904803188614226720978399787805489531837751080926098"
},
{
"input": "7002108534951820589946967018226114921984364117669853212254634761258884835434844673935047882480101006606512119541798298905598015607366335061012709906661245805358900665571472645463994925687210711492820804158354236327017974683658305043146543214454877759341394.20211856263503281388748282682120712214711232598021393495443628276945042110862480888110959179019986486690931930108026302665438087068150666835901617457150158918705186964935221768346957536540345814875615118637945520917367155931078965",
"output": "7002108534951820589946967018226114921984364117669853212254634761258884835434844673935047882480101006606512119541798298905598015607366335061012709906661245805358900665571472645463994925687210711492820804158354236327017974683658305043146543214454877759341394"
},
{
"input": "1950583094879039694852660558765931995628486712128191844305265555887022812284005463780616067.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1950583094879039694852660558765931995628486712128191844305265555887022812284005463780616068"
},
{
"input": "718130341896330596635811874410345440628950330.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "718130341896330596635811874410345440628950331"
},
{
"input": "927925904158088313481229162503626281882161630091489367140850985555900173018122871746924067186432044676083646964286435457446768031295712712803570690846298544912543439221596866052681116386179629036945370280722.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "927925904158088313481229162503626281882161630091489367140850985555900173018122871746924067186432044676083646964286435457446768031295712712803570690846298544912543439221596866052681116386179629036945370280723"
},
{
"input": "68289614863244584294178637364598054554769889.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "GOTO Vasilisa."
},
{
"input": "7536521504744364134984603189602839063535643888645969434165019366202558753840519.4999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999",
"output": "GOTO Vasilisa."
},
{
"input": "646188694587964249318078225173.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "646188694587964249318078225174"
},
{
"input": "7017472758334494297677068672222822550374695787171163207025095950296957261530.50",
"output": "7017472758334494297677068672222822550374695787171163207025095950296957261531"
},
{
"input": "259085737066615534998640212505663524594409165063310128108448186246980628179842202905722595400477937071746695941939306735605849342959111887834258250883469840846714848774368.50000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "259085737066615534998640212505663524594409165063310128108448186246980628179842202905722595400477937071746695941939306735605849342959111887834258250883469840846714848774369"
},
{
"input": "682500858233333594535201113441004740771119672961581796618069185960107115823662126812159957094407454522028503739299.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "GOTO Vasilisa."
},
{
"input": "41203422675619090661099806687619.49999999999999999999999999999999999999999999999999999999999999999999999999999999999999999",
"output": "GOTO Vasilisa."
}
] | 1,598,940,743
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 150
| 248
| 0
|
def q99a():
num = input()
dot_loc = num.index('.')
if(num[dot_loc-1] == '9'):
print("GOTO Vasilisa.")
else:
if(int(num[dot_loc+1]) < 5):
print(num[:dot_loc])
else:
print(num[:dot_loc-1], end='')
print(int(num[dot_loc-1])+1)
# num = float(input())
# num_rounded = round(num)
# if(int(num) % 10 != 9):
# print(num_rounded)
# else:
# print("GOTO Vasilisa.")
q99a()
|
Title: Help Far Away Kingdom
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In a far away kingdom lived the King, the Prince, the Shoemaker, the Dressmaker and many other citizens. They lived happily until great trouble came into the Kingdom. The ACMers settled there.
Most damage those strange creatures inflicted upon the kingdom was that they loved high precision numbers. As a result, the Kingdom healers had already had three appointments with the merchants who were asked to sell, say, exactly 0.273549107 beer barrels. To deal with the problem somehow, the King issued an order obliging rounding up all numbers to the closest integer to simplify calculations. Specifically, the order went like this:
- If a number's integer part does not end with digit 9 and its fractional part is strictly less than 0.5, then the rounded up number coincides with the number’s integer part. - If a number's integer part does not end with digit 9 and its fractional part is not less than 0.5, the rounded up number is obtained if we add 1 to the last digit of the number’s integer part.- If the number’s integer part ends with digit 9, to round up the numbers one should go to Vasilisa the Wise. In the whole Kingdom she is the only one who can perform the tricky operation of carrying into the next position.
Merchants found the algorithm very sophisticated and they asked you (the ACMers) to help them. Can you write a program that would perform the rounding according to the King’s order?
Input Specification:
The first line contains a single number to round up — the integer part (a non-empty set of decimal digits that do not start with 0 — with the exception of a case when the set consists of a single digit — in this case 0 can go first), then follows character «.» (a dot), and then follows the fractional part (any non-empty set of decimal digits). The number's length does not exceed 1000 characters, including the dot. There are no other characters in the input data.
Output Specification:
If the last number of the integer part is not equal to 9, print the rounded-up number without leading zeroes. Otherwise, print the message "GOTO Vasilisa." (without the quotes).
Demo Input:
['0.0\n', '1.49\n', '1.50\n', '2.71828182845904523536\n', '3.14159265358979323846\n', '12345678901234567890.1\n', '123456789123456789.999\n']
Demo Output:
['0', '1', '2', '3', '3', '12345678901234567890', 'GOTO Vasilisa.']
Note:
none
|
```python
def q99a():
num = input()
dot_loc = num.index('.')
if(num[dot_loc-1] == '9'):
print("GOTO Vasilisa.")
else:
if(int(num[dot_loc+1]) < 5):
print(num[:dot_loc])
else:
print(num[:dot_loc-1], end='')
print(int(num[dot_loc-1])+1)
# num = float(input())
# num_rounded = round(num)
# if(int(num) % 10 != 9):
# print(num_rounded)
# else:
# print("GOTO Vasilisa.")
q99a()
```
| 3.938
|
431
|
C
|
k-Tree
|
PROGRAMMING
| 1,600
|
[
"dp",
"implementation",
"trees"
] | null | null |
Quite recently a creative student Lesha had a lecture on trees. After the lecture Lesha was inspired and came up with the tree of his own which he called a *k*-tree.
A *k*-tree is an infinite rooted tree where:
- each vertex has exactly *k* children; - each edge has some weight; - if we look at the edges that goes from some vertex to its children (exactly *k* edges), then their weights will equal 1,<=2,<=3,<=...,<=*k*.
The picture below shows a part of a 3-tree.
Help Dima find an answer to his question. As the number of ways can be rather large, print it modulo 1000000007 (109<=+<=7).
|
A single line contains three space-separated integers: *n*, *k* and *d* (1<=≤<=*n*,<=*k*<=≤<=100; 1<=≤<=*d*<=≤<=*k*).
|
Print a single integer — the answer to the problem modulo 1000000007 (109<=+<=7).
|
[
"3 3 2\n",
"3 3 3\n",
"4 3 2\n",
"4 5 2\n"
] |
[
"3\n",
"1\n",
"6\n",
"7\n"
] |
none
| 1,500
|
[
{
"input": "3 3 2",
"output": "3"
},
{
"input": "3 3 3",
"output": "1"
},
{
"input": "4 3 2",
"output": "6"
},
{
"input": "4 5 2",
"output": "7"
},
{
"input": "28 6 3",
"output": "110682188"
},
{
"input": "5 100 1",
"output": "16"
},
{
"input": "50 6 3",
"output": "295630102"
},
{
"input": "10 13 6",
"output": "48"
},
{
"input": "20 16 14",
"output": "236"
},
{
"input": "1 10 1",
"output": "1"
},
{
"input": "8 11 4",
"output": "47"
},
{
"input": "16 5 4",
"output": "16175"
},
{
"input": "5 26 17",
"output": "0"
},
{
"input": "35 47 42",
"output": "0"
},
{
"input": "11 6 2",
"output": "975"
},
{
"input": "54 60 16",
"output": "931055544"
},
{
"input": "47 5 1",
"output": "164058640"
},
{
"input": "70 6 1",
"output": "592826579"
},
{
"input": "40 77 77",
"output": "0"
},
{
"input": "96 9 6",
"output": "362487247"
},
{
"input": "52 46 4",
"output": "27907693"
},
{
"input": "74 41 28",
"output": "806604424"
},
{
"input": "100 100 100",
"output": "1"
},
{
"input": "99 99 5",
"output": "700732369"
},
{
"input": "100 100 1",
"output": "988185646"
},
{
"input": "98 98 64",
"output": "237643149"
},
{
"input": "28 74 2",
"output": "134217727"
},
{
"input": "86 69 62",
"output": "217513984"
},
{
"input": "9 17 14",
"output": "0"
},
{
"input": "73 72 12",
"output": "426374014"
},
{
"input": "41 98 76",
"output": "0"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "1 100 100",
"output": "0"
},
{
"input": "1 100 1",
"output": "1"
},
{
"input": "1 100 2",
"output": "0"
},
{
"input": "2 100 2",
"output": "1"
},
{
"input": "2 100 1",
"output": "2"
},
{
"input": "50 50 1",
"output": "949480669"
},
{
"input": "100 50 50",
"output": "661237556"
},
{
"input": "3 2 2",
"output": "2"
},
{
"input": "100 50 3",
"output": "494224664"
},
{
"input": "90 97 24",
"output": "413496885"
},
{
"input": "31 8 8",
"output": "52532592"
},
{
"input": "78 90 38",
"output": "744021655"
},
{
"input": "100 13 11",
"output": "883875774"
},
{
"input": "100 45 8",
"output": "367847193"
},
{
"input": "31 8 4",
"output": "924947104"
},
{
"input": "35 95 9",
"output": "927164672"
},
{
"input": "45 5 3",
"output": "252804490"
},
{
"input": "1 5 5",
"output": "0"
},
{
"input": "89 75 59",
"output": "179807625"
},
{
"input": "90 100 30",
"output": "697322870"
},
{
"input": "89 73 32",
"output": "152673180"
},
{
"input": "100 90 80",
"output": "11531520"
}
] | 1,685,208,445
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 93
| 3,686,400
|
n,k,d=map(int,input().split())
mod=10**9+7
from functools import lru_cache
@lru_cache(maxsize=None)
def calc(x,flag):
if x==0:
return flag
ANS=0
for i in range(1,k+1):
if x>=i:
if i>=d:
ANS+=calc(x-i,1)
else:
ANS+=calc(x-i,flag)
else:
break
return ANS%mod
print(calc(n,0))
|
Title: k-Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Quite recently a creative student Lesha had a lecture on trees. After the lecture Lesha was inspired and came up with the tree of his own which he called a *k*-tree.
A *k*-tree is an infinite rooted tree where:
- each vertex has exactly *k* children; - each edge has some weight; - if we look at the edges that goes from some vertex to its children (exactly *k* edges), then their weights will equal 1,<=2,<=3,<=...,<=*k*.
The picture below shows a part of a 3-tree.
Help Dima find an answer to his question. As the number of ways can be rather large, print it modulo 1000000007 (109<=+<=7).
Input Specification:
A single line contains three space-separated integers: *n*, *k* and *d* (1<=≤<=*n*,<=*k*<=≤<=100; 1<=≤<=*d*<=≤<=*k*).
Output Specification:
Print a single integer — the answer to the problem modulo 1000000007 (109<=+<=7).
Demo Input:
['3 3 2\n', '3 3 3\n', '4 3 2\n', '4 5 2\n']
Demo Output:
['3\n', '1\n', '6\n', '7\n']
Note:
none
|
```python
n,k,d=map(int,input().split())
mod=10**9+7
from functools import lru_cache
@lru_cache(maxsize=None)
def calc(x,flag):
if x==0:
return flag
ANS=0
for i in range(1,k+1):
if x>=i:
if i>=d:
ANS+=calc(x-i,1)
else:
ANS+=calc(x-i,flag)
else:
break
return ANS%mod
print(calc(n,0))
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,623,203,584
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 498
| 5,939,200
|
from typing import Counter
n=int(input())
l=list(map(int,input().split()))
c=Counter(l)
if ((1 in c) or (3 in c) or (5 in c)) and ((2 in c) or (4 in c)):
print(0)
elif ((1 in c) or (3 in c) or (5 in c)):
print(3)
else:
print(2)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
from typing import Counter
n=int(input())
l=list(map(int,input().split()))
c=Counter(l)
if ((1 in c) or (3 in c) or (5 in c)) and ((2 in c) or (4 in c)):
print(0)
elif ((1 in c) or (3 in c) or (5 in c)):
print(3)
else:
print(2)
```
| 0
|
|
344
|
A
|
Magnets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other.
Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own.
Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.
|
On the single line of the output print the number of groups of magnets.
|
[
"6\n10\n10\n10\n01\n10\n10\n",
"4\n01\n01\n10\n10\n"
] |
[
"3\n",
"2\n"
] |
The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets.
The second testcase has two groups, each consisting of two magnets.
| 500
|
[
{
"input": "6\n10\n10\n10\n01\n10\n10",
"output": "3"
},
{
"input": "4\n01\n01\n10\n10",
"output": "2"
},
{
"input": "1\n10",
"output": "1"
},
{
"input": "2\n01\n10",
"output": "2"
},
{
"input": "2\n10\n10",
"output": "1"
},
{
"input": "3\n10\n01\n10",
"output": "3"
},
{
"input": "1\n01",
"output": "1"
},
{
"input": "2\n01\n01",
"output": "1"
},
{
"input": "2\n10\n01",
"output": "2"
},
{
"input": "3\n01\n01\n01",
"output": "1"
},
{
"input": "3\n10\n10\n01",
"output": "2"
},
{
"input": "3\n01\n10\n10",
"output": "2"
},
{
"input": "115\n10\n10\n10\n10\n01\n01\n10\n10\n10\n01\n01\n10\n01\n01\n10\n10\n10\n01\n10\n01\n10\n10\n01\n01\n10\n10\n10\n10\n01\n10\n01\n01\n10\n10\n10\n10\n01\n10\n10\n10\n01\n10\n01\n10\n10\n10\n10\n01\n01\n01\n10\n10\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n01\n10\n01\n10\n10\n01\n01\n01\n10\n01\n01\n10\n10\n01\n01\n01\n01\n01\n10\n01\n10\n01\n10\n01\n01\n01\n10\n01\n10\n10\n01\n10\n10\n01\n01\n01\n10\n10\n10\n10\n10\n10\n10\n10",
"output": "55"
}
] | 1,698,394,532
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
n = int(input())
a = []
for i in range(n):
b = input()
a.append(b[0])
print(a.count(0) + 1)
|
Title: Magnets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other.
Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own.
Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.
Output Specification:
On the single line of the output print the number of groups of magnets.
Demo Input:
['6\n10\n10\n10\n01\n10\n10\n', '4\n01\n01\n10\n10\n']
Demo Output:
['3\n', '2\n']
Note:
The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets.
The second testcase has two groups, each consisting of two magnets.
|
```python
n = int(input())
a = []
for i in range(n):
b = input()
a.append(b[0])
print(a.count(0) + 1)
```
| 0
|
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,588,566,173
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 186
| 0
|
s=input()
l=[0]*26
m=0
for i in s:
k=ord(i)-97
l[k]+=1
if l[k]>l[m] or (l[k]==l[m] and k>m):
m=k
#print(m)
k1=chr(97+m)
print(k1*l[m])
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
s=input()
l=[0]*26
m=0
for i in s:
k=ord(i)-97
l[k]+=1
if l[k]>l[m] or (l[k]==l[m] and k>m):
m=k
#print(m)
k1=chr(97+m)
print(k1*l[m])
```
| 0
|
|
290
|
D
|
Orange
|
PROGRAMMING
| 1,400
|
[
"*special",
"implementation"
] | null | null |
The first line of the input is a string (between 1 and 50 characters long, inclusive). Each character will be a letter of English alphabet, lowercase or uppercase.
The second line of the input is an integer between 0 and 26, inclusive.
|
Output the required string.
|
[
"AprilFool\n14\n"
] |
[
"AprILFooL\n"
] |
none
| 0
|
[
{
"input": "AprilFool\n14",
"output": "AprILFooL"
},
{
"input": "abcdefabc\n3",
"output": "ABCdefABC"
},
{
"input": "fgWjSAlPOvcAbCdDEFjz\n7",
"output": "FGwjsAlpovCABCDDEFjz"
},
{
"input": "sm\n26",
"output": "SM"
},
{
"input": "GnlFOqPeZtPiBkvvLhaDvGPgFqBTnLgMT\n12",
"output": "GnLFoqpEztpIBKvvLHADvGpGFqBtnLGmt"
},
{
"input": "sPWSFWWqZBPon\n3",
"output": "spwsfwwqzBpon"
},
{
"input": "fQHHXCdeaintxHWcFcaSGWFvqnYMEByMlSNKumiFgnJB\n0",
"output": "fqhhxcdeaintxhwcfcasgwfvqnymebymlsnkumifgnjb"
},
{
"input": "RtsUOGkraqKyjTktAXloOEmQj\n18",
"output": "RtsuOGKRAQKyJtKtAxLOOEMQJ"
},
{
"input": "DuFhhnq\n4",
"output": "Dufhhnq"
},
{
"input": "RvpuYTxsbDiJDOLauRlfatcfwvtnDzKyaewGrZ\n22",
"output": "RVPUyTxSBDIJDOLAURLFATCFwVTNDzKyAEwGRz"
},
{
"input": "isfvbcBEEPaXUDhbVhwddjEutVQqNdlimIKjUnajDQ\n2",
"output": "isfvBcBeepAxudhBvhwddjeutvqqndlimikjunAjdq"
},
{
"input": "VtQISIHREYaEGPustEkzJRN\n20",
"output": "vTQISIHREyAEGPuSTEKzJRN"
},
{
"input": "jWBVk\n17",
"output": "JwBvK"
},
{
"input": "VWOibsVSFkxPCmyZLWIOxFbfXdlsNzxVcUVf\n8",
"output": "vwoiBsvsFkxpCmyzlwioxFBFxDlsnzxvCuvF"
},
{
"input": "HXyXuYceFtVUMyLqi\n21",
"output": "HxyxUyCEFTvUMyLQI"
},
{
"input": "tAjlldiqGZUayJZHFQHFJVRukaIKepPVucrkyPtMrhIXoxZbw\n12",
"output": "tAJLLDIqGzuAyJzHFqHFJvruKAIKEppvuCrKyptmrHIxoxzBw"
},
{
"input": "fBUycJpfGhsfIVnXAovyoDyndkhv\n9",
"output": "FBuyCjpFGHsFIvnxAovyoDynDkHv"
},
{
"input": "uehLuNwrjO\n0",
"output": "uehlunwrjo"
},
{
"input": "gfSAltDEjuPqEsOFuiTpcUpCOiENCLbHHnCgvCQtW\n13",
"output": "GFsALtDEJupqEsoFuItpCupCoIEnCLBHHnCGvCqtw"
},
{
"input": "SICNEaKsjCnvOEcVqFHLIC\n16",
"output": "sICNEAKsJCNvOECvqFHLIC"
},
{
"input": "LdsmfiNFkPfJgRxytsSJMQZnDTZZ\n11",
"output": "lDsmFInFKpFJGrxytssJmqznDtzz"
},
{
"input": "xedzyPU\n13",
"output": "xEDzypu"
},
{
"input": "kGqopTbelcDUcoZgnnRYXgPCRQwSLoqeIByFWDI\n26",
"output": "KGQOPTBELCDUCOZGNNRYXGPCRQWSLOQEIBYFWDI"
},
{
"input": "WHbBHzhSNkCZOAOwiKdu\n17",
"output": "wHBBHzHsNKCzOAOwIKDu"
},
{
"input": "Ik\n3",
"output": "ik"
},
{
"input": "WlwbRjvrOZakKXqecEdlrCnmvXQtLKBsy\n5",
"output": "wlwBrjvrozAkkxqECEDlrCnmvxqtlkBsy"
},
{
"input": "IOJRIQefPFxpUj\n18",
"output": "IOJRIQEFPFxPuJ"
},
{
"input": "vPuebwksPlxuevRLuWcACTBBgVnmcAUsQUficgEAhoEm\n9",
"output": "vpuEBwksplxuEvrluwCACtBBGvnmCAusquFICGEAHoEm"
},
{
"input": "hQfrRArEPuVAQGfcSuoVKBKvY\n22",
"output": "HQFRRAREPUVAQGFCSUOVKBKVy"
},
{
"input": "TtQEIg\n24",
"output": "TTQEIG"
},
{
"input": "abczxy\n0",
"output": "abczxy"
},
{
"input": "aaaaaaAAAaaaaAaaAaaAaaaaAAaAAAaaAAaaaAAaaaaaAaaAAa\n2",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA"
},
{
"input": "aaaaAaaaaaaAAaaAaaAaAaaaAaaaaaAAaaAAAAAaaAaAAAAaAA\n4",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA"
},
{
"input": "bBbAbbbbaaAAAaabbBbaaabBaaaBaBbAaBabaAAAaaaaBabbb\n4",
"output": "BBBABBBBAAAAAAABBBBAAABBAAABABBAABABAAAAAAAABABBB"
},
{
"input": "BCABcbacbcbAAACCabbaccAabAAaaCCBcBAcCcbaABCCAcCb\n4",
"output": "BCABCBACBCBAAACCABBACCAABAAAACCBCBACCCBAABCCACCB"
},
{
"input": "cdccAAaBBAADdaCDBbDcaDDabdadAbBccCCCDDBADDcdAdC\n4",
"output": "CDCCAAABBAADDACDBBDCADDABDADABBCCCCCDDBADDCDADC"
},
{
"input": "EcCEECdCEBaaeCBEBbAaCAeEdeCEedCAdDeEbcACdCcCCd\n4",
"output": "eCCeeCDCeBAAeCBeBBAACAeeDeCeeDCADDeeBCACDCCCCD"
},
{
"input": "cefEDAbedffbaCcEDfEeCEaAcCeFCcEabEecdEdcaFFde\n4",
"output": "CefeDABeDffBACCeDfeeCeAACCefCCeABeeCDeDCAffDe"
},
{
"input": "nifzlTLaeWxTD\n0",
"output": "nifzltlaewxtd"
},
{
"input": "LiqWMLEULRhW\n1",
"output": "liqwmleulrhw"
},
{
"input": "qH\n2",
"output": "qh"
},
{
"input": "R\n26",
"output": "R"
},
{
"input": "MDJivQRiOIVRcCdkSuUlNbMEOkIVJRMTAnHbkVaOmOblLfignh\n25",
"output": "MDJIVQRIOIVRCCDKSUULNBMEOKIVJRMTANHBKVAOMOBLLFIGNH"
},
{
"input": "pFgLGSkFnGpNKALeDPGlciUNTTlCtAPlFhaIRutCFaFo\n24",
"output": "PFGLGSKFNGPNKALEDPGLCIUNTTLCTAPLFHAIRUTCFAFO"
}
] | 1,638,361,455
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 44
| 124
| 0
|
alphabet_lower=list('abcdefghijklmnopqrstuvwxyz')
s=input()
s=s.lower()
s=list(s)
count=int(input())
for i in range(len(s)):
if alphabet_lower.index(s[i])<count:
s[i]=s[i].upper()
print(''.join(s))
|
Title: Orange
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Input Specification:
The first line of the input is a string (between 1 and 50 characters long, inclusive). Each character will be a letter of English alphabet, lowercase or uppercase.
The second line of the input is an integer between 0 and 26, inclusive.
Output Specification:
Output the required string.
Demo Input:
['AprilFool\n14\n']
Demo Output:
['AprILFooL\n']
Note:
none
|
```python
alphabet_lower=list('abcdefghijklmnopqrstuvwxyz')
s=input()
s=s.lower()
s=list(s)
count=int(input())
for i in range(len(s)):
if alphabet_lower.index(s[i])<count:
s[i]=s[i].upper()
print(''.join(s))
```
| 3
|
||
110
|
A
|
Nearly Lucky Number
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Nearly Lucky Number
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
|
[
"40047\n",
"7747774\n",
"1000000000000000000\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
| 500
|
[
{
"input": "40047",
"output": "NO"
},
{
"input": "7747774",
"output": "YES"
},
{
"input": "1000000000000000000",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "4",
"output": "NO"
},
{
"input": "474404774",
"output": "NO"
},
{
"input": "4744000695826",
"output": "YES"
},
{
"input": "10000000004744744",
"output": "YES"
},
{
"input": "446486416781684178",
"output": "YES"
},
{
"input": "999999999",
"output": "NO"
},
{
"input": "7777",
"output": "YES"
},
{
"input": "87414417444",
"output": "NO"
},
{
"input": "111222333444555667",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "4700",
"output": "NO"
},
{
"input": "3794555488744477",
"output": "NO"
},
{
"input": "444444444444444444",
"output": "NO"
},
{
"input": "474447447774444774",
"output": "NO"
},
{
"input": "777777777777777",
"output": "NO"
},
{
"input": "34777745021000000",
"output": "NO"
},
{
"input": "963",
"output": "NO"
},
{
"input": "855474448854788540",
"output": "NO"
},
{
"input": "999999999999994744",
"output": "YES"
},
{
"input": "400000000474",
"output": "YES"
},
{
"input": "123456789123456789",
"output": "YES"
},
{
"input": "740577777584945874",
"output": "NO"
},
{
"input": "7777777",
"output": "YES"
},
{
"input": "4444000111222333",
"output": "YES"
},
{
"input": "9847745885202111",
"output": "YES"
},
{
"input": "123456000000",
"output": "NO"
},
{
"input": "4744447444444",
"output": "NO"
},
{
"input": "7477",
"output": "YES"
},
{
"input": "4747477",
"output": "YES"
},
{
"input": "777777777444444444",
"output": "NO"
}
] | 1,694,338,225
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
n=int(input())
string=str(n)
count=0
for i in range(len(n)):
if string[i]==4 or string[i]==7:
count+=1
if count==4 or count==7:
print("YES")
else:
print("NO")
|
Title: Nearly Lucky Number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Output Specification:
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
Demo Input:
['40047\n', '7747774\n', '1000000000000000000\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
|
```python
n=int(input())
string=str(n)
count=0
for i in range(len(n)):
if string[i]==4 or string[i]==7:
count+=1
if count==4 or count==7:
print("YES")
else:
print("NO")
```
| -1
|
690
|
C2
|
Brain Network (medium)
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
Further research on zombie thought processes yielded interesting results. As we know from the previous problem, the nervous system of a zombie consists of *n* brains and *m* brain connectors joining some pairs of brains together. It was observed that the intellectual abilities of a zombie depend mainly on the topology of its nervous system. More precisely, we define the distance between two brains *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*) as the minimum number of brain connectors used when transmitting a thought between these two brains. The brain latency of a zombie is defined to be the maximum distance between any two of its brains. Researchers conjecture that the brain latency is the crucial parameter which determines how smart a given zombie is. Help them test this conjecture by writing a program to compute brain latencies of nervous systems.
In this problem you may assume that any nervous system given in the input is valid, i.e., it satisfies conditions (1) and (2) from the easy version.
|
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100000) denoting the number of brains (which are conveniently numbered from 1 to *n*) and the number of brain connectors in the nervous system, respectively. In the next *m* lines, descriptions of brain connectors follow. Every connector is given as a pair of brains *a* *b* it connects (1<=≤<=*a*,<=*b*<=≤<=*n* and *a*<=≠<=*b*).
|
Print one number – the brain latency.
|
[
"4 3\n1 2\n1 3\n1 4\n",
"5 4\n1 2\n2 3\n3 4\n3 5\n"
] |
[
"2",
"3"
] |
none
| 0
|
[
{
"input": "2 1\n1 2",
"output": "1"
},
{
"input": "3 2\n2 1\n3 2",
"output": "2"
},
{
"input": "10 9\n5 1\n1 2\n9 3\n10 5\n6 3\n8 5\n2 7\n2 3\n9 4",
"output": "6"
},
{
"input": "4 3\n1 2\n1 3\n1 4",
"output": "2"
},
{
"input": "5 4\n1 2\n2 3\n3 4\n3 5",
"output": "3"
}
] | 1,695,300,988
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 7
| 733
| 20,582,400
|
mod = int(1e9+7)
inf = int(1e10)
ans = 0
def solve():
n,m = map(int,input().split())
adj = [[]for i in range(n+5)]
for i in range(m):
a,b=map(int,input().split())
adj[a].append(b)
adj[b].append(a)
def dfs(s,par):
global ans
max1 = 0
max2 = 0
for i in adj[s]:
if i!=par:
res = dfs(i,s)
if res>=max1:
max2 = max1
max1 = res
elif res>max2:
max2 = res
ans = max(ans,max1+max2)
return max(max1,max2)+1
dfs(1,-1)
print(ans)
# number of test cases
t = 1
#t = int(input())
for i in range(t):
solve()
|
Title: Brain Network (medium)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Further research on zombie thought processes yielded interesting results. As we know from the previous problem, the nervous system of a zombie consists of *n* brains and *m* brain connectors joining some pairs of brains together. It was observed that the intellectual abilities of a zombie depend mainly on the topology of its nervous system. More precisely, we define the distance between two brains *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*) as the minimum number of brain connectors used when transmitting a thought between these two brains. The brain latency of a zombie is defined to be the maximum distance between any two of its brains. Researchers conjecture that the brain latency is the crucial parameter which determines how smart a given zombie is. Help them test this conjecture by writing a program to compute brain latencies of nervous systems.
In this problem you may assume that any nervous system given in the input is valid, i.e., it satisfies conditions (1) and (2) from the easy version.
Input Specification:
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100000) denoting the number of brains (which are conveniently numbered from 1 to *n*) and the number of brain connectors in the nervous system, respectively. In the next *m* lines, descriptions of brain connectors follow. Every connector is given as a pair of brains *a* *b* it connects (1<=≤<=*a*,<=*b*<=≤<=*n* and *a*<=≠<=*b*).
Output Specification:
Print one number – the brain latency.
Demo Input:
['4 3\n1 2\n1 3\n1 4\n', '5 4\n1 2\n2 3\n3 4\n3 5\n']
Demo Output:
['2', '3']
Note:
none
|
```python
mod = int(1e9+7)
inf = int(1e10)
ans = 0
def solve():
n,m = map(int,input().split())
adj = [[]for i in range(n+5)]
for i in range(m):
a,b=map(int,input().split())
adj[a].append(b)
adj[b].append(a)
def dfs(s,par):
global ans
max1 = 0
max2 = 0
for i in adj[s]:
if i!=par:
res = dfs(i,s)
if res>=max1:
max2 = max1
max1 = res
elif res>max2:
max2 = res
ans = max(ans,max1+max2)
return max(max1,max2)+1
dfs(1,-1)
print(ans)
# number of test cases
t = 1
#t = int(input())
for i in range(t):
solve()
```
| -1
|
|
937
|
A
|
Olympiad
|
PROGRAMMING
| 800
|
[
"implementation",
"sortings"
] | null | null |
The recent All-Berland Olympiad in Informatics featured *n* participants with each scoring a certain amount of points.
As the head of the programming committee, you are to determine the set of participants to be awarded with diplomas with respect to the following criteria:
- At least one participant should get a diploma. - None of those with score equal to zero should get awarded. - When someone is awarded, all participants with score not less than his score should also be awarded.
Determine the number of ways to choose a subset of participants that will receive the diplomas.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants.
The next line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=600) — participants' scores.
It's guaranteed that at least one participant has non-zero score.
|
Print a single integer — the desired number of ways.
|
[
"4\n1 3 3 2\n",
"3\n1 1 1\n",
"4\n42 0 0 42\n"
] |
[
"3\n",
"1\n",
"1\n"
] |
There are three ways to choose a subset in sample case one.
1. Only participants with 3 points will get diplomas. 1. Participants with 2 or 3 points will get diplomas. 1. Everyone will get a diploma!
The only option in sample case two is to award everyone.
Note that in sample case three participants with zero scores cannot get anything.
| 500
|
[
{
"input": "4\n1 3 3 2",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "4\n42 0 0 42",
"output": "1"
},
{
"input": "10\n1 0 1 0 1 0 0 0 0 1",
"output": "1"
},
{
"input": "10\n572 471 540 163 50 30 561 510 43 200",
"output": "10"
},
{
"input": "100\n122 575 426 445 172 81 247 429 97 202 175 325 382 384 417 356 132 502 328 537 57 339 518 211 479 306 140 168 268 16 140 263 593 249 391 310 555 468 231 180 157 18 334 328 276 155 21 280 322 545 111 267 467 274 291 304 235 34 365 180 21 95 501 552 325 331 302 353 296 22 289 399 7 466 32 302 568 333 75 192 284 10 94 128 154 512 9 480 243 521 551 492 420 197 207 125 367 117 438 600",
"output": "94"
},
{
"input": "100\n600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600 600",
"output": "1"
},
{
"input": "78\n5 4 13 2 5 6 2 10 10 1 2 6 7 9 6 3 5 7 1 10 2 2 7 0 2 11 11 3 1 13 3 10 6 2 0 3 0 5 0 1 4 11 1 1 7 0 12 7 5 12 0 2 12 9 8 3 4 3 4 11 4 10 2 3 10 12 5 6 1 11 2 0 8 7 9 1 3 12",
"output": "13"
},
{
"input": "34\n220 387 408 343 184 447 197 307 337 414 251 319 426 322 347 242 208 412 188 185 241 235 216 259 331 372 322 284 444 384 214 297 389 391",
"output": "33"
},
{
"input": "100\n1 2 1 0 3 0 2 0 0 1 2 0 1 3 0 3 3 1 3 0 0 2 1 2 2 1 3 3 3 3 3 2 0 0 2 1 2 3 2 3 0 1 1 3 3 2 0 3 1 0 2 2 2 1 2 3 2 1 0 3 0 2 0 3 0 2 1 0 3 1 0 2 2 1 3 1 3 0 2 3 3 1 1 3 1 3 0 3 2 0 2 3 3 0 2 0 2 0 1 3",
"output": "3"
},
{
"input": "100\n572 471 540 163 50 30 561 510 43 200 213 387 500 424 113 487 357 333 294 337 435 202 447 494 485 465 161 344 470 559 104 356 393 207 224 213 511 514 60 386 149 216 392 229 429 173 165 401 395 150 127 579 344 390 529 296 225 425 318 79 465 447 177 110 367 212 459 270 41 500 277 567 125 436 178 9 214 342 203 112 144 24 79 155 495 556 40 549 463 281 241 316 2 246 1 396 510 293 332 55",
"output": "93"
},
{
"input": "99\n5 4 13 2 5 6 2 10 10 1 2 6 7 9 6 3 5 7 1 10 2 2 7 0 2 11 11 3 1 13 3 10 6 2 0 3 0 5 0 1 4 11 1 1 7 0 12 7 5 12 0 2 12 9 8 3 4 3 4 11 4 10 2 3 10 12 5 6 1 11 2 0 8 7 9 1 3 12 2 3 9 3 7 13 7 13 0 11 8 12 2 5 9 4 0 6 6 2 13",
"output": "13"
},
{
"input": "99\n1 0 1 0 1 0 0 0 0 1 0 0 1 1 0 1 1 1 1 0 0 0 1 0 0 1 1 1 1 1 1 0 0 0 0 1 0 1 0 1 0 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 0 1 0 1 0 0 0 1 0 0 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 1 0 0 0 1 1 0 0 0 0 0 1",
"output": "1"
},
{
"input": "99\n21 74 25 44 71 80 46 28 96 1 74 24 81 83 16 55 31 1 27 36 56 38 17 10 78 5 39 67 67 15 39 62 92 48 90 9 54 67 30 79 56 17 33 27 75 54 20 79 21 44 10 66 66 73 90 3 34 33 64 79 20 94 0 51 24 30 1 52 95 21 88 98 6 65 31 1 67 32 74 91 83 9 93 27 53 11 8 79 42 20 50 91 19 96 6 24 66 16 37",
"output": "61"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 600",
"output": "1"
},
{
"input": "4\n1 1 1 2",
"output": "2"
},
{
"input": "4\n0 0 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "2\n0 5",
"output": "1"
},
{
"input": "5\n1 0 0 1 2",
"output": "2"
}
] | 1,563,555,079
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 109
| 0
|
# import sys
# sys.stdin=open("input.in","r")
n=int(input())
print(len(set(input().split())-{"0"}))
|
Title: Olympiad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The recent All-Berland Olympiad in Informatics featured *n* participants with each scoring a certain amount of points.
As the head of the programming committee, you are to determine the set of participants to be awarded with diplomas with respect to the following criteria:
- At least one participant should get a diploma. - None of those with score equal to zero should get awarded. - When someone is awarded, all participants with score not less than his score should also be awarded.
Determine the number of ways to choose a subset of participants that will receive the diplomas.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants.
The next line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=600) — participants' scores.
It's guaranteed that at least one participant has non-zero score.
Output Specification:
Print a single integer — the desired number of ways.
Demo Input:
['4\n1 3 3 2\n', '3\n1 1 1\n', '4\n42 0 0 42\n']
Demo Output:
['3\n', '1\n', '1\n']
Note:
There are three ways to choose a subset in sample case one.
1. Only participants with 3 points will get diplomas. 1. Participants with 2 or 3 points will get diplomas. 1. Everyone will get a diploma!
The only option in sample case two is to award everyone.
Note that in sample case three participants with zero scores cannot get anything.
|
```python
# import sys
# sys.stdin=open("input.in","r")
n=int(input())
print(len(set(input().split())-{"0"}))
```
| 3
|
|
895
|
A
|
Pizza Separation
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=360) — the number of pieces into which the delivered pizza was cut.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360) — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360.
|
Print one integer — the minimal difference between angles of sectors that will go to Vasya and Petya.
|
[
"4\n90 90 90 90\n",
"3\n100 100 160\n",
"1\n360\n",
"4\n170 30 150 10\n"
] |
[
"0\n",
"40\n",
"360\n",
"0\n"
] |
In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0.
In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360.
In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0.
Picture explaning fourth sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
| 500
|
[
{
"input": "4\n90 90 90 90",
"output": "0"
},
{
"input": "3\n100 100 160",
"output": "40"
},
{
"input": "1\n360",
"output": "360"
},
{
"input": "4\n170 30 150 10",
"output": "0"
},
{
"input": "5\n10 10 10 10 320",
"output": "280"
},
{
"input": "8\n45 45 45 45 45 45 45 45",
"output": "0"
},
{
"input": "3\n120 120 120",
"output": "120"
},
{
"input": "5\n110 90 70 50 40",
"output": "40"
},
{
"input": "2\n170 190",
"output": "20"
},
{
"input": "15\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 10",
"output": "10"
},
{
"input": "5\n30 60 180 60 30",
"output": "0"
},
{
"input": "2\n359 1",
"output": "358"
},
{
"input": "5\n100 100 30 100 30",
"output": "40"
},
{
"input": "5\n36 34 35 11 244",
"output": "128"
},
{
"input": "5\n96 94 95 71 4",
"output": "18"
},
{
"input": "2\n85 275",
"output": "190"
},
{
"input": "3\n281 67 12",
"output": "202"
},
{
"input": "5\n211 113 25 9 2",
"output": "62"
},
{
"input": "13\n286 58 6 1 1 1 1 1 1 1 1 1 1",
"output": "212"
},
{
"input": "15\n172 69 41 67 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "20\n226 96 2 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "92"
},
{
"input": "50\n148 53 32 11 4 56 8 2 5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n1 1 358",
"output": "356"
},
{
"input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 341",
"output": "322"
},
{
"input": "33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 328",
"output": "296"
},
{
"input": "70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 291",
"output": "222"
},
{
"input": "130\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 231",
"output": "102"
},
{
"input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 161",
"output": "0"
},
{
"input": "222\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 139",
"output": "0"
},
{
"input": "10\n8 3 11 4 1 10 10 1 8 304",
"output": "248"
},
{
"input": "12\n8 7 7 3 11 2 10 1 10 8 10 283",
"output": "206"
},
{
"input": "13\n10 8 9 10 5 9 4 1 10 11 1 7 275",
"output": "190"
},
{
"input": "14\n1 6 3 11 9 5 9 8 5 6 7 3 7 280",
"output": "200"
},
{
"input": "15\n10 11 5 4 11 5 4 1 5 4 5 5 9 6 275",
"output": "190"
},
{
"input": "30\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 189",
"output": "18"
},
{
"input": "70\n5 3 6 8 9 2 8 9 11 5 2 8 9 11 7 6 6 9 7 11 7 6 3 8 2 4 4 8 4 3 2 2 3 5 6 5 11 2 7 7 5 8 10 5 2 1 10 9 4 10 7 1 8 10 9 1 5 1 1 1 2 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "29\n2 10 1 5 7 2 9 11 9 9 10 8 4 11 2 5 4 1 4 9 6 10 8 3 1 3 8 9 189",
"output": "18"
},
{
"input": "35\n3 4 11 4 4 2 3 4 3 9 7 10 2 7 8 3 11 3 6 4 6 7 11 10 8 7 6 7 2 8 5 3 2 2 168",
"output": "0"
},
{
"input": "60\n4 10 3 10 6 3 11 8 11 9 3 5 9 2 6 5 6 9 4 10 1 1 3 7 2 10 5 5 3 10 5 2 1 2 9 11 11 9 11 4 11 7 5 6 10 9 3 4 7 8 7 3 6 7 8 5 1 1 1 5",
"output": "0"
},
{
"input": "71\n3 11 8 1 10 1 7 9 6 4 11 10 11 2 4 1 11 7 9 10 11 4 8 7 11 3 8 4 1 8 4 2 9 9 7 10 10 9 5 7 9 7 2 1 7 6 5 11 5 9 4 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "63\n2 11 5 8 7 9 9 8 10 5 9 10 11 8 10 2 3 5 3 7 5 10 2 9 4 8 1 8 5 9 7 7 1 8 7 7 9 10 10 10 8 7 7 2 2 8 9 7 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "81\n5 8 7 11 2 7 1 1 5 8 7 2 3 11 4 9 7 6 4 4 2 1 1 7 9 4 1 8 3 1 4 10 7 9 9 8 11 3 4 3 10 8 6 4 7 2 4 3 6 11 11 10 7 10 2 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "47\n5 3 7 4 2 7 8 1 9 10 5 11 10 7 7 5 1 3 2 11 3 8 6 1 6 10 8 3 2 10 5 6 8 6 9 7 10 9 7 4 8 11 10 1 5 11 68",
"output": "0"
},
{
"input": "100\n5 8 9 3 2 3 9 8 11 10 4 8 1 1 1 1 6 5 10 9 5 3 7 7 2 11 10 2 3 2 2 8 7 3 5 5 10 9 2 5 10 6 7 7 4 7 7 8 2 8 9 9 2 4 1 1 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "120\n9 11 3 7 3 7 9 1 10 7 11 4 1 5 3 5 6 3 1 11 8 8 11 7 3 5 1 9 1 7 10 10 10 10 9 5 4 8 2 8 2 1 4 5 3 11 3 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "200\n7 7 9 8 2 8 5 8 3 9 7 10 2 9 11 8 11 7 5 2 6 3 11 9 5 1 10 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "220\n3 2 8 1 3 5 5 11 1 5 2 6 9 2 2 6 8 10 7 1 3 2 10 9 10 10 4 10 9 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "6\n27 15 28 34 41 215",
"output": "70"
},
{
"input": "7\n41 38 41 31 22 41 146",
"output": "14"
},
{
"input": "8\n24 27 34 23 29 23 30 170",
"output": "20"
},
{
"input": "9\n11 11 20 20 33 32 35 26 172",
"output": "6"
},
{
"input": "10\n36 13 28 13 33 34 23 25 34 121",
"output": "0"
},
{
"input": "11\n19 37 13 41 37 15 32 12 19 35 100",
"output": "10"
},
{
"input": "12\n37 25 34 38 21 24 34 38 11 29 28 41",
"output": "2"
},
{
"input": "13\n24 40 20 26 25 29 39 29 35 28 19 18 28",
"output": "2"
},
{
"input": "14\n11 21 40 19 28 34 13 16 23 30 34 22 25 44",
"output": "4"
},
{
"input": "3\n95 91 174",
"output": "12"
},
{
"input": "4\n82 75 78 125",
"output": "46"
},
{
"input": "6\n87 75 88 94 15 1",
"output": "4"
},
{
"input": "10\n27 52 58 64 45 64 1 19 2 28",
"output": "12"
},
{
"input": "50\n14 12 11 8 1 6 11 6 7 8 4 11 4 5 7 3 5 4 7 24 10 2 3 4 6 13 2 1 8 7 5 13 10 8 5 20 1 2 23 7 14 3 4 4 2 8 8 2 6 1",
"output": "0"
},
{
"input": "100\n3 3 4 3 3 6 3 2 8 2 13 3 1 1 2 1 3 4 1 7 1 2 2 6 3 2 10 3 1 2 5 6 2 3 3 2 3 11 8 3 2 6 1 3 3 4 7 7 2 2 1 2 6 3 3 2 3 1 3 8 2 6 4 2 1 12 2 2 2 1 4 1 4 1 3 1 3 1 5 2 6 6 7 1 2 3 2 4 4 2 5 9 8 2 4 6 5 1 1 3",
"output": "0"
},
{
"input": "150\n1 5 1 2 2 2 1 4 2 2 2 3 1 2 1 2 2 2 2 1 2 2 2 1 5 3 4 1 3 4 5 2 4 2 1 2 2 1 1 2 3 2 4 2 2 3 3 1 1 5 2 3 2 1 9 2 1 1 2 1 4 1 1 3 2 2 2 1 2 2 2 1 3 3 4 2 2 1 3 3 3 1 4 3 4 1 2 2 1 1 1 2 2 5 4 1 1 1 2 1 2 3 2 2 6 3 3 3 1 2 1 1 2 8 2 2 4 3 4 5 3 1 4 2 2 2 2 1 4 4 1 1 2 2 4 9 6 3 1 1 2 1 3 4 1 3 2 2 2 1",
"output": "0"
},
{
"input": "200\n1 2 1 3 1 3 1 2 1 4 6 1 2 2 2 2 1 1 1 1 3 2 1 2 2 2 1 2 2 2 2 1 1 1 3 2 3 1 1 2 1 1 2 1 1 1 1 1 1 2 1 2 2 4 1 3 1 2 1 2 2 1 2 1 3 1 1 2 2 1 1 1 1 2 4 1 2 1 1 1 2 1 3 1 1 3 1 2 2 4 1 1 2 1 2 1 2 2 2 2 1 1 2 1 2 1 3 3 1 1 1 2 1 3 3 1 2 1 3 1 3 3 1 2 2 1 4 1 2 2 1 2 2 4 2 5 1 2 2 1 2 1 2 1 5 2 1 2 2 1 2 4 1 2 2 4 2 3 2 3 1 2 1 1 2 2 2 1 1 2 1 4 1 2 1 1 2 1 2 3 1 1 1 2 2 3 1 3 2 2 3 1 2 1 2 1 1 2 1 2",
"output": "0"
},
{
"input": "5\n35 80 45 100 100",
"output": "40"
},
{
"input": "4\n90 179 90 1",
"output": "2"
},
{
"input": "5\n50 50 20 160 80",
"output": "0"
},
{
"input": "5\n30 175 30 5 120",
"output": "10"
},
{
"input": "4\n170 30 10 150",
"output": "20"
},
{
"input": "6\n90 30 90 30 90 30",
"output": "60"
},
{
"input": "4\n70 80 110 100",
"output": "20"
},
{
"input": "7\n35 45 70 100 10 10 90",
"output": "0"
},
{
"input": "6\n50 90 10 90 20 100",
"output": "20"
},
{
"input": "6\n10 155 162 1 26 6",
"output": "18"
},
{
"input": "7\n80 90 80 45 10 10 45",
"output": "20"
},
{
"input": "4\n18 36 162 144",
"output": "36"
},
{
"input": "5\n20 50 50 160 80",
"output": "40"
},
{
"input": "5\n10 30 140 20 160",
"output": "0"
},
{
"input": "6\n90 80 60 50 40 40",
"output": "20"
},
{
"input": "9\n40 20 20 20 20 20 20 40 160",
"output": "40"
},
{
"input": "4\n90 54 90 126",
"output": "72"
},
{
"input": "4\n150 170 30 10",
"output": "20"
},
{
"input": "8\n130 12 13 85 41 67 5 7",
"output": "26"
},
{
"input": "7\n70 170 20 10 30 30 30",
"output": "20"
},
{
"input": "8\n100 100 50 50 15 15 15 15",
"output": "40"
},
{
"input": "4\n100 70 80 110",
"output": "20"
},
{
"input": "5\n160 130 40 20 10",
"output": "20"
},
{
"input": "4\n20 149 151 40",
"output": "22"
},
{
"input": "4\n100 10 100 150",
"output": "60"
},
{
"input": "6\n19 64 105 168 1 3",
"output": "16"
},
{
"input": "8\n10 10 70 70 90 90 10 10",
"output": "0"
}
] | 1,511,765,241
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 5,529,600
|
n = int(input())
l = list(map(int, input().split()))
ans = 180
for i in range(0, n):
sum = 0
for j in range(i, n):
sum += l[a]
if ans > abs(180 - sum):
ans = abs(180 - sum)
print(ans * 2)
|
Title: Pizza Separation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=360) — the number of pieces into which the delivered pizza was cut.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360) — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360.
Output Specification:
Print one integer — the minimal difference between angles of sectors that will go to Vasya and Petya.
Demo Input:
['4\n90 90 90 90\n', '3\n100 100 160\n', '1\n360\n', '4\n170 30 150 10\n']
Demo Output:
['0\n', '40\n', '360\n', '0\n']
Note:
In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0.
In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360.
In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0.
Picture explaning fourth sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
|
```python
n = int(input())
l = list(map(int, input().split()))
ans = 180
for i in range(0, n):
sum = 0
for j in range(i, n):
sum += l[a]
if ans > abs(180 - sum):
ans = abs(180 - sum)
print(ans * 2)
```
| -1
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,579,076,512
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 186
| 204,800
|
n=int(input())
s=input()
a=0
d=0
c=0
x=0
b=0
for i in list(s):
if i=='ABC':
a=a+1
elif(i=='AB'):
d=d+1
elif(i=='A'):
c=c+1
elif(i=='B'):
x=x+1
else:
b=0
if (a>d and a>c and a>x and a>b):
print("ABC")
elif (d>a and d>c and d>x and d>b):
print("AB")
elif (c>a and c>d and c>x and c>b):
print("A")
elif (x>a and x>d and x>c and x>b):
print("B")
elif(b>a and b>d and b>x and b>c):
print("C")
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n=int(input())
s=input()
a=0
d=0
c=0
x=0
b=0
for i in list(s):
if i=='ABC':
a=a+1
elif(i=='AB'):
d=d+1
elif(i=='A'):
c=c+1
elif(i=='B'):
x=x+1
else:
b=0
if (a>d and a>c and a>x and a>b):
print("ABC")
elif (d>a and d>c and d>x and d>b):
print("AB")
elif (c>a and c>d and c>x and c>b):
print("A")
elif (x>a and x>d and x>c and x>b):
print("B")
elif(b>a and b>d and b>x and b>c):
print("C")
```
| 0
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,680,426,890
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
def domino_piling(m, n):
return m * n // 2
if __name__ == "__main__":
m, n = map(int, input().split())
print(domino_piling(m, n))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
def domino_piling(m, n):
return m * n // 2
if __name__ == "__main__":
m, n = map(int, input().split())
print(domino_piling(m, n))
```
| 3.977
|
798
|
A
|
Mike and palindrome
|
PROGRAMMING
| 1,000
|
[
"brute force",
"constructive algorithms",
"strings"
] | null | null |
Mike has a string *s* consisting of only lowercase English letters. He wants to change exactly one character from the string so that the resulting one is a palindrome.
A palindrome is a string that reads the same backward as forward, for example strings "z", "aaa", "aba", "abccba" are palindromes, but strings "codeforces", "reality", "ab" are not.
|
The first and single line contains string *s* (1<=≤<=|*s*|<=≤<=15).
|
Print "YES" (without quotes) if Mike can change exactly one character so that the resulting string is palindrome or "NO" (without quotes) otherwise.
|
[
"abccaa\n",
"abbcca\n",
"abcda\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "abccaa",
"output": "YES"
},
{
"input": "abbcca",
"output": "NO"
},
{
"input": "abcda",
"output": "YES"
},
{
"input": "kyw",
"output": "YES"
},
{
"input": "fccf",
"output": "NO"
},
{
"input": "mnlm",
"output": "YES"
},
{
"input": "gqrk",
"output": "NO"
},
{
"input": "glxlg",
"output": "YES"
},
{
"input": "czhfc",
"output": "YES"
},
{
"input": "broon",
"output": "NO"
},
{
"input": "rmggmr",
"output": "NO"
},
{
"input": "wvxxzw",
"output": "YES"
},
{
"input": "ukvciu",
"output": "NO"
},
{
"input": "vrnwnrv",
"output": "YES"
},
{
"input": "vlkjkav",
"output": "YES"
},
{
"input": "guayhmg",
"output": "NO"
},
{
"input": "lkvhhvkl",
"output": "NO"
},
{
"input": "ffdsslff",
"output": "YES"
},
{
"input": "galjjtyw",
"output": "NO"
},
{
"input": "uosgwgsou",
"output": "YES"
},
{
"input": "qjwmjmljq",
"output": "YES"
},
{
"input": "ustrvrodf",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "qjfyjjyfjq",
"output": "NO"
},
{
"input": "ysxibbixsq",
"output": "YES"
},
{
"input": "howfslfwmh",
"output": "NO"
},
{
"input": "ekhajrjahke",
"output": "YES"
},
{
"input": "ucnolsloncw",
"output": "YES"
},
{
"input": "jrzsfrrkrtj",
"output": "NO"
},
{
"input": "typayzzyapyt",
"output": "NO"
},
{
"input": "uwdhkzokhdwu",
"output": "YES"
},
{
"input": "xokxpyyuafij",
"output": "NO"
},
{
"input": "eusneioiensue",
"output": "YES"
},
{
"input": "fuxpuajabpxuf",
"output": "YES"
},
{
"input": "guvggtfhlgruy",
"output": "NO"
},
{
"input": "cojhkhxxhkhjoc",
"output": "NO"
},
{
"input": "mhifbmmmmbmihm",
"output": "YES"
},
{
"input": "kxfqqncnebpami",
"output": "NO"
},
{
"input": "scfwrjevejrwfcs",
"output": "YES"
},
{
"input": "thdaonpepdoadht",
"output": "YES"
},
{
"input": "jsfzcbnhsccuqsj",
"output": "NO"
},
{
"input": "nn",
"output": "NO"
},
{
"input": "nm",
"output": "YES"
},
{
"input": "jdj",
"output": "YES"
},
{
"input": "bbcaa",
"output": "NO"
},
{
"input": "abcde",
"output": "NO"
},
{
"input": "abcdf",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "abecd",
"output": "NO"
},
{
"input": "abccacb",
"output": "NO"
},
{
"input": "aabc",
"output": "NO"
},
{
"input": "anpqb",
"output": "NO"
},
{
"input": "c",
"output": "YES"
},
{
"input": "abcdefg",
"output": "NO"
},
{
"input": "aanbb",
"output": "NO"
},
{
"input": "aabbb",
"output": "NO"
},
{
"input": "aaabbab",
"output": "NO"
},
{
"input": "ab",
"output": "YES"
},
{
"input": "aabbc",
"output": "NO"
},
{
"input": "ecabd",
"output": "NO"
},
{
"input": "abcdrty",
"output": "NO"
},
{
"input": "abcdmnp",
"output": "NO"
},
{
"input": "bbbbbb",
"output": "NO"
},
{
"input": "abcxuio",
"output": "NO"
},
{
"input": "abcdabcde",
"output": "NO"
},
{
"input": "abcxpoi",
"output": "NO"
},
{
"input": "aba",
"output": "YES"
},
{
"input": "aacbb",
"output": "NO"
},
{
"input": "abcedca",
"output": "NO"
},
{
"input": "abcdd",
"output": "NO"
},
{
"input": "abbcs",
"output": "NO"
},
{
"input": "aaabccc",
"output": "NO"
},
{
"input": "paxkxbq",
"output": "NO"
},
{
"input": "z",
"output": "YES"
},
{
"input": "b",
"output": "YES"
},
{
"input": "abcdefghi",
"output": "NO"
},
{
"input": "abcqr",
"output": "NO"
},
{
"input": "abcdc",
"output": "NO"
},
{
"input": "abcb",
"output": "NO"
},
{
"input": "aabcd",
"output": "NO"
},
{
"input": "abbba",
"output": "YES"
},
{
"input": "aaabbb",
"output": "NO"
},
{
"input": "bb",
"output": "NO"
},
{
"input": "aaacbbb",
"output": "NO"
},
{
"input": "abbzcca",
"output": "NO"
},
{
"input": "abxab",
"output": "NO"
},
{
"input": "bbb",
"output": "YES"
},
{
"input": "abcrtyu",
"output": "NO"
},
{
"input": "cbacb",
"output": "NO"
},
{
"input": "acbb",
"output": "NO"
},
{
"input": "ww",
"output": "NO"
},
{
"input": "aaaaaa",
"output": "NO"
},
{
"input": "jizzz",
"output": "NO"
},
{
"input": "aaakcba",
"output": "NO"
},
{
"input": "acbak",
"output": "NO"
},
{
"input": "bddeffd",
"output": "NO"
},
{
"input": "aaa",
"output": "YES"
},
{
"input": "afghqwe",
"output": "NO"
},
{
"input": "abcdfga",
"output": "NO"
}
] | 1,670,835,329
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 4
| 77
| 3,072,000
|
s=input()
a=len(s)
for i in range(0,a//2):
if s[i]==s[-1-i] :
pass
else:
b=str(s[0:i]+s[-1-i]+s[i+1:a])
break
if b[0:a]==b[::-1] :
print("YES")
else:
print("NO")
|
Title: Mike and palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mike has a string *s* consisting of only lowercase English letters. He wants to change exactly one character from the string so that the resulting one is a palindrome.
A palindrome is a string that reads the same backward as forward, for example strings "z", "aaa", "aba", "abccba" are palindromes, but strings "codeforces", "reality", "ab" are not.
Input Specification:
The first and single line contains string *s* (1<=≤<=|*s*|<=≤<=15).
Output Specification:
Print "YES" (without quotes) if Mike can change exactly one character so that the resulting string is palindrome or "NO" (without quotes) otherwise.
Demo Input:
['abccaa\n', 'abbcca\n', 'abcda\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none
|
```python
s=input()
a=len(s)
for i in range(0,a//2):
if s[i]==s[-1-i] :
pass
else:
b=str(s[0:i]+s[-1-i]+s[i+1:a])
break
if b[0:a]==b[::-1] :
print("YES")
else:
print("NO")
```
| -1
|
|
978
|
B
|
File Name
|
PROGRAMMING
| 800
|
[
"greedy",
"strings"
] | null | null |
You can not just take the file and send it. When Polycarp trying to send a file in the social network "Codehorses", he encountered an unexpected problem. If the name of the file contains three or more "x" (lowercase Latin letters "x") in a row, the system considers that the file content does not correspond to the social network topic. In this case, the file is not sent and an error message is displayed.
Determine the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. Print 0 if the file name does not initially contain a forbidden substring "xxx".
You can delete characters in arbitrary positions (not necessarily consecutive). If you delete a character, then the length of a string is reduced by $1$. For example, if you delete the character in the position $2$ from the string "exxxii", then the resulting string is "exxii".
|
The first line contains integer $n$ $(3 \le n \le 100)$ — the length of the file name.
The second line contains a string of length $n$ consisting of lowercase Latin letters only — the file name.
|
Print the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. If initially the file name dost not contain a forbidden substring "xxx", print 0.
|
[
"6\nxxxiii\n",
"5\nxxoxx\n",
"10\nxxxxxxxxxx\n"
] |
[
"1\n",
"0\n",
"8\n"
] |
In the first example Polycarp tried to send a file with name contains number $33$, written in Roman numerals. But he can not just send the file, because it name contains three letters "x" in a row. To send the file he needs to remove any one of this letters.
| 0
|
[
{
"input": "6\nxxxiii",
"output": "1"
},
{
"input": "5\nxxoxx",
"output": "0"
},
{
"input": "10\nxxxxxxxxxx",
"output": "8"
},
{
"input": "100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "98"
},
{
"input": "99\nxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxa",
"output": "0"
},
{
"input": "3\nxxx",
"output": "1"
},
{
"input": "77\naaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxyyyzzz",
"output": "0"
},
{
"input": "100\nuxxxxxlmexxxxxxxwnxxexxxxxcxxfydxxxxxxvmdxxxxxxisxxxxxxxxidkxxxpxxxxxxxxmnuxxxxjxxxqcxxwmxxxxxxxxmrx",
"output": "41"
},
{
"input": "100\nxxxxxxxxxxxjtxxxxxxxxcxxxxxxcfxxxxzxxxxxxgxxxxxbxxxxbxxxxxxxxdycxxxxokixxxkizxxgcxxxxxxxxexxxxxfxxxc",
"output": "49"
},
{
"input": "100\nuxxxxxlmexxxxxxxwnxxexxxxxcxxfydxxxxxxvmdxxxxxxisxxxxxxxxidkxxxpxxxxxxxxmnuxxxxjxxxqcxxwmxxxxxwxxxxx",
"output": "41"
},
{
"input": "34\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "5\nfcyju",
"output": "0"
},
{
"input": "100\nihygyvdvyeifomhxhkhdkimquvgallbqharcyriyqkidnwykozuhvkwdldlztpabgyuflikychqpdenwzgtlzotyumjgdsrbxxxx",
"output": "2"
}
] | 1,690,552,799
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
while True:
m=int(input())
n=input()
if m == len(n):
break
so_lan_x = 0
so_lan_xoa = 0
for i in range(0,len(n)):
if n[i] == 'x':
so_lan_x += 1
if n[i] != 'x':
so_lan_x = 0
if so_lan_x > 2:
so_lan_xoa += 1
print(so_lan_x)
|
Title: File Name
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You can not just take the file and send it. When Polycarp trying to send a file in the social network "Codehorses", he encountered an unexpected problem. If the name of the file contains three or more "x" (lowercase Latin letters "x") in a row, the system considers that the file content does not correspond to the social network topic. In this case, the file is not sent and an error message is displayed.
Determine the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. Print 0 if the file name does not initially contain a forbidden substring "xxx".
You can delete characters in arbitrary positions (not necessarily consecutive). If you delete a character, then the length of a string is reduced by $1$. For example, if you delete the character in the position $2$ from the string "exxxii", then the resulting string is "exxii".
Input Specification:
The first line contains integer $n$ $(3 \le n \le 100)$ — the length of the file name.
The second line contains a string of length $n$ consisting of lowercase Latin letters only — the file name.
Output Specification:
Print the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. If initially the file name dost not contain a forbidden substring "xxx", print 0.
Demo Input:
['6\nxxxiii\n', '5\nxxoxx\n', '10\nxxxxxxxxxx\n']
Demo Output:
['1\n', '0\n', '8\n']
Note:
In the first example Polycarp tried to send a file with name contains number $33$, written in Roman numerals. But he can not just send the file, because it name contains three letters "x" in a row. To send the file he needs to remove any one of this letters.
|
```python
while True:
m=int(input())
n=input()
if m == len(n):
break
so_lan_x = 0
so_lan_xoa = 0
for i in range(0,len(n)):
if n[i] == 'x':
so_lan_x += 1
if n[i] != 'x':
so_lan_x = 0
if so_lan_x > 2:
so_lan_xoa += 1
print(so_lan_x)
```
| 0
|
|
103
|
A
|
Testing Pants for Sadness
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation",
"math"
] |
A. Testing Pants for Sadness
|
2
|
256
|
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=≤<=*a**i*<=≤<=109), the number of answer variants to question *i*.
|
Print a single number — the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
[
"2\n1 1\n",
"2\n2 2\n",
"1\n10\n"
] |
[
"2",
"5",
"10"
] |
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
| 500
|
[
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n2 2",
"output": "5"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n2 4 1",
"output": "10"
},
{
"input": "4\n5 5 3 1",
"output": "22"
},
{
"input": "2\n1000000000 1000000000",
"output": "2999999999"
},
{
"input": "10\n5 7 8 1 10 3 6 4 10 6",
"output": "294"
},
{
"input": "100\n5 7 5 3 5 4 6 5 3 6 4 6 6 2 1 9 6 5 3 8 4 10 1 9 1 3 7 6 5 5 8 8 7 7 8 9 2 10 3 5 4 2 6 10 2 6 9 6 1 9 3 7 7 8 3 9 9 5 10 10 3 10 7 8 3 9 8 3 2 4 10 2 1 1 7 3 9 10 4 6 9 8 2 1 4 10 1 10 6 8 7 5 3 3 6 2 7 10 3 8",
"output": "24212"
},
{
"input": "100\n96 23 25 62 34 30 85 15 26 61 59 87 34 99 60 41 52 73 63 84 50 89 42 29 87 99 19 94 84 43 82 90 41 100 60 61 99 49 26 3 97 5 24 34 51 59 69 61 11 41 72 60 33 36 18 29 82 53 18 80 52 98 38 32 56 95 55 79 32 80 37 64 45 13 62 80 70 29 1 58 88 24 79 68 41 80 12 72 52 39 64 19 54 56 70 58 19 3 83 62",
"output": "261115"
},
{
"input": "100\n883 82 79 535 478 824 700 593 262 385 403 183 176 386 126 648 710 516 922 97 800 728 372 9 954 911 975 526 476 3 74 459 471 174 295 831 698 21 927 698 580 856 712 430 5 473 592 40 301 230 763 266 38 213 393 70 333 779 811 249 130 456 763 657 578 699 939 660 898 918 438 855 892 85 35 232 54 593 849 777 917 979 796 322 473 887 284 105 522 415 86 480 80 592 516 227 680 574 488 644",
"output": "2519223"
},
{
"input": "100\n6659 5574 5804 7566 7431 1431 3871 6703 200 300 3523 3580 8500 2312 4812 3149 3324 5846 8965 5758 5831 1341 7733 4477 355 3024 2941 9938 1494 16 1038 8262 9938 9230 5192 8113 7575 7696 5566 2884 8659 1951 1253 6480 3877 3707 5482 3825 5359 44 3219 3258 1785 5478 4525 5950 2417 1991 8885 4264 8769 2961 7107 8904 5097 2319 5713 8811 9723 8677 2153 3237 7174 9528 9260 7390 3050 6823 6239 5222 4602 933 7823 4198 8304 244 5845 3189 4490 3216 7877 6323 1938 4597 880 1206 1691 1405 4122 5950",
"output": "24496504"
},
{
"input": "50\n515844718 503470143 928669067 209884122 322869098 241621928 844696197 105586164 552680307 968792756 135928721 842094825 298782438 829020472 791637138 285482545 811025527 428952878 887796419 11883658 546401594 6272027 100292274 308219869 372132044 955814846 644008184 521195760 919389466 215065725 687764134 655750167 181397022 404292682 643251185 776299412 741398345 865144798 369796727 673902099 124966684 35796775 794385099 594562033 550366869 868093561 695094388 580789105 755076935 198783899",
"output": "685659563557"
},
{
"input": "10\n12528238 329065023 620046219 303914458 356423530 751571368 72944261 883971060 123105651 868129460",
"output": "27409624352"
},
{
"input": "1\n84355694",
"output": "84355694"
},
{
"input": "2\n885992042 510468669",
"output": "1906929379"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n2 1 2 2 2 2 1 2 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 1 2 1 1 2 1 1 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 2 2 1 1 1 2 2 1 1 2 1 1 2 2 2 2 1 2 2 2 1 2 1 2 2 1 2 1 1 1 2 2 1 2 1 2 1 1 1 2 1 2 2 2 1 1 1",
"output": "2686"
},
{
"input": "100\n1 3 2 1 1 2 1 3 2 2 3 1 1 1 2 2 1 3 3 1 1 2 2 3 2 1 3 1 3 2 1 1 3 3 2 1 2 2 2 3 2 2 3 2 2 3 2 1 3 1 1 2 1 3 2 2 1 1 1 1 1 1 3 1 2 3 1 1 1 1 1 2 3 3 1 1 1 1 2 3 3 1 3 2 2 3 2 1 3 2 2 3 1 1 3 2 3 2 3 1",
"output": "4667"
}
] | 1,593,866,414
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 280
| 0
|
import sys
def input():
return sys.stdin.readline().strip()
def iinput():
return int(input())
def tinput():
return input().split()
def rinput():
return map(int, tinput())
def rlinput():
return list(rinput())
n = iinput()
A = rlinput()
ans = 0
for i in range(n):
if A[i] != 1:
ans += A[i] + i
else:
ans += 1
print(ans)
|
Title: Testing Pants for Sadness
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=≤<=*a**i*<=≤<=109), the number of answer variants to question *i*.
Output Specification:
Print a single number — the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['2\n1 1\n', '2\n2 2\n', '1\n10\n']
Demo Output:
['2', '5', '10']
Note:
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
|
```python
import sys
def input():
return sys.stdin.readline().strip()
def iinput():
return int(input())
def tinput():
return input().split()
def rinput():
return map(int, tinput())
def rlinput():
return list(rinput())
n = iinput()
A = rlinput()
ans = 0
for i in range(n):
if A[i] != 1:
ans += A[i] + i
else:
ans += 1
print(ans)
```
| 0
|
453
|
A
|
Little Pony and Expected Maximum
|
PROGRAMMING
| 1,600
|
[
"probabilities"
] | null | null |
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
|
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
|
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
|
[
"6 1\n",
"6 3\n",
"2 2\n"
] |
[
"3.500000000000\n",
"4.958333333333\n",
"1.750000000000\n"
] |
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
| 500
|
[
{
"input": "6 1",
"output": "3.500000000000"
},
{
"input": "6 3",
"output": "4.958333333333"
},
{
"input": "2 2",
"output": "1.750000000000"
},
{
"input": "5 4",
"output": "4.433600000000"
},
{
"input": "5 8",
"output": "4.814773760000"
},
{
"input": "3 10",
"output": "2.982641534996"
},
{
"input": "3 6",
"output": "2.910836762689"
},
{
"input": "1 8",
"output": "1.000000000000"
},
{
"input": "24438 9",
"output": "21994.699969310015"
},
{
"input": "94444 9",
"output": "85000.099992058866"
},
{
"input": "8 66716",
"output": "8.000000000000"
},
{
"input": "4 25132",
"output": "4.000000000000"
},
{
"input": "51520 73331",
"output": "51519.682650242677"
},
{
"input": "54230 31747",
"output": "54228.743352775018"
},
{
"input": "24236 90163",
"output": "24235.975171545670"
},
{
"input": "26946 99523",
"output": "26945.974480086279"
},
{
"input": "50323 7",
"output": "44033.124988408454"
},
{
"input": "53033 3",
"output": "39775.249995286234"
},
{
"input": "55743 5",
"output": "46452.999992525307"
},
{
"input": "59964 79",
"output": "59214.949890211828"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "3 1",
"output": "2.000000000000"
},
{
"input": "1 2",
"output": "1.000000000000"
},
{
"input": "53513 34040",
"output": "53511.875329020870"
},
{
"input": "100000 100000",
"output": "99999.418033254507"
},
{
"input": "1 100000",
"output": "1.000000000000"
},
{
"input": "100000 1",
"output": "50000.499999999935"
},
{
"input": "2 100000",
"output": "2.000000000000"
},
{
"input": "100000 2",
"output": "66667.166665000332"
},
{
"input": "50000 100000",
"output": "49999.843487110789"
},
{
"input": "99999 1111",
"output": "99909.571915885972"
},
{
"input": "99999 99999",
"output": "99998.418033254609"
},
{
"input": "1000 1000",
"output": "999.419018443269"
},
{
"input": "50000 50000",
"output": "49999.418043215679"
},
{
"input": "88888 88888",
"output": "88887.418034499773"
},
{
"input": "99999 100000",
"output": "99998.418042461126"
},
{
"input": "100000 555",
"output": "99820.643422392372"
},
{
"input": "10000 10000",
"output": "9999.418122897887"
},
{
"input": "100000 5001",
"output": "99980.503829474910"
},
{
"input": "100000 1000",
"output": "99900.599066768002"
}
] | 1,672,316,570
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 124
| 0
|
m, n = map(int, input().split())
def N(x):
if x ==1:
return 1
return x**n - (x-1)**n
expect_max = 0
for x in range(1,m+1):
expect_max+=x*(((x/m)**n)-(((x-1)/m)**n))
print(expect_max)
|
Title: Little Pony and Expected Maximum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
Input Specification:
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
Output Specification:
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
Demo Input:
['6 1\n', '6 3\n', '2 2\n']
Demo Output:
['3.500000000000\n', '4.958333333333\n', '1.750000000000\n']
Note:
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
|
```python
m, n = map(int, input().split())
def N(x):
if x ==1:
return 1
return x**n - (x-1)**n
expect_max = 0
for x in range(1,m+1):
expect_max+=x*(((x/m)**n)-(((x-1)/m)**n))
print(expect_max)
```
| 3
|
|
768
|
B
|
Code For 1
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"dfs and similar",
"divide and conquer"
] | null | null |
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
|
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
|
Output the total number of 1s in the range *l* to *r* in the final sequence.
|
[
"7 2 5\n",
"10 3 10\n"
] |
[
"4\n",
"5\n"
] |
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
| 1,000
|
[
{
"input": "7 2 5",
"output": "4"
},
{
"input": "10 3 10",
"output": "5"
},
{
"input": "56 18 40",
"output": "20"
},
{
"input": "203 40 124",
"output": "67"
},
{
"input": "903316762502 354723010040 354723105411",
"output": "78355"
},
{
"input": "33534354842198 32529564319236 32529564342569",
"output": "22239"
},
{
"input": "62518534961045 50734311240112 50734311287877",
"output": "42439"
},
{
"input": "95173251245550 106288351347530 106288351372022",
"output": "16565"
},
{
"input": "542 321 956",
"output": "336"
},
{
"input": "3621 237 2637",
"output": "2124"
},
{
"input": "9056 336 896",
"output": "311"
},
{
"input": "36007 368 24490",
"output": "13253"
},
{
"input": "244269 149154 244246",
"output": "88609"
},
{
"input": "880234 669493 757150",
"output": "73585"
},
{
"input": "3740160 1031384 1104236",
"output": "64965"
},
{
"input": "11586121 15337246 15397874",
"output": "41868"
},
{
"input": "38658997 35923164 35985664",
"output": "36004"
},
{
"input": "192308932 207804787 207866400",
"output": "44142"
},
{
"input": "950099012 175922161 176000556",
"output": "69369"
},
{
"input": "2787326787 3799676481 3799680514",
"output": "2618"
},
{
"input": "14417262581 8527979363 8528075536",
"output": "80707"
},
{
"input": "39889373539 7747197212 7747278363",
"output": "47105"
},
{
"input": "251772781087 70597428577 70597479816",
"output": "46933"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "3 2 3",
"output": "2"
},
{
"input": "14 7 12",
"output": "5"
},
{
"input": "1125899906842623 1 100001",
"output": "100001"
},
{
"input": "1125899906842623 1125899906742623 1125899906842623",
"output": "100001"
},
{
"input": "1000 1 1023",
"output": "1000"
},
{
"input": "281474976710656 17179869184 17179869186",
"output": "1"
},
{
"input": "2 2 2",
"output": "0"
},
{
"input": "3 2 2",
"output": "1"
}
] | 1,680,165,670
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
def countOnes(n, l, r):
count = 0
for i in range(l, r+1):
if n % i == 0:
count += 1
return count
n = int(input())
l = int(input())
r = int(input())
count = countOnes(n, l, r)
print(count)
|
Title: Code For 1
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
Input Specification:
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
Output Specification:
Output the total number of 1s in the range *l* to *r* in the final sequence.
Demo Input:
['7 2 5\n', '10 3 10\n']
Demo Output:
['4\n', '5\n']
Note:
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
|
```python
def countOnes(n, l, r):
count = 0
for i in range(l, r+1):
if n % i == 0:
count += 1
return count
n = int(input())
l = int(input())
r = int(input())
count = countOnes(n, l, r)
print(count)
```
| -1
|
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,693,212,659
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
import math
for i in range(int(input())):
gcd=0
a,b=map(int,input().split())
x=math.factorial(a)
y=math.factorial(b)
if x>y:
temp=y
else:
temp=x
for i in range(1,temp+1):
if(a%i==0)and(b%i==0):
gcd=i
print(gcd)
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math
for i in range(int(input())):
gcd=0
a,b=map(int,input().split())
x=math.factorial(a)
y=math.factorial(b)
if x>y:
temp=y
else:
temp=x
for i in range(1,temp+1):
if(a%i==0)and(b%i==0):
gcd=i
print(gcd)
```
| -1
|
|
665
|
C
|
Simple Strings
|
PROGRAMMING
| 1,300
|
[
"dp",
"greedy",
"strings"
] | null | null |
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
|
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
|
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
|
[
"aab\n",
"caaab\n",
"zscoder\n"
] |
[
"bab\n",
"cabab\n",
"zscoder\n"
] |
none
| 0
|
[
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,632,549,889
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 27
| 139
| 30,003,200
|
"""
Summary of Code:
- Gets the string, convert it to string
- change the substring of the same letter with minimum difference
Time Complexity:
- O(2N) => O(N)
Space Complexity:
- O(N)
Why the chosen algorithm are good:
- the maximum of N is 2*10^5 and time complexity is O(N)
- thus it should be fast enough
"""
s = list(input()) + [""]
j = 0
for i in range(len(s)):
if s[j] == s[i]:
continue
else:
for k in range(j+((i-j)&1),i,2):
if 0 < k < len(s)-1:
s[k] = "a" if "a" not in {s[k-1], s[k+1]} else "b" if "b" not in {s[k-1], s[k+1]} else "c"
elif k == 0:
s[k] = "a" if s[k+1] != "a" else "b"
elif k == len(s)-1:
s[k] = "a" if s[k-1] != "a" else "b"
j = i
print("".join(s))
|
Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none
|
```python
"""
Summary of Code:
- Gets the string, convert it to string
- change the substring of the same letter with minimum difference
Time Complexity:
- O(2N) => O(N)
Space Complexity:
- O(N)
Why the chosen algorithm are good:
- the maximum of N is 2*10^5 and time complexity is O(N)
- thus it should be fast enough
"""
s = list(input()) + [""]
j = 0
for i in range(len(s)):
if s[j] == s[i]:
continue
else:
for k in range(j+((i-j)&1),i,2):
if 0 < k < len(s)-1:
s[k] = "a" if "a" not in {s[k-1], s[k+1]} else "b" if "b" not in {s[k-1], s[k+1]} else "c"
elif k == 0:
s[k] = "a" if s[k+1] != "a" else "b"
elif k == len(s)-1:
s[k] = "a" if s[k-1] != "a" else "b"
j = i
print("".join(s))
```
| 3
|
|
499
|
B
|
Lecture
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
|
The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
|
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
|
[
"4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n",
"5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n"
] |
[
"codeforces round letter round\n",
"hbnyiyc joll joll un joll\n"
] |
none
| 500
|
[
{
"input": "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest",
"output": "codeforces round letter round"
},
{
"input": "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll",
"output": "hbnyiyc joll joll un joll"
},
{
"input": "5 5\nqueyqj f\nb vn\ntabzvk qpfzoqx\nytnyonoc hnxsd\njpggvr lchinjmt\nqueyqj jpggvr b ytnyonoc b",
"output": "f jpggvr b hnxsd b"
},
{
"input": "10 22\nazbrll oen\ngh vdyayei\njphveblohx vfglv\nmfyxib jepnvhcuwo\nrpikazqj uam\nl rx\nokjenof qpnyi\nj tixqrno\nod itozmfct\nikkdxmirx ev\nqexftojc p\nkdazb zjs\nmbk ykvqjrxaxu\nhbcwhouzq pwt\nmirpsz zfaegpl\nuhkkvcj rlvwj\nef iqnnwtolrc\npjzfcpmeag ecdayth\nsa qcthz\ncbfhfxi qrnbvdryz\nwqel tj\natx smkbid\nef hbcwhouzq cbfhfxi hbcwhouzq mirpsz cbfhfxi cbfhfxi okjenof pjzfcpmeag kdazb",
"output": "ef pwt cbfhfxi pwt mirpsz cbfhfxi cbfhfxi qpnyi ecdayth zjs"
},
{
"input": "1 1\namit am\namit",
"output": "am"
},
{
"input": "1 1\na c\na",
"output": "a"
}
] | 1,656,408,547
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 0
|
# Abu Hurayra
import sys
def rs(): return sys.stdin.readline().rstrip()
def ri(): return int(sys.stdin.readline())
def ria(): return list(map(int, sys.stdin.readline().split()))
def ws(s): sys.stdout.write(s + '\n')
def wi(n): sys.stdout.write(str(n) + '\n')
def wia(a): sys.stdout.write(' '.join([str(x) for x in a]) + '\n')
# a = list(map(int, input().split()))
def main():
n, m = ria()
a = {}
for i in range(m):
x, y = rs().split(" ")
a[x] = y
q = rs().split(" ")
sol = []
for i in q:
if len(i) < len(a[i]):
sol.append(i)
else:
sol.append(a[i])
print(" ".join(sol))
if __name__ == '__main__':
main()
|
Title: Lecture
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
Input Specification:
The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
Output Specification:
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
Demo Input:
['4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n', '5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n']
Demo Output:
['codeforces round letter round\n', 'hbnyiyc joll joll un joll\n']
Note:
none
|
```python
# Abu Hurayra
import sys
def rs(): return sys.stdin.readline().rstrip()
def ri(): return int(sys.stdin.readline())
def ria(): return list(map(int, sys.stdin.readline().split()))
def ws(s): sys.stdout.write(s + '\n')
def wi(n): sys.stdout.write(str(n) + '\n')
def wia(a): sys.stdout.write(' '.join([str(x) for x in a]) + '\n')
# a = list(map(int, input().split()))
def main():
n, m = ria()
a = {}
for i in range(m):
x, y = rs().split(" ")
a[x] = y
q = rs().split(" ")
sol = []
for i in q:
if len(i) < len(a[i]):
sol.append(i)
else:
sol.append(a[i])
print(" ".join(sol))
if __name__ == '__main__':
main()
```
| 0
|
|
217
|
A
|
Ice Skating
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dfs and similar",
"dsu",
"graphs"
] | null | null |
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
|
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
|
[
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,617,758,709
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
def criaMonte(origem, destino, cont):
if origem[0] == destino[0] or origem[1] == destino[1]:
return cont
else:
distancia_y = abs(destino[1] - origem[1])
distancia_x = abs(destino[0] - origem[0])
if(distancia_y < distancia_x):
if origem[1] < destino[1]:
cont = criaMonte([origem[0], origem[1] + 1],destino, cont + 1)
elif origem[1] > destino[1]:
cont = criaMonte([origem[0], origem[1] - 1], destino, cont + 1)
else:
if origem[0] < destino[0]:
cont = criaMonte([origem[0] + 1, origem[1]],destino, cont + 1)
elif origem[0] > destino[0]:
criaMonte([origem[0] - 1, origem[1]], destino, cont + 1)
return cont
n = int(input())
cordenadas = []
for i in range(n):
entrada = input().split(" ")
cordenadas += [[int(entrada[0]), int(entrada[1])]]
if n <= 1:
montes = 0
else:
montes = 0
for i in range(1,n):
origem = cordenadas[i-1]
destino = cordenadas[i]
cont = criaMonte(origem,destino,0)
if cont > 0:
montes += 1
print(montes)
|
Title: Ice Skating
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
def criaMonte(origem, destino, cont):
if origem[0] == destino[0] or origem[1] == destino[1]:
return cont
else:
distancia_y = abs(destino[1] - origem[1])
distancia_x = abs(destino[0] - origem[0])
if(distancia_y < distancia_x):
if origem[1] < destino[1]:
cont = criaMonte([origem[0], origem[1] + 1],destino, cont + 1)
elif origem[1] > destino[1]:
cont = criaMonte([origem[0], origem[1] - 1], destino, cont + 1)
else:
if origem[0] < destino[0]:
cont = criaMonte([origem[0] + 1, origem[1]],destino, cont + 1)
elif origem[0] > destino[0]:
criaMonte([origem[0] - 1, origem[1]], destino, cont + 1)
return cont
n = int(input())
cordenadas = []
for i in range(n):
entrada = input().split(" ")
cordenadas += [[int(entrada[0]), int(entrada[1])]]
if n <= 1:
montes = 0
else:
montes = 0
for i in range(1,n):
origem = cordenadas[i-1]
destino = cordenadas[i]
cont = criaMonte(origem,destino,0)
if cont > 0:
montes += 1
print(montes)
```
| 0
|
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
|
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,645,693,802
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 109
| 614,400
|
import collections, math, bisect, sys
from collections import OrderedDict, Counter, defaultdict
from sys import stdin, stdout
import string
def get_line(): return list(map(int, sys.stdin.readline().strip().split()))
def in1(): return int(stdin.readline())
def display_arr(arr): stdout.write(" ".join(map(str, arr)) + "\n")
def display_num(num): stdout.write(str(num) + "\n")
def factorial(n): return n * factorial(n - 1) if n > 1 else 1
def percent(c, s): return (c / s) * 100
def l2d(a): return collections.Counter(a)
def with_index():
a, i = [], 0
for t in map(int, input().split()):
a.append((t, i))
i += 1
return a
def SieveOfEratosthenes(m,n):
prime = [True for i in range(n + 1)]
p = 2
while p * p <= n:
if prime[p]:
for i in range(p * p, n + 1, p):
prime[i] = False
p += 1
ans = 0
print(prime)
for p in range(2,n + 1):
if p <m:
break
if prime[p]:
ans += p
return ans
#
# par = [i for i in range(n+1)]
# # print(len(par), par)
# rank = [1]*(n+1)
# def find(n1):
# res = n1
# while res != par[res]:
# par[res] = par[par[res]]
# res = par[res]
# return res
#
# def union(n1, n2):
# p1, p2 = find(n1), find(n2)
# if p1 == p2:
# return 0
# if rank[p2] > ra nk[p1]:
# par[p1] = p2
# rank[p2] += rank[p1]
# else :
# par[p2] = p1
# rank[p1] += rank[p2]
# return 1
#
# res = n
def find_min(l,r,a):
mini = float("inf")
left = l
for i in range(l,r):
if a[i] < mini:
mini = a[i]
left = i
return left
def gcd(a,b):
res = 0
for i in range(2,min(a,b)):
if a%i==0 and b%i==0:
res = max(res,i)
return res
n = in1()
if n&1:
print(n//2)
n-=2
for i in range(n//2):
print(2,end=" ")
print(3)
else:
print(n//2)
for i in range(n//2):
print(2,end=" ")
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
import collections, math, bisect, sys
from collections import OrderedDict, Counter, defaultdict
from sys import stdin, stdout
import string
def get_line(): return list(map(int, sys.stdin.readline().strip().split()))
def in1(): return int(stdin.readline())
def display_arr(arr): stdout.write(" ".join(map(str, arr)) + "\n")
def display_num(num): stdout.write(str(num) + "\n")
def factorial(n): return n * factorial(n - 1) if n > 1 else 1
def percent(c, s): return (c / s) * 100
def l2d(a): return collections.Counter(a)
def with_index():
a, i = [], 0
for t in map(int, input().split()):
a.append((t, i))
i += 1
return a
def SieveOfEratosthenes(m,n):
prime = [True for i in range(n + 1)]
p = 2
while p * p <= n:
if prime[p]:
for i in range(p * p, n + 1, p):
prime[i] = False
p += 1
ans = 0
print(prime)
for p in range(2,n + 1):
if p <m:
break
if prime[p]:
ans += p
return ans
#
# par = [i for i in range(n+1)]
# # print(len(par), par)
# rank = [1]*(n+1)
# def find(n1):
# res = n1
# while res != par[res]:
# par[res] = par[par[res]]
# res = par[res]
# return res
#
# def union(n1, n2):
# p1, p2 = find(n1), find(n2)
# if p1 == p2:
# return 0
# if rank[p2] > ra nk[p1]:
# par[p1] = p2
# rank[p2] += rank[p1]
# else :
# par[p2] = p1
# rank[p1] += rank[p2]
# return 1
#
# res = n
def find_min(l,r,a):
mini = float("inf")
left = l
for i in range(l,r):
if a[i] < mini:
mini = a[i]
left = i
return left
def gcd(a,b):
res = 0
for i in range(2,min(a,b)):
if a%i==0 and b%i==0:
res = max(res,i)
return res
n = in1()
if n&1:
print(n//2)
n-=2
for i in range(n//2):
print(2,end=" ")
print(3)
else:
print(n//2)
for i in range(n//2):
print(2,end=" ")
```
| 3
|
|
981
|
A
|
Antipalindrome
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not.
A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$.
Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all.
Some time ago Ann read the word $s$. What is the word she changed it into?
|
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
|
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$.
Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
|
[
"mew\n",
"wuffuw\n",
"qqqqqqqq\n"
] |
[
"3\n",
"5\n",
"0\n"
] |
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$.
The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$.
All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
| 500
|
[
{
"input": "mew",
"output": "3"
},
{
"input": "wuffuw",
"output": "5"
},
{
"input": "qqqqqqqq",
"output": "0"
},
{
"input": "ijvji",
"output": "4"
},
{
"input": "iiiiiii",
"output": "0"
},
{
"input": "wobervhvvkihcuyjtmqhaaigvvgiaahqmtjyuchikvvhvrebow",
"output": "49"
},
{
"input": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww",
"output": "0"
},
{
"input": "wobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy",
"output": "50"
},
{
"input": "ijvxljt",
"output": "7"
},
{
"input": "fyhcncnchyf",
"output": "10"
},
{
"input": "ffffffffffff",
"output": "0"
},
{
"input": "fyhcncfsepqj",
"output": "12"
},
{
"input": "ybejrrlbcinttnicblrrjeby",
"output": "23"
},
{
"input": "yyyyyyyyyyyyyyyyyyyyyyyyy",
"output": "0"
},
{
"input": "ybejrrlbcintahovgjddrqatv",
"output": "25"
},
{
"input": "oftmhcmclgyqaojljoaqyglcmchmtfo",
"output": "30"
},
{
"input": "oooooooooooooooooooooooooooooooo",
"output": "0"
},
{
"input": "oftmhcmclgyqaojllbotztajglsmcilv",
"output": "32"
},
{
"input": "gxandbtgpbknxvnkjaajknvxnkbpgtbdnaxg",
"output": "35"
},
{
"input": "gggggggggggggggggggggggggggggggggggg",
"output": "0"
},
{
"input": "gxandbtgpbknxvnkjaygommzqitqzjfalfkk",
"output": "36"
},
{
"input": "fcliblymyqckxvieotjooojtoeivxkcqymylbilcf",
"output": "40"
},
{
"input": "fffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "fcliblymyqckxvieotjootiqwtyznhhvuhbaixwqnsy",
"output": "43"
},
{
"input": "rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr",
"output": "0"
},
{
"input": "rajccqwqnqmshmerpvjyfepxwpxyldzpzhctqjnstxyfmlhiy",
"output": "49"
},
{
"input": "a",
"output": "0"
},
{
"input": "abca",
"output": "4"
},
{
"input": "aaaaabaaaaa",
"output": "10"
},
{
"input": "aba",
"output": "2"
},
{
"input": "asaa",
"output": "4"
},
{
"input": "aabaa",
"output": "4"
},
{
"input": "aabbaa",
"output": "5"
},
{
"input": "abcdaaa",
"output": "7"
},
{
"input": "aaholaa",
"output": "7"
},
{
"input": "abcdefghijka",
"output": "12"
},
{
"input": "aaadcba",
"output": "7"
},
{
"input": "aaaabaaaa",
"output": "8"
},
{
"input": "abaa",
"output": "4"
},
{
"input": "abcbaa",
"output": "6"
},
{
"input": "ab",
"output": "2"
},
{
"input": "l",
"output": "0"
},
{
"input": "aaaabcaaaa",
"output": "10"
},
{
"input": "abbaaaaaabba",
"output": "11"
},
{
"input": "abaaa",
"output": "5"
},
{
"input": "baa",
"output": "3"
},
{
"input": "aaaaaaabbba",
"output": "11"
},
{
"input": "ccbcc",
"output": "4"
},
{
"input": "bbbaaab",
"output": "7"
},
{
"input": "abaaaaaaaa",
"output": "10"
},
{
"input": "abaaba",
"output": "5"
},
{
"input": "aabsdfaaaa",
"output": "10"
},
{
"input": "aaaba",
"output": "5"
},
{
"input": "aaabaaa",
"output": "6"
},
{
"input": "baaabbb",
"output": "7"
},
{
"input": "ccbbabbcc",
"output": "8"
},
{
"input": "cabc",
"output": "4"
},
{
"input": "aabcd",
"output": "5"
},
{
"input": "abcdea",
"output": "6"
},
{
"input": "bbabb",
"output": "4"
},
{
"input": "aaaaabababaaaaa",
"output": "14"
},
{
"input": "bbabbb",
"output": "6"
},
{
"input": "aababd",
"output": "6"
},
{
"input": "abaaaa",
"output": "6"
},
{
"input": "aaaaaaaabbba",
"output": "12"
},
{
"input": "aabca",
"output": "5"
},
{
"input": "aaabccbaaa",
"output": "9"
},
{
"input": "aaaaaaaaaaaaaaaaaaaab",
"output": "21"
},
{
"input": "babb",
"output": "4"
},
{
"input": "abcaa",
"output": "5"
},
{
"input": "qwqq",
"output": "4"
},
{
"input": "aaaaaaaaaaabbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaa",
"output": "48"
},
{
"input": "aaab",
"output": "4"
},
{
"input": "aaaaaabaaaaa",
"output": "12"
},
{
"input": "wwuww",
"output": "4"
},
{
"input": "aaaaabcbaaaaa",
"output": "12"
},
{
"input": "aaabbbaaa",
"output": "8"
},
{
"input": "aabcbaa",
"output": "6"
},
{
"input": "abccdefccba",
"output": "11"
},
{
"input": "aabbcbbaa",
"output": "8"
},
{
"input": "aaaabbaaaa",
"output": "9"
},
{
"input": "aabcda",
"output": "6"
},
{
"input": "abbca",
"output": "5"
},
{
"input": "aaaaaabbaaa",
"output": "11"
},
{
"input": "sssssspssssss",
"output": "12"
},
{
"input": "sdnmsdcs",
"output": "8"
},
{
"input": "aaabbbccbbbaaa",
"output": "13"
},
{
"input": "cbdbdc",
"output": "6"
},
{
"input": "abb",
"output": "3"
},
{
"input": "abcdefaaaa",
"output": "10"
},
{
"input": "abbbaaa",
"output": "7"
},
{
"input": "v",
"output": "0"
},
{
"input": "abccbba",
"output": "7"
},
{
"input": "axyza",
"output": "5"
},
{
"input": "abcdefgaaaa",
"output": "11"
},
{
"input": "aaabcdaaa",
"output": "9"
},
{
"input": "aaaacaaaa",
"output": "8"
},
{
"input": "aaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaa",
"output": "42"
},
{
"input": "abbbaa",
"output": "6"
},
{
"input": "abcdee",
"output": "6"
},
{
"input": "oom",
"output": "3"
},
{
"input": "aabcaa",
"output": "6"
},
{
"input": "abba",
"output": "3"
},
{
"input": "aaca",
"output": "4"
},
{
"input": "aacbca",
"output": "6"
},
{
"input": "ababa",
"output": "4"
},
{
"input": "abcda",
"output": "5"
},
{
"input": "cccaaccc",
"output": "7"
},
{
"input": "aaabcda",
"output": "7"
},
{
"input": "aa",
"output": "0"
},
{
"input": "aabaaaa",
"output": "7"
},
{
"input": "abbaaaa",
"output": "7"
},
{
"input": "aaabcbaaa",
"output": "8"
},
{
"input": "aabba",
"output": "5"
},
{
"input": "xyxx",
"output": "4"
},
{
"input": "aaaaaaaaaaaabc",
"output": "14"
},
{
"input": "bbaaaabb",
"output": "7"
},
{
"input": "aaabaa",
"output": "6"
},
{
"input": "sssssabsssss",
"output": "12"
},
{
"input": "bbbaaaabbb",
"output": "9"
},
{
"input": "abbbbaaaa",
"output": "9"
},
{
"input": "wwufuww",
"output": "6"
},
{
"input": "oowoo",
"output": "4"
},
{
"input": "cccaccc",
"output": "6"
},
{
"input": "aaa",
"output": "0"
},
{
"input": "bbbcc",
"output": "5"
},
{
"input": "abcdef",
"output": "6"
},
{
"input": "abbba",
"output": "4"
},
{
"input": "aab",
"output": "3"
},
{
"input": "aaba",
"output": "4"
},
{
"input": "azbyaaa",
"output": "7"
},
{
"input": "oooooiooooo",
"output": "10"
},
{
"input": "aabbbbbaaaaaa",
"output": "13"
}
] | 1,527,486,124
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
def docfile():
f = open('', 'r')
line = f.readline()
return line
if __name__ == "__main__":
word = input()
while word == word[::-1]:
word == word[0:-1]
return len(word)
|
Title: Antipalindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not.
A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$.
Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all.
Some time ago Ann read the word $s$. What is the word she changed it into?
Input Specification:
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
Output Specification:
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$.
Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
Demo Input:
['mew\n', 'wuffuw\n', 'qqqqqqqq\n']
Demo Output:
['3\n', '5\n', '0\n']
Note:
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$.
The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$.
All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
|
```python
def docfile():
f = open('', 'r')
line = f.readline()
return line
if __name__ == "__main__":
word = input()
while word == word[::-1]:
word == word[0:-1]
return len(word)
```
| -1
|
|
152
|
C
|
Pocket Book
|
PROGRAMMING
| 1,400
|
[
"combinatorics"
] | null | null |
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
|
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
|
Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
|
[
"2 3\nAAB\nBAA\n",
"4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n"
] |
[
"4\n",
"216\n"
] |
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB".
| 1,500
|
[
{
"input": "2 3\nAAB\nBAA",
"output": "4"
},
{
"input": "4 5\nABABA\nBCGDG\nAAAAA\nYABSA",
"output": "216"
},
{
"input": "1 1\nE",
"output": "1"
},
{
"input": "2 2\nNS\nPD",
"output": "4"
},
{
"input": "3 4\nPJKD\nNFJX\nFGFK",
"output": "81"
},
{
"input": "4 5\nSXFMY\nATHLM\nKDDQW\nZWGDS",
"output": "1024"
},
{
"input": "20 14\nJNFKBBBJYZHWQE\nLBOKZCPFNKDBJY\nXKNWGHQHIOXUPF\nDDNRUKVUGHWMXW\nMTIZFNAAFEAPHX\nIXBQOOHEULZYHU\nMRCSREUEOOMUUN\nHJTSQWKUFYZDQU\nGMCMUZCOPRVEIQ\nXBKKGGJECOBLTH\nXXHTLXCNJZJUAF\nVLJRKXXXWMTPKZ\nPTYMNPTBBCWKAD\nQYJGOBUBHMEDYE\nGTKUUVVNKAHTUI\nZNKXYZPCYLBZFP\nQCBLJTRMBDWNNE\nTDOKJOBKEOVNLZ\nFKZUITYAFJOQIM\nUWQNSGLXEEIRWF",
"output": "515139391"
},
{
"input": "5 14\nAQRXUQQNSKZPGC\nDTTKSPFGGVCLPT\nVLZQWWESCHDTAZ\nCOKOWDWDRUOMHP\nXDTRBIZTTCIDGS",
"output": "124999979"
},
{
"input": "9 23\nOILBYKHRGMPENVFNHLSIUOW\nLPJFHTUQUINAALRDGLSQUXR\nLYYJJEBNZATAFQWTDZSPUNZ\nHSJPIQKKWWERJZIEMLCZUKI\nOJYIEYDGPFWRHCMISJCCUEM\nLMGKZVFYIVDRTIHBWPCNUTG\nUBGGNCITVHAIPKXCLTSAULQ\nOWSAWUOXQDBSXXBHTLSXUVD\nUGQTIZQPBGMASRQPVPSFUWK",
"output": "454717784"
},
{
"input": "25 4\nLVKG\nMICU\nZHKW\nLFGG\nOWQO\nLCQG\nLVXU\nOUKB\nLNQX\nZJTO\nOOQX\nLVQP\nMFQB\nMRQV\nOIQH\nOPXX\nXFKU\nFCQB\nZPKH\nLVCH\nNFCU\nOVQW\nOZKU\nLFHX\nLPXO",
"output": "5733"
},
{
"input": "30 10\nUTNTGOKZYJ\nQHOUHNYZVW\nLTVGHJRZVW\nMZHYHOLZYJ\nERYEUEPZYE\nUZDBFTURYJ\nRVSMQTIZGW\nWDJQHMIRYY\nKCORHQPZYE\nRRPLFOZZVY\nJTXMFNNNYJ\nMVTGGOZZVV\nEHAFFNUZVF\nLBRNWJZNYE\nJVMOHTPZYJ\nWTARFJLZVV\nLVJCWOURVW\nLCLQFJYRVV\nQVBVGNJRYF\nNTZGHOLRYE\nMGQKHOUPYJ\nRRSSBXPZYJ\nRYCRGTLZYJ\nJRDEGNKRVW\nRZKFGHYRVG\nMDJBFNIZYG\nMPLWHXIZYE\nSRZMHMURVE\nMTEBBMRZYJ\nJPJIFOLZYM",
"output": "919913906"
},
{
"input": "40 7\nPNTVVER\nPAHTQDR\nRXMJVAS\nVIQNLYC\nILPUSVX\nYJOXQDJ\nSEFODTO\nOTJMREL\nLIQRZGD\nLBJJPOR\nRUTYHQO\nRIWEPBD\nKQUMFIB\nISTRRYH\nXBTOTGK\nRFQODEY\nHDSTZTP\nYCXFAGL\nAREGRFU\nLELZUYU\nGVABDKH\nFJAMMME\nACVULXE\nJHVPJAS\nAAQNMBX\nJJGUCXG\nOQATILQ\nNEOSHJM\nHFLWOFM\nICYEQHY\nFACGLYP\nPLLXJEQ\nDCHXYPB\nAGDDZJJ\nLSQRXTN\nHDQZXIY\nNAHDDWW\nQCMXRQN\nFDUDSZO\nHKBEVTW",
"output": "206575993"
},
{
"input": "2 2\nAA\nBB",
"output": "4"
},
{
"input": "1 10\nAAAAAAAAAA",
"output": "1"
},
{
"input": "2 8\nAAAAAAAA\nBBBBBBBB",
"output": "256"
},
{
"input": "10 10\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB",
"output": "1048576"
},
{
"input": "1 20\nAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "20 1\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF",
"output": "7"
},
{
"input": "5 60\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE",
"output": "449874206"
},
{
"input": "50 4\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ",
"output": "10000"
},
{
"input": "1 100\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "100 1\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA",
"output": "1"
},
{
"input": "100 1\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB",
"output": "2"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB",
"output": "14"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV",
"output": "26"
}
] | 1,623,159,956
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 248
| 0
|
n, m = map(int, input().split())
tp = [ [' '] for i in range(m) ]
for i in range(n):
a = input()
for j in range(m):
if not a[j] in tp[j]:
tp[j].append(a[j])
c = 1
for i in range(n):
c*=len(tp[i])-1
print((c*2)%1000000007)
|
Title: Pocket Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
Input Specification:
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
Output Specification:
Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\nAAB\nBAA\n', '4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n']
Demo Output:
['4\n', '216\n']
Note:
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB".
|
```python
n, m = map(int, input().split())
tp = [ [' '] for i in range(m) ]
for i in range(n):
a = input()
for j in range(m):
if not a[j] in tp[j]:
tp[j].append(a[j])
c = 1
for i in range(n):
c*=len(tp[i])-1
print((c*2)%1000000007)
```
| 0
|
|
420
|
A
|
Start Up
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it?
The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper.
There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not.
|
The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font:
|
Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes).
|
[
"AHA\n",
"Z\n",
"XO\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "AHA",
"output": "YES"
},
{
"input": "Z",
"output": "NO"
},
{
"input": "XO",
"output": "NO"
},
{
"input": "AAA",
"output": "YES"
},
{
"input": "AHHA",
"output": "YES"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "OMMMAAMMMO",
"output": "YES"
},
{
"input": "YYHUIUGYI",
"output": "NO"
},
{
"input": "TT",
"output": "YES"
},
{
"input": "UUU",
"output": "YES"
},
{
"input": "WYYW",
"output": "YES"
},
{
"input": "MITIM",
"output": "YES"
},
{
"input": "VO",
"output": "NO"
},
{
"input": "WWS",
"output": "NO"
},
{
"input": "VIYMAXXAVM",
"output": "NO"
},
{
"input": "OVWIHIWVYXMVAAAATOXWOIUUHYXHIHHVUIOOXWHOXTUUMUUVHVWWYUTIAUAITAOMHXWMTTOIVMIVOTHOVOIOHYHAOXWAUVWAVIVM",
"output": "NO"
},
{
"input": "CC",
"output": "NO"
},
{
"input": "QOQ",
"output": "NO"
},
{
"input": "AEEA",
"output": "NO"
},
{
"input": "OQQQO",
"output": "NO"
},
{
"input": "HNCMEEMCNH",
"output": "NO"
},
{
"input": "QDPINBMCRFWXPDBFGOZVVOCEMJRUCTOADEWEGTVBVBFWWRPGYEEYGPRWWFBVBVTGEWEDAOTCURJMECOVVZOGFBDPXWFRCMBNIPDQ",
"output": "NO"
},
{
"input": "A",
"output": "YES"
},
{
"input": "B",
"output": "NO"
},
{
"input": "C",
"output": "NO"
},
{
"input": "D",
"output": "NO"
},
{
"input": "E",
"output": "NO"
},
{
"input": "F",
"output": "NO"
},
{
"input": "G",
"output": "NO"
},
{
"input": "H",
"output": "YES"
},
{
"input": "I",
"output": "YES"
},
{
"input": "J",
"output": "NO"
},
{
"input": "K",
"output": "NO"
},
{
"input": "L",
"output": "NO"
},
{
"input": "M",
"output": "YES"
},
{
"input": "N",
"output": "NO"
},
{
"input": "O",
"output": "YES"
},
{
"input": "P",
"output": "NO"
},
{
"input": "Q",
"output": "NO"
},
{
"input": "R",
"output": "NO"
},
{
"input": "S",
"output": "NO"
},
{
"input": "T",
"output": "YES"
},
{
"input": "U",
"output": "YES"
},
{
"input": "V",
"output": "YES"
},
{
"input": "W",
"output": "YES"
},
{
"input": "X",
"output": "YES"
},
{
"input": "Y",
"output": "YES"
},
{
"input": "JL",
"output": "NO"
},
{
"input": "AAAKTAAA",
"output": "NO"
},
{
"input": "AKA",
"output": "NO"
},
{
"input": "AAJAA",
"output": "NO"
},
{
"input": "ABA",
"output": "NO"
},
{
"input": "AAAAAABAAAAAA",
"output": "NO"
},
{
"input": "ZZ",
"output": "NO"
},
{
"input": "ADA",
"output": "NO"
},
{
"input": "N",
"output": "NO"
},
{
"input": "P",
"output": "NO"
},
{
"input": "LAL",
"output": "NO"
},
{
"input": "AABAA",
"output": "NO"
},
{
"input": "AZA",
"output": "NO"
},
{
"input": "V",
"output": "YES"
},
{
"input": "SSS",
"output": "NO"
},
{
"input": "NNN",
"output": "NO"
},
{
"input": "S",
"output": "NO"
},
{
"input": "I",
"output": "YES"
},
{
"input": "SS",
"output": "NO"
},
{
"input": "E",
"output": "NO"
}
] | 1,661,606,326
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
S=input()
if len(S)==1 or S!=S[::-1]:
print('NO')
else:
Nb=0
for i in S:
if i in "BCDEFGJKLNPQRSZ"
Nb=1
break
if Nb==0:
print('YES')
else:
print('NO')
|
Title: Start Up
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it?
The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper.
There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not.
Input Specification:
The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font:
Output Specification:
Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes).
Demo Input:
['AHA\n', 'Z\n', 'XO\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
S=input()
if len(S)==1 or S!=S[::-1]:
print('NO')
else:
Nb=0
for i in S:
if i in "BCDEFGJKLNPQRSZ"
Nb=1
break
if Nb==0:
print('YES')
else:
print('NO')
```
| -1
|
|
624
|
B
|
Making a String
|
PROGRAMMING
| 1,100
|
[
"greedy",
"sortings"
] | null | null |
You are given an alphabet consisting of *n* letters, your task is to make a string of the maximum possible length so that the following conditions are satisfied:
- the *i*-th letter occurs in the string no more than *a**i* times; - the number of occurrences of each letter in the string must be distinct for all the letters that occurred in the string at least once.
|
The first line of the input contains a single integer *n* (2<=<=≤<=<=*n*<=<=≤<=<=26) — the number of letters in the alphabet.
The next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — *i*-th of these integers gives the limitation on the number of occurrences of the *i*-th character in the string.
|
Print a single integer — the maximum length of the string that meets all the requirements.
|
[
"3\n2 5 5\n",
"3\n1 1 2\n"
] |
[
"11\n",
"3\n"
] |
For convenience let's consider an alphabet consisting of three letters: "a", "b", "c". In the first sample, some of the optimal strings are: "cccaabbccbb", "aabcbcbcbcb". In the second sample some of the optimal strings are: "acc", "cbc".
| 1,000
|
[
{
"input": "3\n2 5 5",
"output": "11"
},
{
"input": "3\n1 1 2",
"output": "3"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "3\n1 1000000000 2",
"output": "1000000003"
},
{
"input": "26\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "25999999675"
},
{
"input": "2\n559476582 796461544",
"output": "1355938126"
},
{
"input": "2\n257775227 621811272",
"output": "879586499"
},
{
"input": "10\n876938317 219479349 703839299 977218449 116819315 752405530 393874852 286326991 592978634 155758306",
"output": "5075639042"
},
{
"input": "26\n72 49 87 47 94 96 36 91 43 11 19 83 36 38 10 93 95 81 4 96 60 38 97 37 36 41",
"output": "1478"
},
{
"input": "26\n243 364 768 766 633 535 502 424 502 283 592 877 137 891 837 990 681 898 831 487 595 604 747 856 805 688",
"output": "16535"
},
{
"input": "26\n775 517 406 364 548 951 680 984 466 141 960 513 660 849 152 250 176 601 199 370 971 554 141 224 724 543",
"output": "13718"
},
{
"input": "26\n475 344 706 807 925 813 974 166 578 226 624 591 419 894 574 909 544 597 170 990 893 785 399 172 792 748",
"output": "16115"
},
{
"input": "26\n130 396 985 226 487 671 188 706 106 649 38 525 210 133 298 418 953 431 577 69 12 982 264 373 283 266",
"output": "10376"
},
{
"input": "26\n605 641 814 935 936 547 524 702 133 674 173 102 318 620 248 523 77 718 318 635 322 362 306 86 8 442",
"output": "11768"
},
{
"input": "26\n220 675 725 888 725 654 546 806 379 182 604 667 734 394 889 731 572 193 850 651 844 734 163 671 820 887",
"output": "16202"
},
{
"input": "26\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "25675"
},
{
"input": "26\n1001 1001 1000 1000 1001 1000 1001 1001 1001 1000 1000 1001 1001 1000 1000 1000 1000 1001 1000 1001 1001 1000 1001 1001 1001 1000",
"output": "25701"
},
{
"input": "26\n1000 1001 1000 1001 1000 1001 1001 1000 1001 1002 1002 1000 1001 1000 1000 1000 1001 1002 1001 1000 1000 1001 1000 1002 1001 1002",
"output": "25727"
},
{
"input": "26\n1003 1002 1002 1003 1000 1000 1000 1003 1000 1001 1003 1003 1000 1002 1002 1002 1001 1003 1000 1001 1000 1001 1001 1000 1003 1003",
"output": "25753"
},
{
"input": "26\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "26\n8717 9417 1409 7205 3625 6247 8626 9486 464 4271 1698 8449 4551 1528 7456 9198 4886 2889 7534 506 7867 9410 1635 4955 2580 2580",
"output": "137188"
},
{
"input": "26\n197464663 125058028 622449215 11119637 587496049 703992162 219591040 965159268 229879004 278894000 841629744 616893922 218779915 362575332 844188865 342411376 369680019 43823059 921419789 999588082 943769007 35365522 301907919 758302419 427454397 807507709",
"output": "12776400142"
},
{
"input": "26\n907247856 970380443 957324066 929910532 947150618 944189007 998282297 988343406 981298600 943026596 953932265 972691398 950024048 923033790 996423650 972134755 946404759 918183059 902987271 965507679 906967700 982106487 933997242 972594441 977736332 928874832",
"output": "24770753129"
},
{
"input": "26\n999999061 999999688 999999587 999999429 999999110 999999563 999999120 999999111 999999794 999999890 999999004 999999448 999999770 999999543 999999460 999999034 999999361 999999305 999999201 999999778 999999432 999999844 999999133 999999342 999999600 999999319",
"output": "25999984927"
},
{
"input": "3\n587951561 282383259 612352726",
"output": "1482687546"
},
{
"input": "4\n111637338 992238139 787658714 974622806",
"output": "2866156997"
},
{
"input": "5\n694257603 528073418 726928894 596328666 652863391",
"output": "3198451972"
},
{
"input": "6\n217943380 532900593 902234882 513005821 369342573 495810412",
"output": "3031237661"
},
{
"input": "7\n446656860 478792281 77541870 429682977 85821755 826122363 563802405",
"output": "2908420511"
},
{
"input": "8\n29278125 778590752 252847858 51388836 802299938 215370803 901540149 242074772",
"output": "3273391233"
},
{
"input": "9\n552962902 724482439 133182550 673093696 518779120 604618242 534250189 847695567 403066553",
"output": "4992131258"
},
{
"input": "10\n600386086 862479376 284190454 781950823 672077209 5753052 145701234 680334621 497013634 35429365",
"output": "4565315854"
},
{
"input": "11\n183007351 103343359 164525146 698627979 388556391 926007595 483438978 580927711 659384363 201890880 920750904",
"output": "5310460657"
},
{
"input": "12\n706692128 108170535 339831134 320333838 810063277 20284739 821176722 481520801 467848308 604388203 881959821 874133307",
"output": "6436402813"
},
{
"input": "13\n525349200 54062222 810108418 237010994 821513756 409532178 158915465 87142595 630219037 770849718 843168738 617993222 504443485",
"output": "6470309028"
},
{
"input": "14\n812998169 353860693 690443110 153688149 537992938 798779618 791624505 282706982 733654279 468319337 568341847 597888944 649703235 667623671",
"output": "8107625477"
},
{
"input": "15\n336683946 299752380 865749098 775393009 959499824 893055762 365399057 419335880 896025008 575845364 529550764 341748859 30999793 464432689 19445239",
"output": "7772916672"
},
{
"input": "16\n860368723 540615364 41056086 692070164 970950302 282304201 998108096 24957674 999460249 37279175 490759681 26673285 412295352 671298115 627182888 90740349",
"output": "7766119704"
},
{
"input": "17\n148018692 545442539 980325266 313776023 687429485 376580345 40875544 925549764 161831978 144805202 451968598 475560904 262583806 468107133 60900936 281546097 912565045",
"output": "7237867357"
},
{
"input": "18\n966674765 786305522 860659958 935480883 108937371 60800080 673584584 826142855 560238516 606238013 413177515 455456626 643879364 969943855 963609881 177380550 544192822 864797474",
"output": "11417500634"
},
{
"input": "19\n490360541 496161402 330938242 852158038 120387849 686083328 247359135 431764649 427637949 8736336 843378328 435352349 494167818 766752874 161292122 368186298 470791896 813444279 170758124",
"output": "8615711557"
},
{
"input": "20\n654616375 542649443 729213190 188364665 238384327 726353863 974350390 526804424 601329631 886592063 734805196 275562411 861801362 374466292 119830901 403120565 670982545 63210795 130397643 601611646",
"output": "10304447727"
},
{
"input": "21\n942265343 252505322 904519178 810069524 954862509 115602302 548124942 132426218 999736168 584061682 696014113 960485837 712089816 581331718 317512142 593926314 302610323 716885305 477125514 813997503 535631456",
"output": "12951783229"
},
{
"input": "22\n465951120 788339601 784853870 726746679 376370396 504849742 180834982 33019308 867135601 455551901 657223030 940381560 93386374 378140736 161286599 548696254 934237100 75589518 764917898 731412064 205669368 630662937",
"output": "11305256638"
},
{
"input": "23\n989635897 498195481 255132154 643423835 387820874 894097181 223601429 228583694 265543138 153021520 618431947 684241474 943673829 174949754 358967839 444530707 801900686 965299835 347682577 648826625 406714384 129525158 958578251",
"output": "12022378269"
},
{
"input": "24\n277285866 739058464 135466846 265129694 104300056 519381429 856310469 834204489 132942572 260547547 343605057 664137197 619941683 676786476 497713592 635336455 138557168 618975345 635474960 861212482 76752297 923357675 517046816 274123722",
"output": "11607648357"
},
{
"input": "25\n95942939 979921447 310772834 181806850 525806942 613657573 194049213 734797579 531349109 721980358 304813974 113025815 470230137 473595494 695394833 590106396 770183946 567622150 218239639 778627043 41761505 127248600 134450869 860350034 901937574",
"output": "11937672853"
},
{
"input": "26\n619627716 984748623 486078822 98484005 537257421 2906012 62795060 635390669 103777246 829506385 971050595 92921538 851525695 680460920 893076074 780912144 401811723 221297659 269996214 991012900 242806521 626109821 987889730 682613155 209557740 806895799",
"output": "14070510187"
},
{
"input": "26\n10 1 20 2 23 3 14 6 7 13 26 21 11 8 16 25 12 15 19 9 17 22 24 18 5 4",
"output": "351"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "5\n5 3 3 3 1",
"output": "11"
},
{
"input": "5\n2 2 2 2 2",
"output": "3"
},
{
"input": "10\n10 10 10 10 10 10 10 10 1 1",
"output": "53"
},
{
"input": "10\n100 100 10 10 10 10 10 1 1 1",
"output": "240"
},
{
"input": "6\n5 3 3 3 3 1",
"output": "11"
},
{
"input": "4\n4 3 2 1",
"output": "10"
},
{
"input": "5\n1 1 1 1 1",
"output": "1"
}
] | 1,472,001,517
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 46
| 4,608,000
|
n = int(input())
a = list(map(int,input().split()))
a.sort(reverse=True)
ans = a[0]
for i in range(1,len(a)):
if a[i]==a[i-1]:
ans += a[i]-1
else:
ans += a[i]
print(ans)
|
Title: Making a String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an alphabet consisting of *n* letters, your task is to make a string of the maximum possible length so that the following conditions are satisfied:
- the *i*-th letter occurs in the string no more than *a**i* times; - the number of occurrences of each letter in the string must be distinct for all the letters that occurred in the string at least once.
Input Specification:
The first line of the input contains a single integer *n* (2<=<=≤<=<=*n*<=<=≤<=<=26) — the number of letters in the alphabet.
The next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — *i*-th of these integers gives the limitation on the number of occurrences of the *i*-th character in the string.
Output Specification:
Print a single integer — the maximum length of the string that meets all the requirements.
Demo Input:
['3\n2 5 5\n', '3\n1 1 2\n']
Demo Output:
['11\n', '3\n']
Note:
For convenience let's consider an alphabet consisting of three letters: "a", "b", "c". In the first sample, some of the optimal strings are: "cccaabbccbb", "aabcbcbcbcb". In the second sample some of the optimal strings are: "acc", "cbc".
|
```python
n = int(input())
a = list(map(int,input().split()))
a.sort(reverse=True)
ans = a[0]
for i in range(1,len(a)):
if a[i]==a[i-1]:
ans += a[i]-1
else:
ans += a[i]
print(ans)
```
| 0
|
|
1,008
|
A
|
Romaji
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
|
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
|
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
|
[
"sumimasen\n",
"ninja\n",
"codeforces\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
| 500
|
[
{
"input": "sumimasen",
"output": "YES"
},
{
"input": "ninja",
"output": "YES"
},
{
"input": "codeforces",
"output": "NO"
},
{
"input": "auuaoonntanonnuewannnnpuuinniwoonennyolonnnvienonpoujinndinunnenannmuveoiuuhikucuziuhunnnmunzancenen",
"output": "YES"
},
{
"input": "n",
"output": "YES"
},
{
"input": "necnei",
"output": "NO"
},
{
"input": "nternn",
"output": "NO"
},
{
"input": "aucunuohja",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "b",
"output": "NO"
},
{
"input": "nn",
"output": "YES"
},
{
"input": "nnnzaaa",
"output": "YES"
},
{
"input": "zn",
"output": "NO"
},
{
"input": "ab",
"output": "NO"
},
{
"input": "aaaaaaaaaa",
"output": "YES"
},
{
"input": "aaaaaaaaab",
"output": "NO"
},
{
"input": "aaaaaaaaan",
"output": "YES"
},
{
"input": "baaaaaaaaa",
"output": "YES"
},
{
"input": "naaaaaaaaa",
"output": "YES"
},
{
"input": "nbaaaaaaaa",
"output": "YES"
},
{
"input": "bbaaaaaaaa",
"output": "NO"
},
{
"input": "bnaaaaaaaa",
"output": "NO"
},
{
"input": "eonwonojannonnufimiiniewuqaienokacevecinfuqihatenhunliquuyebayiaenifuexuanenuaounnboancaeowonu",
"output": "YES"
},
{
"input": "uixinnepnlinqaingieianndeakuniooudidonnnqeaituioeneiroionxuowudiooonayenfeonuino",
"output": "NO"
},
{
"input": "nnnnnyigaveteononnnnxaalenxuiiwannntoxonyoqonlejuoxuoconnnentoinnul",
"output": "NO"
},
{
"input": "ndonneasoiunhomuunnhuitonnntunntoanerekonoupunanuauenu",
"output": "YES"
},
{
"input": "anujemogawautiedoneobninnibonuunaoennnyoorufonxionntinimiboonununnnnnleenqunminzayoutanlalo",
"output": "NO"
},
{
"input": "y",
"output": "NO"
},
{
"input": "by",
"output": "NO"
},
{
"input": "yy",
"output": "NO"
},
{
"input": "nbn",
"output": "NO"
},
{
"input": "nz",
"output": "NO"
},
{
"input": "king",
"output": "NO"
},
{
"input": "g",
"output": "NO"
},
{
"input": "az",
"output": "NO"
},
{
"input": "x",
"output": "NO"
},
{
"input": "z",
"output": "NO"
},
{
"input": "yn",
"output": "NO"
},
{
"input": "aeo",
"output": "YES"
},
{
"input": "nb",
"output": "NO"
},
{
"input": "npn",
"output": "NO"
},
{
"input": "kini",
"output": "YES"
},
{
"input": "pya",
"output": "NO"
},
{
"input": "m",
"output": "NO"
},
{
"input": "p",
"output": "NO"
},
{
"input": "aaaaaaaak",
"output": "NO"
},
{
"input": "aab",
"output": "NO"
},
{
"input": "d",
"output": "NO"
},
{
"input": "at",
"output": "NO"
},
{
"input": "aaaaaak",
"output": "NO"
},
{
"input": "aaz",
"output": "NO"
},
{
"input": "aaab",
"output": "NO"
},
{
"input": "s",
"output": "NO"
},
{
"input": "nzzen",
"output": "NO"
},
{
"input": "aeionnhhhn",
"output": "NO"
},
{
"input": "h",
"output": "NO"
},
{
"input": "ny",
"output": "NO"
}
] | 1,637,249,474
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
text=input()
l=len(text)
zero=0
one=0
a=0
for i in range(l):
if text[i]=='0':
one=0
zero=zero+1
if zero>=7:
a=1
break
elif text[i]=='1':
zero=0
one=one+1
if one>=7:
a=1
break
if a==1:
print('YES')
else:
print('NO')
|
Title: Romaji
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
Input Specification:
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
Output Specification:
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
Demo Input:
['sumimasen\n', 'ninja\n', 'codeforces\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
|
```python
text=input()
l=len(text)
zero=0
one=0
a=0
for i in range(l):
if text[i]=='0':
one=0
zero=zero+1
if zero>=7:
a=1
break
elif text[i]=='1':
zero=0
one=one+1
if one>=7:
a=1
break
if a==1:
print('YES')
else:
print('NO')
```
| 0
|
|
789
|
A
|
Anastasia and pebbles
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
Anastasia loves going for a walk in Central Uzhlyandian Park. But she became uninterested in simple walking, so she began to collect Uzhlyandian pebbles. At first, she decided to collect all the pebbles she could find in the park.
She has only two pockets. She can put at most *k* pebbles in each pocket at the same time. There are *n* different pebble types in the park, and there are *w**i* pebbles of the *i*-th type. Anastasia is very responsible, so she never mixes pebbles of different types in same pocket. However, she can put different kinds of pebbles in different pockets at the same time. Unfortunately, she can't spend all her time collecting pebbles, so she can collect pebbles from the park only once a day.
Help her to find the minimum number of days needed to collect all the pebbles of Uzhlyandian Central Park, taking into consideration that Anastasia can't place pebbles of different types in same pocket.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=109) — the number of different pebble types and number of pebbles Anastasia can place in one pocket.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=≤<=*w**i*<=≤<=104) — number of pebbles of each type.
|
The only line of output contains one integer — the minimum number of days Anastasia needs to collect all the pebbles.
|
[
"3 2\n2 3 4\n",
"5 4\n3 1 8 9 7\n"
] |
[
"3\n",
"5\n"
] |
In the first sample case, Anastasia can collect all pebbles of the first type on the first day, of second type — on the second day, and of third type — on the third day.
Optimal sequence of actions in the second sample case:
- In the first day Anastasia collects 8 pebbles of the third type. - In the second day she collects 8 pebbles of the fourth type. - In the third day she collects 3 pebbles of the first type and 1 pebble of the fourth type. - In the fourth day she collects 7 pebbles of the fifth type. - In the fifth day she collects 1 pebble of the second type.
| 500
|
[
{
"input": "3 2\n2 3 4",
"output": "3"
},
{
"input": "5 4\n3 1 8 9 7",
"output": "5"
},
{
"input": "1 22\n1",
"output": "1"
},
{
"input": "3 57\n78 165 54",
"output": "3"
},
{
"input": "5 72\n74 10 146 189 184",
"output": "6"
},
{
"input": "9 13\n132 87 200 62 168 51 185 192 118",
"output": "48"
},
{
"input": "1 1\n10000",
"output": "5000"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "2 2\n2 2",
"output": "1"
}
] | 1,560,716,255
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
using namespace std;
int main() {
int n, k;
cin >> n >> k;
int portion = 0;
for (int i = 0; i < n; ++i) {
int w;
cin >> w;
portion += (w + k - 1) / k;
}
cout << (portion + 1) / 2;
return 0;
}
|
Title: Anastasia and pebbles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anastasia loves going for a walk in Central Uzhlyandian Park. But she became uninterested in simple walking, so she began to collect Uzhlyandian pebbles. At first, she decided to collect all the pebbles she could find in the park.
She has only two pockets. She can put at most *k* pebbles in each pocket at the same time. There are *n* different pebble types in the park, and there are *w**i* pebbles of the *i*-th type. Anastasia is very responsible, so she never mixes pebbles of different types in same pocket. However, she can put different kinds of pebbles in different pockets at the same time. Unfortunately, she can't spend all her time collecting pebbles, so she can collect pebbles from the park only once a day.
Help her to find the minimum number of days needed to collect all the pebbles of Uzhlyandian Central Park, taking into consideration that Anastasia can't place pebbles of different types in same pocket.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=109) — the number of different pebble types and number of pebbles Anastasia can place in one pocket.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=≤<=*w**i*<=≤<=104) — number of pebbles of each type.
Output Specification:
The only line of output contains one integer — the minimum number of days Anastasia needs to collect all the pebbles.
Demo Input:
['3 2\n2 3 4\n', '5 4\n3 1 8 9 7\n']
Demo Output:
['3\n', '5\n']
Note:
In the first sample case, Anastasia can collect all pebbles of the first type on the first day, of second type — on the second day, and of third type — on the third day.
Optimal sequence of actions in the second sample case:
- In the first day Anastasia collects 8 pebbles of the third type. - In the second day she collects 8 pebbles of the fourth type. - In the third day she collects 3 pebbles of the first type and 1 pebble of the fourth type. - In the fourth day she collects 7 pebbles of the fifth type. - In the fifth day she collects 1 pebble of the second type.
|
```python
#include <iostream>
using namespace std;
int main() {
int n, k;
cin >> n >> k;
int portion = 0;
for (int i = 0; i < n; ++i) {
int w;
cin >> w;
portion += (w + k - 1) / k;
}
cout << (portion + 1) / 2;
return 0;
}
```
| -1
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,649,253,933
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 46
| 0
|
n = input()
hello = ("hello")
count = 0
for i in range(len(n)):
if n[i]== hello[count]:
count+= 1
if count == 5:
break
if count == 5:
print('YES')
else:
print('NO')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n = input()
hello = ("hello")
count = 0
for i in range(len(n)):
if n[i]== hello[count]:
count+= 1
if count == 5:
break
if count == 5:
print('YES')
else:
print('NO')
```
| 3.977
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,686,128,826
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 92
| 0
|
n=int(input())
l=list(map(int,input().split()))
mi,ma=l[0],l[0]
c=0
for i in range(1,n):
if mi>l[i]:
mi=l[i]
c+=1
elif ma<l[i]:
ma=l[i]
c+=1
print(c)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
n=int(input())
l=list(map(int,input().split()))
mi,ma=l[0],l[0]
c=0
for i in range(1,n):
if mi>l[i]:
mi=l[i]
c+=1
elif ma<l[i]:
ma=l[i]
c+=1
print(c)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
|
Print the smallest pretty integer.
|
[
"2 3\n4 2\n5 7 6\n",
"8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n"
] |
[
"25\n",
"1\n"
] |
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
| 0
|
[
{
"input": "2 3\n4 2\n5 7 6",
"output": "25"
},
{
"input": "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n9\n1",
"output": "19"
},
{
"input": "9 1\n5 4 2 3 6 1 7 9 8\n9",
"output": "9"
},
{
"input": "5 3\n7 2 5 8 6\n3 1 9",
"output": "12"
},
{
"input": "4 5\n5 2 6 4\n8 9 1 3 7",
"output": "12"
},
{
"input": "5 9\n4 2 1 6 7\n2 3 4 5 6 7 8 9 1",
"output": "1"
},
{
"input": "9 9\n5 4 3 2 1 6 7 8 9\n3 2 1 5 4 7 8 9 6",
"output": "1"
},
{
"input": "9 5\n2 3 4 5 6 7 8 9 1\n4 2 1 6 7",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n8\n9",
"output": "89"
},
{
"input": "1 1\n9\n8",
"output": "89"
},
{
"input": "1 1\n1\n2",
"output": "12"
},
{
"input": "1 1\n2\n1",
"output": "12"
},
{
"input": "1 1\n9\n9",
"output": "9"
},
{
"input": "1 1\n1\n1",
"output": "1"
},
{
"input": "4 5\n3 2 4 5\n1 6 5 9 8",
"output": "5"
},
{
"input": "3 2\n4 5 6\n1 5",
"output": "5"
},
{
"input": "5 4\n1 3 5 6 7\n2 4 3 9",
"output": "3"
},
{
"input": "5 5\n1 3 5 7 9\n2 4 6 8 9",
"output": "9"
},
{
"input": "2 2\n1 8\n2 8",
"output": "8"
},
{
"input": "5 5\n5 6 7 8 9\n1 2 3 4 5",
"output": "5"
},
{
"input": "5 5\n1 2 3 4 5\n1 2 3 4 5",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6",
"output": "2"
},
{
"input": "2 2\n1 5\n2 5",
"output": "5"
},
{
"input": "4 4\n1 3 5 8\n2 4 6 8",
"output": "8"
},
{
"input": "3 3\n1 5 3\n2 5 7",
"output": "5"
},
{
"input": "3 3\n3 6 8\n2 6 9",
"output": "6"
},
{
"input": "2 2\n1 4\n2 4",
"output": "4"
},
{
"input": "5 3\n3 4 5 6 7\n1 5 9",
"output": "5"
},
{
"input": "4 4\n1 2 3 4\n2 5 6 7",
"output": "2"
},
{
"input": "5 5\n1 2 3 4 5\n9 2 1 7 5",
"output": "1"
},
{
"input": "2 2\n1 3\n2 3",
"output": "3"
},
{
"input": "3 3\n3 2 1\n3 2 1",
"output": "1"
},
{
"input": "3 3\n1 3 5\n2 3 6",
"output": "3"
},
{
"input": "3 3\n5 6 7\n5 6 7",
"output": "5"
},
{
"input": "1 2\n5\n2 5",
"output": "5"
},
{
"input": "3 3\n2 4 9\n7 8 9",
"output": "9"
},
{
"input": "3 3\n1 2 4\n3 4 5",
"output": "4"
},
{
"input": "3 2\n1 4 9\n2 4",
"output": "4"
},
{
"input": "3 3\n3 5 6\n1 5 9",
"output": "5"
},
{
"input": "3 2\n1 2 4\n3 4",
"output": "4"
},
{
"input": "2 4\n8 9\n1 2 3 9",
"output": "9"
},
{
"input": "1 2\n9\n8 9",
"output": "9"
},
{
"input": "3 2\n1 2 4\n4 2",
"output": "2"
},
{
"input": "2 3\n4 5\n1 3 5",
"output": "5"
},
{
"input": "3 2\n1 2 3\n2 3",
"output": "2"
},
{
"input": "4 3\n1 3 5 9\n2 8 9",
"output": "9"
},
{
"input": "2 2\n1 9\n9 2",
"output": "9"
}
] | 1,508,055,131
| 431
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 3
| 62
| 5,529,600
|
n,m=map(int,input().split())
ar1=list(map(int,input().split()))
ar2=list(map(int,input().split()))
ar1.sort()
ar2.sort()
num=0
if(ar1[0]==ar2[0]):
print(ar1[0])
elif(ar1[0]<ar2[0]):
num=ar1[0]
num=num*10+ar2[0]
print(num)
else:
num=ar2[0]
num=num*10+ar1[0]
print(num)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
Output Specification:
Print the smallest pretty integer.
Demo Input:
['2 3\n4 2\n5 7 6\n', '8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n']
Demo Output:
['25\n', '1\n']
Note:
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
|
```python
n,m=map(int,input().split())
ar1=list(map(int,input().split()))
ar2=list(map(int,input().split()))
ar1.sort()
ar2.sort()
num=0
if(ar1[0]==ar2[0]):
print(ar1[0])
elif(ar1[0]<ar2[0]):
num=ar1[0]
num=num*10+ar2[0]
print(num)
else:
num=ar2[0]
num=num*10+ar1[0]
print(num)
```
| 0
|
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,560,753,867
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 109
| 0
|
a, b = map(int, input().split())
player1 = 0
player2 = 0
draw = 0
for i in range(1, 7):
if abs(a - i) < abs(b - i):
player1 = player1 + 1
elif abs(a - i) > abs(b - i):
player2 = player2 + 1
else:
draw += 1
print(str(player1) + " " + str(draw) + " " + str(player2))
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
a, b = map(int, input().split())
player1 = 0
player2 = 0
draw = 0
for i in range(1, 7):
if abs(a - i) < abs(b - i):
player1 = player1 + 1
elif abs(a - i) > abs(b - i):
player2 = player2 + 1
else:
draw += 1
print(str(player1) + " " + str(draw) + " " + str(player2))
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,672,949,234
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
data = list(iter(input, '')) # собираем вводные данные
data.pop(0) # удалем цифру в начале
def func(x): # создаем функцию преобразователь
a = list(x) # сразу с построчным выводом переменных
b = len(a)
c = a[0]
d = a[-1]
e = (b - 2)
if b >= 10:
return print(c, e, d, sep="")
elif b < 10:
return print(x)
change = [func(i) for i in data] # итерируем все переменные в списке
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
data = list(iter(input, '')) # собираем вводные данные
data.pop(0) # удалем цифру в начале
def func(x): # создаем функцию преобразователь
a = list(x) # сразу с построчным выводом переменных
b = len(a)
c = a[0]
d = a[-1]
e = (b - 2)
if b >= 10:
return print(c, e, d, sep="")
elif b < 10:
return print(x)
change = [func(i) for i in data] # итерируем все переменные в списке
```
| -1
|
412
|
A
|
Poster
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
The R1 company has recently bought a high rise building in the centre of Moscow for its main office. It's time to decorate the new office, and the first thing to do is to write the company's slogan above the main entrance to the building.
The slogan of the company consists of *n* characters, so the decorators hung a large banner, *n* meters wide and 1 meter high, divided into *n* equal squares. The first character of the slogan must be in the first square (the leftmost) of the poster, the second character must be in the second square, and so on.
Of course, the R1 programmers want to write the slogan on the poster themselves. To do this, they have a large (and a very heavy) ladder which was put exactly opposite the *k*-th square of the poster. To draw the *i*-th character of the slogan on the poster, you need to climb the ladder, standing in front of the *i*-th square of the poster. This action (along with climbing up and down the ladder) takes one hour for a painter. The painter is not allowed to draw characters in the adjacent squares when the ladder is in front of the *i*-th square because the uncomfortable position of the ladder may make the characters untidy. Besides, the programmers can move the ladder. In one hour, they can move the ladder either a meter to the right or a meter to the left.
Drawing characters and moving the ladder is very tiring, so the programmers want to finish the job in as little time as possible. Develop for them an optimal poster painting plan!
|
The first line contains two integers, *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of characters in the slogan and the initial position of the ladder, correspondingly. The next line contains the slogan as *n* characters written without spaces. Each character of the slogan is either a large English letter, or digit, or one of the characters: '.', '!', ',', '?'.
|
In *t* lines, print the actions the programmers need to make. In the *i*-th line print:
- "LEFT" (without the quotes), if the *i*-th action was "move the ladder to the left"; - "RIGHT" (without the quotes), if the *i*-th action was "move the ladder to the right"; - "PRINT *x*" (without the quotes), if the *i*-th action was to "go up the ladder, paint character *x*, go down the ladder".
The painting time (variable *t*) must be minimum possible. If there are multiple optimal painting plans, you can print any of them.
|
[
"2 2\nR1\n",
"2 1\nR1\n",
"6 4\nGO?GO!\n"
] |
[
"PRINT 1\nLEFT\nPRINT R\n",
"PRINT R\nRIGHT\nPRINT 1\n",
"RIGHT\nRIGHT\nPRINT !\nLEFT\nPRINT O\nLEFT\nPRINT G\nLEFT\nPRINT ?\nLEFT\nPRINT O\nLEFT\nPRINT G\n"
] |
Note that the ladder cannot be shifted by less than one meter. The ladder can only stand in front of some square of the poster. For example, you cannot shift a ladder by half a meter and position it between two squares. Then go up and paint the first character and the second character.
| 500
|
[
{
"input": "2 2\nR1",
"output": "PRINT 1\nLEFT\nPRINT R"
},
{
"input": "2 1\nR1",
"output": "PRINT R\nRIGHT\nPRINT 1"
},
{
"input": "6 4\nGO?GO!",
"output": "RIGHT\nRIGHT\nPRINT !\nLEFT\nPRINT O\nLEFT\nPRINT G\nLEFT\nPRINT ?\nLEFT\nPRINT O\nLEFT\nPRINT G"
},
{
"input": "7 3\nME,YOU.",
"output": "LEFT\nLEFT\nPRINT M\nRIGHT\nPRINT E\nRIGHT\nPRINT ,\nRIGHT\nPRINT Y\nRIGHT\nPRINT O\nRIGHT\nPRINT U\nRIGHT\nPRINT ."
},
{
"input": "10 1\nEK5JQMS5QN",
"output": "PRINT E\nRIGHT\nPRINT K\nRIGHT\nPRINT 5\nRIGHT\nPRINT J\nRIGHT\nPRINT Q\nRIGHT\nPRINT M\nRIGHT\nPRINT S\nRIGHT\nPRINT 5\nRIGHT\nPRINT Q\nRIGHT\nPRINT N"
},
{
"input": "85 84\n73IW80UODC8B,UR7S8WMNATV0JSRF4W0B2VV8LCAX6SGCYY8?LHDKJEO29WXQWT9.WY1VY7408S1W04GNDZPK",
"output": "RIGHT\nPRINT K\nLEFT\nPRINT P\nLEFT\nPRINT Z\nLEFT\nPRINT D\nLEFT\nPRINT N\nLEFT\nPRINT G\nLEFT\nPRINT 4\nLEFT\nPRINT 0\nLEFT\nPRINT W\nLEFT\nPRINT 1\nLEFT\nPRINT S\nLEFT\nPRINT 8\nLEFT\nPRINT 0\nLEFT\nPRINT 4\nLEFT\nPRINT 7\nLEFT\nPRINT Y\nLEFT\nPRINT V\nLEFT\nPRINT 1\nLEFT\nPRINT Y\nLEFT\nPRINT W\nLEFT\nPRINT .\nLEFT\nPRINT 9\nLEFT\nPRINT T\nLEFT\nPRINT W\nLEFT\nPRINT Q\nLEFT\nPRINT X\nLEFT\nPRINT W\nLEFT\nPRINT 9\nLEFT\nPRINT 2\nLEFT\nPRINT O\nLEFT\nPRINT E\nLEFT\nPRINT J\nLEFT\nPRINT K\nLEFT\nPRINT D\n..."
},
{
"input": "59 53\n7NWD!9PC11C8S4TQABBTJO,?CO6YGOM!W0QR94CZJBD9U1YJY23YB354,8F",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT F\nLEFT\nPRINT 8\nLEFT\nPRINT ,\nLEFT\nPRINT 4\nLEFT\nPRINT 5\nLEFT\nPRINT 3\nLEFT\nPRINT B\nLEFT\nPRINT Y\nLEFT\nPRINT 3\nLEFT\nPRINT 2\nLEFT\nPRINT Y\nLEFT\nPRINT J\nLEFT\nPRINT Y\nLEFT\nPRINT 1\nLEFT\nPRINT U\nLEFT\nPRINT 9\nLEFT\nPRINT D\nLEFT\nPRINT B\nLEFT\nPRINT J\nLEFT\nPRINT Z\nLEFT\nPRINT C\nLEFT\nPRINT 4\nLEFT\nPRINT 9\nLEFT\nPRINT R\nLEFT\nPRINT Q\nLEFT\nPRINT 0\nLEFT\nPRINT W\nLEFT\nPRINT !\nLEFT\nPRINT M\nLEFT\nPRINT O\nLEFT\nPRINT G\nLEFT\nPRIN..."
},
{
"input": "100 79\nF2.58O.L4A!QX!,.,YQUE.RZW.ENQCZKUFNG?.J6FT?L59BIHKFB?,44MAHSTD8?Z.UP3N!76YW6KVI?4AKWDPP0?3HPERM3PCUR",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT R\nLEFT\nPRINT U\nLEFT\nPRINT C\nLEFT\nPRINT P\nLEFT\nPRINT 3\nLEFT\nPRINT M\nLEFT\nPRINT R\nLEFT\nPRINT E\nLEFT\nPRINT P\nLEFT\nPRINT H\nLEFT\nPRINT 3\nLEFT\nPRINT ?\nLEFT\nPRINT 0\nLEFT\nPRINT P\nLEFT\nPRINT P\nLEFT\nPRINT D\nLEFT\nPRINT W\nLEFT\nPRINT K\nLEFT\nPRINT A\nLEFT\nPRINT 4\nLEFT\nPRINT ?\nLEFT\nPRINT I\nLEFT\nPRINT V\nLEFT\nPRINT K\nLEFT\nPRIN..."
},
{
"input": "1 1\n!",
"output": "PRINT !"
},
{
"input": "34 20\n.C0QPPSWQKGBSH0,VGM!N,5SX.M9Q,D1DT",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT T\nLEFT\nPRINT D\nLEFT\nPRINT 1\nLEFT\nPRINT D\nLEFT\nPRINT ,\nLEFT\nPRINT Q\nLEFT\nPRINT 9\nLEFT\nPRINT M\nLEFT\nPRINT .\nLEFT\nPRINT X\nLEFT\nPRINT S\nLEFT\nPRINT 5\nLEFT\nPRINT ,\nLEFT\nPRINT N\nLEFT\nPRINT !\nLEFT\nPRINT M\nLEFT\nPRINT G\nLEFT\nPRINT V\nLEFT\nPRINT ,\nLEFT\nPRINT 0\nLEFT\nPRINT H\nLEFT\nPRINT S\nLEFT\nPRINT B\nLEFT\nPRINT G\nLEFT\nPRINT K\nLEFT\nPRINT Q\nLEFT\nPRINT W\nLEFT\nPRINT S\n..."
},
{
"input": "99 98\nR8MZTEG240LNHY33H7.2CMWM73ZK,P5R,RGOA,KYKMIOG7CMPNHV3R2KM,N374IP8HN97XVMG.PSIPS8H3AXFGK0CJ76,EVKRZ9",
"output": "RIGHT\nPRINT 9\nLEFT\nPRINT Z\nLEFT\nPRINT R\nLEFT\nPRINT K\nLEFT\nPRINT V\nLEFT\nPRINT E\nLEFT\nPRINT ,\nLEFT\nPRINT 6\nLEFT\nPRINT 7\nLEFT\nPRINT J\nLEFT\nPRINT C\nLEFT\nPRINT 0\nLEFT\nPRINT K\nLEFT\nPRINT G\nLEFT\nPRINT F\nLEFT\nPRINT X\nLEFT\nPRINT A\nLEFT\nPRINT 3\nLEFT\nPRINT H\nLEFT\nPRINT 8\nLEFT\nPRINT S\nLEFT\nPRINT P\nLEFT\nPRINT I\nLEFT\nPRINT S\nLEFT\nPRINT P\nLEFT\nPRINT .\nLEFT\nPRINT G\nLEFT\nPRINT M\nLEFT\nPRINT V\nLEFT\nPRINT X\nLEFT\nPRINT 7\nLEFT\nPRINT 9\nLEFT\nPRINT N\nLEFT\nPRINT H\n..."
},
{
"input": "98 72\n.1?7CJ!EFZHO5WUKDZV,0EE92PTAGY078WKN!!41E,Q7381U60!9C,VONEZ6!SFFNDBI86MACX0?D?9!U2UV7S,977PNDSF0HY",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT Y\nLEFT\nPRINT H\nLEFT\nPRINT 0\nLEFT\nPRINT F\nLEFT\nPRINT S\nLEFT\nPRINT D\nLEFT\nPRINT N\nLEFT\nPRINT P\nLEFT\nPRINT 7\nLEFT\nPRINT 7\nLEFT\nPRINT 9\nLEFT\nPRINT ,\nLEFT\nPRINT S\nLEFT\nPRINT 7\nLEFT\nPRINT V\nLEFT\nPRINT U\nLEFT\nPRINT 2\nLEFT\nPRINT U\nLEFT\nPRINT !\nLEFT\nPRINT 9\nLEFT\nPRINT ?\nLEFT\nPRINT D\nLEFT\n..."
},
{
"input": "97 41\nGQSPZGGRZ0KWUMI79GOXP7!RR9E?Z5YO?6WUL!I7GCXRS8T,PEFQM7CZOUG8HLC7198J1?C69JD00Q!QY1AK!27I?WB?UAUIG",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT G\nRIGHT\nPRINT Q\nRIGHT\nPRINT S\nRIGHT\nPRINT P\nRIGHT\nPRINT Z\nRIGHT\nPRINT G\nRIGHT\nPRINT G\nRIGHT\nPRINT R\nRIGHT\nPRINT Z\nRIGHT\nPRINT 0\nRIGHT\nPRINT K\nRIGHT\nPRINT W\nRIGHT\nPRINT U\nRIGHT\nPRINT M\nRIGHT\nPRINT I\nRIGHT\nPRINT 7\nRIGHT\nPRINT 9\nRIGHT\n..."
},
{
"input": "96 28\nZCF!PLS27YGXHK8P46H,C.A7MW90ED,4BA!T0!XKIR2GE0HD..YZ0O20O8TA7E35G5YT3L4W5ESSYBHG8.TIQENS4I.R8WE,",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT Z\nRIGHT\nPRINT C\nRIGHT\nPRINT F\nRIGHT\nPRINT !\nRIGHT\nPRINT P\nRIGHT\nPRINT L\nRIGHT\nPRINT S\nRIGHT\nPRINT 2\nRIGHT\nPRINT 7\nRIGHT\nPRINT Y\nRIGHT\nPRINT G\nRIGHT\nPRINT X\nRIGHT\nPRINT H\nRIGHT\nPRINT K\nRIGHT\nPRINT 8\nRIGHT\nPRINT P\nRIGHT\nPRINT 4\nRIGHT\nPRINT 6\nRIGHT\nPRINT H\nRIGHT\nPRINT ,\nRIGHT\nPRINT C\nRIGHT\nPRINT .\nRIGH..."
},
{
"input": "15 3\n!..!?!,!,..,?!.",
"output": "LEFT\nLEFT\nPRINT !\nRIGHT\nPRINT .\nRIGHT\nPRINT .\nRIGHT\nPRINT !\nRIGHT\nPRINT ?\nRIGHT\nPRINT !\nRIGHT\nPRINT ,\nRIGHT\nPRINT !\nRIGHT\nPRINT ,\nRIGHT\nPRINT .\nRIGHT\nPRINT .\nRIGHT\nPRINT ,\nRIGHT\nPRINT ?\nRIGHT\nPRINT !\nRIGHT\nPRINT ."
},
{
"input": "93 81\nGMIBVKYLURQLWHBGTFNJZZAZNUJJTPQKCPGDMGCDTTGXOANWKTDZSIYBUPFUXGQHCMVIEQCTINRTIUSPGMVZPGWBHPIXC",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT C\nLEFT\nPRINT X\nLEFT\nPRINT I\nLEFT\nPRINT P\nLEFT\nPRINT H\nLEFT\nPRINT B\nLEFT\nPRINT W\nLEFT\nPRINT G\nLEFT\nPRINT P\nLEFT\nPRINT Z\nLEFT\nPRINT V\nLEFT\nPRINT M\nLEFT\nPRINT G\nLEFT\nPRINT P\nLEFT\nPRINT S\nLEFT\nPRINT U\nLEFT\nPRINT I\nLEFT\nPRINT T\nLEFT\nPRINT R\nLEFT\nPRINT N\nLEFT\nPRINT I\nLEFT\nPRINT T\nLEFT\nPRINT C\nLEFT\nPRINT Q\nLEFT\nPRINT E\nLEFT\nPRINT I\nLEFT\nPRINT V\nLEFT\nPRINT M\nLEFT\nPRINT C..."
},
{
"input": "88 30\n5847857685475132927321580125243001071762130696139249809763381765504146602574972381323476",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT 5\nRIGHT\nPRINT 8\nRIGHT\nPRINT 4\nRIGHT\nPRINT 7\nRIGHT\nPRINT 8\nRIGHT\nPRINT 5\nRIGHT\nPRINT 7\nRIGHT\nPRINT 6\nRIGHT\nPRINT 8\nRIGHT\nPRINT 5\nRIGHT\nPRINT 4\nRIGHT\nPRINT 7\nRIGHT\nPRINT 5\nRIGHT\nPRINT 1\nRIGHT\nPRINT 3\nRIGHT\nPRINT 2\nRIGHT\nPRINT 9\nRIGHT\nPRINT 2\nRIGHT\nPRINT 7\nRIGHT\nPRINT 3\nRIGHT\nPRINT 2\nRIGHT\nP..."
},
{
"input": "100 50\n5B2N,CXCWOIWH71XV!HCFEUCN3U88JDRIFRO2VHY?!N.RGH.?W14X5S.Y00RIY6YA19BPD0T,WECXYI,O2RF1U4NX9,F5AVLPOYK",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT 5\nRIGHT\nPRINT B\nRIGHT\nPRINT 2\nRIGHT\nPRINT N\nRIGHT\nPRINT ,\nRIGHT\nPRINT C\nRIGHT\nPRINT X\nRIGHT\nPRINT C\nRIGHT\nPRINT W\nRIGHT\nPRINT O\nRIGHT\nPRINT I\nRIGHT\nPRINT W\nRIGHT\nPRINT H\nRIGHT\nPRINT 7\n..."
},
{
"input": "100 51\n!X85PT!WJDNS9KA6D2SJBR,U,G7M914W07EK3EAJ4XG..UHA3KOOFYJ?M0MEFDC6KNCNGKS0A!S,C02H4TSZA1U7NDBTIY?,7XZ4",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT 4\nLEFT\nPRINT Z\nLEFT\nPRINT X\nLEFT\nPRINT 7\nLEFT\nPRINT ,\nLEFT\nPRINT ?\nLEFT\nPRINT Y\nLEFT\nPRINT I\nLEFT\nPRINT T\nLEFT\nPRINT B\nLEFT\nPRINT D\nLEFT\nPRI..."
},
{
"input": "100 52\n!MLPE.0K72RW9XKHR60QE?69ILFSIKYSK5AG!TA5.02VG5OMY0967G2RI.62CNK9L8G!7IG9F0XNNCGSDOTFD?I,EBP31HRERZSX",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT X\nLEFT\nPRINT S\nLEFT\nPRINT Z\nLEFT\nPRINT R\nLEFT\nPRINT E\nLEFT\nPRINT R\nLEFT\nPRINT H\nLEFT\nPRINT 1\nLEFT\nPRINT 3\nLEFT\nPRINT P\nLEFT\nPRINT B\nLEFT\nPRINT E\nL..."
},
{
"input": "100 49\n86C0NR7V,BE09,7,ER715OQ3GZ,P014H4BSQ5YS?OFNDD7YWI?S?UMKIWHSBDZ4398?SSDZLTDU1L?G4QVAB53HNDS!4PYW5C!VI",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT 8\nRIGHT\nPRINT 6\nRIGHT\nPRINT C\nRIGHT\nPRINT 0\nRIGHT\nPRINT N\nRIGHT\nPRINT R\nRIGHT\nPRINT 7\nRIGHT\nPRINT V\nRIGHT\nPRINT ,\nRIGHT\nPRINT B\nRIGHT\nPRINT E\nRIGHT\nPRINT 0\nRIGHT\nPRINT 9\nRIGHT\nPRINT ,\nRIGHT\n..."
},
{
"input": "100 48\nFO,IYI4AAV?4?N5PWMZX1AINZLKAUJCKMDWU4CROT?.LYWYLYU5S80,15A6VGP!V0N,O.70CP?GEA52WG59UYWU1MMMU4BERVY.!",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT F\nRIGHT\nPRINT O\nRIGHT\nPRINT ,\nRIGHT\nPRINT I\nRIGHT\nPRINT Y\nRIGHT\nPRINT I\nRIGHT\nPRINT 4\nRIGHT\nPRINT A\nRIGHT\nPRINT A\nRIGHT\nPRINT V\nRIGHT\nPRINT ?\nRIGHT\nPRINT 4\nRIGHT\nPRINT ?\nRIGHT\nPRINT N\nRIGHT\nPRINT..."
},
{
"input": "100 100\nE?F,W.,,O51!!G13ZWP?YHWRT69?RQPW7,V,EM3336F1YAIKJIME1M45?LJM42?45V7221?P.DIO9FK245LXKMR4ALKPDLA5YI2Y",
"output": "PRINT Y\nLEFT\nPRINT 2\nLEFT\nPRINT I\nLEFT\nPRINT Y\nLEFT\nPRINT 5\nLEFT\nPRINT A\nLEFT\nPRINT L\nLEFT\nPRINT D\nLEFT\nPRINT P\nLEFT\nPRINT K\nLEFT\nPRINT L\nLEFT\nPRINT A\nLEFT\nPRINT 4\nLEFT\nPRINT R\nLEFT\nPRINT M\nLEFT\nPRINT K\nLEFT\nPRINT X\nLEFT\nPRINT L\nLEFT\nPRINT 5\nLEFT\nPRINT 4\nLEFT\nPRINT 2\nLEFT\nPRINT K\nLEFT\nPRINT F\nLEFT\nPRINT 9\nLEFT\nPRINT O\nLEFT\nPRINT I\nLEFT\nPRINT D\nLEFT\nPRINT .\nLEFT\nPRINT P\nLEFT\nPRINT ?\nLEFT\nPRINT 1\nLEFT\nPRINT 2\nLEFT\nPRINT 2\nLEFT\nPRINT 7\nLEFT\nP..."
},
{
"input": "100 1\nJJ0ZOX4CY,SQ9L0K!2C9TM3C6K.6R21717I37VDSXGHBMR2!J820AI75D.O7NYMT6F.AGJ8R0RDETWOACK3P6UZAUYRKMKJ!G3WF",
"output": "PRINT J\nRIGHT\nPRINT J\nRIGHT\nPRINT 0\nRIGHT\nPRINT Z\nRIGHT\nPRINT O\nRIGHT\nPRINT X\nRIGHT\nPRINT 4\nRIGHT\nPRINT C\nRIGHT\nPRINT Y\nRIGHT\nPRINT ,\nRIGHT\nPRINT S\nRIGHT\nPRINT Q\nRIGHT\nPRINT 9\nRIGHT\nPRINT L\nRIGHT\nPRINT 0\nRIGHT\nPRINT K\nRIGHT\nPRINT !\nRIGHT\nPRINT 2\nRIGHT\nPRINT C\nRIGHT\nPRINT 9\nRIGHT\nPRINT T\nRIGHT\nPRINT M\nRIGHT\nPRINT 3\nRIGHT\nPRINT C\nRIGHT\nPRINT 6\nRIGHT\nPRINT K\nRIGHT\nPRINT .\nRIGHT\nPRINT 6\nRIGHT\nPRINT R\nRIGHT\nPRINT 2\nRIGHT\nPRINT 1\nRIGHT\nPRINT 7\nRIGHT\n..."
},
{
"input": "99 50\nLQJ!7GDFJ,SKQ8J2R?I4VA0K2.NDY.AZ?7K275NA81.YK!DO,PCQCJYL6BUU30XQ300FP0,LB!5TYTRSGOB4ELZ8IBKGVDNW8?B",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT B\nLEFT\nPRINT ?\nLEFT\nPRINT 8\nLEFT\nPRINT W\nLEFT\nPRINT N\nLEFT\nPRINT D\nLEFT\nPRINT V\nLEFT\nPRINT G\nLEFT\nPRINT K\nLEFT\nPRINT B\nLEFT\nPRINT I\nLEFT\nPRI..."
},
{
"input": "99 51\nD9QHZXG46IWHHLTD2E,AZO0.M40R4B1WU6F,0QNZ37NQ0ACSU6!7Z?H02AD?0?9,5N5RG6PVOWIE6YA9QBCOHVNU??YT6,29SAC",
"output": "RIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nRIGHT\nPRINT C\nLEFT\nPRINT A\nLEFT\nPRINT S\nLEFT\nPRINT 9\nLEFT\nPRINT 2\nLEFT\nPRINT ,\nLEFT\nPRINT 6\nLEFT\nPRINT T\nLEFT\nPRINT Y\nLEFT\nPRINT ?\nLEFT\nPRINT ?\nLEFT\nPRINT U\nL..."
},
{
"input": "99 49\nOLUBX0Q3VPNSH,QCAWFVSKZA3NUURJ9PXBS3?72PMJ,27QTA7Z1N?6Q2CSJE,W0YX8XWS.W6B?K?M!PYAD30BX?8.VJCC,P8QL9",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT O\nRIGHT\nPRINT L\nRIGHT\nPRINT U\nRIGHT\nPRINT B\nRIGHT\nPRINT X\nRIGHT\nPRINT 0\nRIGHT\nPRINT Q\nRIGHT\nPRINT 3\nRIGHT\nPRINT V\nRIGHT\nPRINT P\nRIGHT\nPRINT N\nRIGHT\nPRINT S\nRIGHT\nPRINT H\nRIGHT\nPRINT ,\nRIGHT\n..."
},
{
"input": "99 48\nW0GU5MNE5!JVIOO2SR5OO7RWLHDFH.HLCCX89O21SLD9!CU0MFG3RFZUFT!R0LWNVNSS.W54.67N4VAN1Q2J9NMO9Q6.UE8U6B8",
"output": "LEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nLEFT\nPRINT W\nRIGHT\nPRINT 0\nRIGHT\nPRINT G\nRIGHT\nPRINT U\nRIGHT\nPRINT 5\nRIGHT\nPRINT M\nRIGHT\nPRINT N\nRIGHT\nPRINT E\nRIGHT\nPRINT 5\nRIGHT\nPRINT !\nRIGHT\nPRINT J\nRIGHT\nPRINT V\nRIGHT\nPRINT I\nRIGHT\nPRINT O\nRIGHT\nPRINT..."
},
{
"input": "2 1\nOA",
"output": "PRINT O\nRIGHT\nPRINT A"
},
{
"input": "2 2\nGW",
"output": "PRINT W\nLEFT\nPRINT G"
},
{
"input": "3 1\n.VP",
"output": "PRINT .\nRIGHT\nPRINT V\nRIGHT\nPRINT P"
},
{
"input": "3 2\nUD0",
"output": "RIGHT\nPRINT 0\nLEFT\nPRINT D\nLEFT\nPRINT U"
},
{
"input": "3 3\nMYE",
"output": "PRINT E\nLEFT\nPRINT Y\nLEFT\nPRINT M"
},
{
"input": "4 1\nC5EJ",
"output": "PRINT C\nRIGHT\nPRINT 5\nRIGHT\nPRINT E\nRIGHT\nPRINT J"
},
{
"input": "4 2\n5QSW",
"output": "LEFT\nPRINT 5\nRIGHT\nPRINT Q\nRIGHT\nPRINT S\nRIGHT\nPRINT W"
},
{
"input": "4 3\n!F3D",
"output": "RIGHT\nPRINT D\nLEFT\nPRINT 3\nLEFT\nPRINT F\nLEFT\nPRINT !"
},
{
"input": "4 4\nS!?Y",
"output": "PRINT Y\nLEFT\nPRINT ?\nLEFT\nPRINT !\nLEFT\nPRINT S"
},
{
"input": "5 1\nIP4!N",
"output": "PRINT I\nRIGHT\nPRINT P\nRIGHT\nPRINT 4\nRIGHT\nPRINT !\nRIGHT\nPRINT N"
},
{
"input": "5 2\nI7??5",
"output": "LEFT\nPRINT I\nRIGHT\nPRINT 7\nRIGHT\nPRINT ?\nRIGHT\nPRINT ?\nRIGHT\nPRINT 5"
},
{
"input": "5 3\nASNUW",
"output": "RIGHT\nRIGHT\nPRINT W\nLEFT\nPRINT U\nLEFT\nPRINT N\nLEFT\nPRINT S\nLEFT\nPRINT A"
},
{
"input": "5 4\n3?,4L",
"output": "RIGHT\nPRINT L\nLEFT\nPRINT 4\nLEFT\nPRINT ,\nLEFT\nPRINT ?\nLEFT\nPRINT 3"
},
{
"input": "5 5\n30COA",
"output": "PRINT A\nLEFT\nPRINT O\nLEFT\nPRINT C\nLEFT\nPRINT 0\nLEFT\nPRINT 3"
},
{
"input": "4 2\nABCD",
"output": "LEFT\nPRINT A\nRIGHT\nPRINT B\nRIGHT\nPRINT C\nRIGHT\nPRINT D"
}
] | 1,594,698,368
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 43
| 155
| 20,172,800
|
l1 = [int(x) for x in input().split()]
n,k = l1[0],l1[1]
# 1 2 3 4 5 6 7 8
#
l2 = list(input())
if k > (n+1)/2:
i=k-1
while i<n-1:
print("RIGHT")
i+=1
l2.reverse()
i=0
while i<n:
print("PRINT",l2[i])
if i!=n-1:print("LEFT")
i+=1
else:
i = k-1
while i>0:
print("LEFT")
i-=1
i=0
while i<n:
print("PRINT",l2[i])
if i!=n-1:print("RIGHT")
i+=1
|
Title: Poster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The R1 company has recently bought a high rise building in the centre of Moscow for its main office. It's time to decorate the new office, and the first thing to do is to write the company's slogan above the main entrance to the building.
The slogan of the company consists of *n* characters, so the decorators hung a large banner, *n* meters wide and 1 meter high, divided into *n* equal squares. The first character of the slogan must be in the first square (the leftmost) of the poster, the second character must be in the second square, and so on.
Of course, the R1 programmers want to write the slogan on the poster themselves. To do this, they have a large (and a very heavy) ladder which was put exactly opposite the *k*-th square of the poster. To draw the *i*-th character of the slogan on the poster, you need to climb the ladder, standing in front of the *i*-th square of the poster. This action (along with climbing up and down the ladder) takes one hour for a painter. The painter is not allowed to draw characters in the adjacent squares when the ladder is in front of the *i*-th square because the uncomfortable position of the ladder may make the characters untidy. Besides, the programmers can move the ladder. In one hour, they can move the ladder either a meter to the right or a meter to the left.
Drawing characters and moving the ladder is very tiring, so the programmers want to finish the job in as little time as possible. Develop for them an optimal poster painting plan!
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of characters in the slogan and the initial position of the ladder, correspondingly. The next line contains the slogan as *n* characters written without spaces. Each character of the slogan is either a large English letter, or digit, or one of the characters: '.', '!', ',', '?'.
Output Specification:
In *t* lines, print the actions the programmers need to make. In the *i*-th line print:
- "LEFT" (without the quotes), if the *i*-th action was "move the ladder to the left"; - "RIGHT" (without the quotes), if the *i*-th action was "move the ladder to the right"; - "PRINT *x*" (without the quotes), if the *i*-th action was to "go up the ladder, paint character *x*, go down the ladder".
The painting time (variable *t*) must be minimum possible. If there are multiple optimal painting plans, you can print any of them.
Demo Input:
['2 2\nR1\n', '2 1\nR1\n', '6 4\nGO?GO!\n']
Demo Output:
['PRINT 1\nLEFT\nPRINT R\n', 'PRINT R\nRIGHT\nPRINT 1\n', 'RIGHT\nRIGHT\nPRINT !\nLEFT\nPRINT O\nLEFT\nPRINT G\nLEFT\nPRINT ?\nLEFT\nPRINT O\nLEFT\nPRINT G\n']
Note:
Note that the ladder cannot be shifted by less than one meter. The ladder can only stand in front of some square of the poster. For example, you cannot shift a ladder by half a meter and position it between two squares. Then go up and paint the first character and the second character.
|
```python
l1 = [int(x) for x in input().split()]
n,k = l1[0],l1[1]
# 1 2 3 4 5 6 7 8
#
l2 = list(input())
if k > (n+1)/2:
i=k-1
while i<n-1:
print("RIGHT")
i+=1
l2.reverse()
i=0
while i<n:
print("PRINT",l2[i])
if i!=n-1:print("LEFT")
i+=1
else:
i = k-1
while i>0:
print("LEFT")
i-=1
i=0
while i<n:
print("PRINT",l2[i])
if i!=n-1:print("RIGHT")
i+=1
```
| 3
|
|
893
|
B
|
Beautiful Divisors
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes.
Some examples of beautiful numbers:
- 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610).
More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1).
Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it!
|
The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got.
|
Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists.
|
[
"3\n",
"992\n"
] |
[
"1\n",
"496\n"
] |
none
| 0
|
[
{
"input": "3",
"output": "1"
},
{
"input": "992",
"output": "496"
},
{
"input": "81142",
"output": "1"
},
{
"input": "76920",
"output": "120"
},
{
"input": "2016",
"output": "2016"
},
{
"input": "1",
"output": "1"
},
{
"input": "6",
"output": "6"
},
{
"input": "32640",
"output": "32640"
},
{
"input": "12096",
"output": "2016"
},
{
"input": "55948",
"output": "1"
},
{
"input": "47262",
"output": "6"
},
{
"input": "22876",
"output": "28"
},
{
"input": "96120",
"output": "120"
},
{
"input": "42160",
"output": "496"
},
{
"input": "38304",
"output": "2016"
},
{
"input": "89408",
"output": "8128"
},
{
"input": "97920",
"output": "32640"
},
{
"input": "55493",
"output": "1"
},
{
"input": "38021",
"output": "1"
},
{
"input": "21445",
"output": "1"
},
{
"input": "100000",
"output": "1"
},
{
"input": "497",
"output": "1"
},
{
"input": "240",
"output": "120"
},
{
"input": "21204",
"output": "6"
},
{
"input": "65536",
"output": "1"
},
{
"input": "364",
"output": "28"
},
{
"input": "1024",
"output": "1"
},
{
"input": "36",
"output": "6"
},
{
"input": "28",
"output": "28"
},
{
"input": "14400",
"output": "120"
},
{
"input": "10080",
"output": "2016"
},
{
"input": "9",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "42",
"output": "6"
},
{
"input": "83160",
"output": "120"
},
{
"input": "65534",
"output": "1"
},
{
"input": "1026",
"output": "6"
},
{
"input": "1025",
"output": "1"
},
{
"input": "1027",
"output": "1"
},
{
"input": "2018",
"output": "1"
},
{
"input": "2020",
"output": "1"
},
{
"input": "123",
"output": "1"
},
{
"input": "150",
"output": "6"
},
{
"input": "5",
"output": "1"
},
{
"input": "66",
"output": "6"
},
{
"input": "12768",
"output": "28"
},
{
"input": "156",
"output": "6"
},
{
"input": "99990",
"output": "6"
},
{
"input": "248",
"output": "1"
}
] | 1,603,867,310
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 49
| 140
| 0
|
import sys, bisect
n = int(sys.stdin.readline())
ans = 0
for i in range(10):
temp = '1' * (i + 1) + '0' * i
if n % (int(temp, base=2)) == 0:
ans = int(temp, base=2)
print(ans)
|
Title: Beautiful Divisors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes.
Some examples of beautiful numbers:
- 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610).
More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1).
Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it!
Input Specification:
The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got.
Output Specification:
Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists.
Demo Input:
['3\n', '992\n']
Demo Output:
['1\n', '496\n']
Note:
none
|
```python
import sys, bisect
n = int(sys.stdin.readline())
ans = 0
for i in range(10):
temp = '1' * (i + 1) + '0' * i
if n % (int(temp, base=2)) == 0:
ans = int(temp, base=2)
print(ans)
```
| 3
|
|
988
|
B
|
Substrings Sort
|
PROGRAMMING
| 1,100
|
[
"sortings",
"strings"
] | null | null |
You are given $n$ strings. Each string consists of lowercase English letters. Rearrange (reorder) the given strings in such a way that for every string, all strings that are placed before it are its substrings.
String $a$ is a substring of string $b$ if it is possible to choose several consecutive letters in $b$ in such a way that they form $a$. For example, string "for" is contained as a substring in strings "codeforces", "for" and "therefore", but is not contained as a substring in strings "four", "fofo" and "rof".
|
The first line contains an integer $n$ ($1 \le n \le 100$) — the number of strings.
The next $n$ lines contain the given strings. The number of letters in each string is from $1$ to $100$, inclusive. Each string consists of lowercase English letters.
Some strings might be equal.
|
If it is impossible to reorder $n$ given strings in required order, print "NO" (without quotes).
Otherwise print "YES" (without quotes) and $n$ given strings in required order.
|
[
"5\na\naba\nabacaba\nba\naba\n",
"5\na\nabacaba\nba\naba\nabab\n",
"3\nqwerty\nqwerty\nqwerty\n"
] |
[
"YES\na\nba\naba\naba\nabacaba\n",
"NO\n",
"YES\nqwerty\nqwerty\nqwerty\n"
] |
In the second example you cannot reorder the strings because the string "abab" is not a substring of the string "abacaba".
| 0
|
[
{
"input": "5\na\naba\nabacaba\nba\naba",
"output": "YES\na\nba\naba\naba\nabacaba"
},
{
"input": "5\na\nabacaba\nba\naba\nabab",
"output": "NO"
},
{
"input": "3\nqwerty\nqwerty\nqwerty",
"output": "YES\nqwerty\nqwerty\nqwerty"
},
{
"input": "1\nwronganswer",
"output": "YES\nwronganswer"
},
{
"input": "3\na\nb\nab",
"output": "NO"
},
{
"input": "2\nababaab\nabaab",
"output": "YES\nabaab\nababaab"
},
{
"input": "2\nq\nqq",
"output": "YES\nq\nqq"
},
{
"input": "5\nabab\nbab\nba\nab\na",
"output": "NO"
},
{
"input": "3\nb\nc\nd",
"output": "NO"
},
{
"input": "3\naba\nbab\nababa",
"output": "NO"
},
{
"input": "4\na\nba\nabacabac\nb",
"output": "NO"
},
{
"input": "4\nab\nba\nabab\na",
"output": "NO"
},
{
"input": "3\naaa\naab\naaab",
"output": "NO"
},
{
"input": "2\nac\nabac",
"output": "YES\nac\nabac"
},
{
"input": "2\na\nb",
"output": "NO"
},
{
"input": "3\nbaa\nbaaaaaaaab\naaaaaa",
"output": "NO"
},
{
"input": "3\naaab\naab\naaaab",
"output": "YES\naab\naaab\naaaab"
},
{
"input": "2\naaba\naba",
"output": "YES\naba\naaba"
},
{
"input": "10\na\nb\nc\nd\nab\nbc\ncd\nabc\nbcd\nabcd",
"output": "NO"
},
{
"input": "5\na\nab\nae\nabcd\nabcde",
"output": "NO"
},
{
"input": "3\nv\nab\nvab",
"output": "NO"
},
{
"input": "4\na\nb\nc\nabc",
"output": "NO"
},
{
"input": "2\nab\naab",
"output": "YES\nab\naab"
},
{
"input": "3\nabc\na\nc",
"output": "NO"
},
{
"input": "2\nabaab\nababaab",
"output": "YES\nabaab\nababaab"
},
{
"input": "3\ny\nxx\nxxy",
"output": "NO"
},
{
"input": "4\naaaa\naaaa\naaaa\nab",
"output": "NO"
},
{
"input": "3\nbad\naba\nabad",
"output": "NO"
},
{
"input": "3\nabcabc\nab\nbc",
"output": "NO"
},
{
"input": "2\naaaab\naaaaab",
"output": "YES\naaaab\naaaaab"
},
{
"input": "5\nab\naba\naba\naba\nabd",
"output": "NO"
},
{
"input": "4\nded\nd\ne\nd",
"output": "NO"
},
{
"input": "5\nekgetterherforme\ner\nter\nher\ntter",
"output": "NO"
},
{
"input": "3\naa\nbba\ncbba",
"output": "NO"
},
{
"input": "3\nab\naa\naab",
"output": "NO"
},
{
"input": "6\naaaa\naaaa\naaaa\naaaaab\nab\nab",
"output": "NO"
},
{
"input": "3\na\nbcd\nabcd",
"output": "NO"
},
{
"input": "3\naa\nab\naab",
"output": "NO"
},
{
"input": "3\nabcde\nab\ncde",
"output": "NO"
},
{
"input": "4\nanoop\np\nan\noop",
"output": "NO"
},
{
"input": "3\nab\ncd\nabcd",
"output": "NO"
},
{
"input": "3\nafaba\nafab\nfaba",
"output": "NO"
},
{
"input": "3\nababc\nabababc\nab",
"output": "YES\nab\nababc\nabababc"
},
{
"input": "3\na\nba\nbbab",
"output": "YES\na\nba\nbbab"
},
{
"input": "2\naabaa\naba",
"output": "YES\naba\naabaa"
},
{
"input": "3\nbc\nbca\na",
"output": "NO"
},
{
"input": "2\naba\nabba",
"output": "NO"
},
{
"input": "7\na\nb\nc\nab\nac\nac\nac",
"output": "NO"
},
{
"input": "2\naa\nmmmmmmmammmmmmmm",
"output": "NO"
}
] | 1,630,248,693
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 56
| 108
| 20,172,800
|
s = sorted((input() for i in range(int(input()))),key = len)
if all(x in y for x,y in zip(s,s[1:])):
print("YES")
print(*s,sep = ' ')
else:
print("NO")
|
Title: Substrings Sort
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given $n$ strings. Each string consists of lowercase English letters. Rearrange (reorder) the given strings in such a way that for every string, all strings that are placed before it are its substrings.
String $a$ is a substring of string $b$ if it is possible to choose several consecutive letters in $b$ in such a way that they form $a$. For example, string "for" is contained as a substring in strings "codeforces", "for" and "therefore", but is not contained as a substring in strings "four", "fofo" and "rof".
Input Specification:
The first line contains an integer $n$ ($1 \le n \le 100$) — the number of strings.
The next $n$ lines contain the given strings. The number of letters in each string is from $1$ to $100$, inclusive. Each string consists of lowercase English letters.
Some strings might be equal.
Output Specification:
If it is impossible to reorder $n$ given strings in required order, print "NO" (without quotes).
Otherwise print "YES" (without quotes) and $n$ given strings in required order.
Demo Input:
['5\na\naba\nabacaba\nba\naba\n', '5\na\nabacaba\nba\naba\nabab\n', '3\nqwerty\nqwerty\nqwerty\n']
Demo Output:
['YES\na\nba\naba\naba\nabacaba\n', 'NO\n', 'YES\nqwerty\nqwerty\nqwerty\n']
Note:
In the second example you cannot reorder the strings because the string "abab" is not a substring of the string "abacaba".
|
```python
s = sorted((input() for i in range(int(input()))),key = len)
if all(x in y for x,y in zip(s,s[1:])):
print("YES")
print(*s,sep = ' ')
else:
print("NO")
```
| 3
|
|
115
|
A
|
Party
|
PROGRAMMING
| 900
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
A company has *n* employees numbered from 1 to *n*. Each employee either has no immediate manager or exactly one immediate manager, who is another employee with a different number. An employee *A* is said to be the superior of another employee *B* if at least one of the following is true:
- Employee *A* is the immediate manager of employee *B* - Employee *B* has an immediate manager employee *C* such that employee *A* is the superior of employee *C*.
The company will not have a managerial cycle. That is, there will not exist an employee who is the superior of his/her own immediate manager.
Today the company is going to arrange a party. This involves dividing all *n* employees into several groups: every employee must belong to exactly one group. Furthermore, within any single group, there must not be two employees *A* and *B* such that *A* is the superior of *B*.
What is the minimum number of groups that must be formed?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of employees.
The next *n* lines contain the integers *p**i* (1<=≤<=*p**i*<=≤<=*n* or *p**i*<==<=-1). Every *p**i* denotes the immediate manager for the *i*-th employee. If *p**i* is -1, that means that the *i*-th employee does not have an immediate manager.
It is guaranteed, that no employee will be the immediate manager of him/herself (*p**i*<=≠<=*i*). Also, there will be no managerial cycles.
|
Print a single integer denoting the minimum number of groups that will be formed in the party.
|
[
"5\n-1\n1\n2\n1\n-1\n"
] |
[
"3\n"
] |
For the first example, three groups are sufficient, for example:
- Employee 1 - Employees 2 and 4 - Employees 3 and 5
| 500
|
[
{
"input": "5\n-1\n1\n2\n1\n-1",
"output": "3"
},
{
"input": "4\n-1\n1\n2\n3",
"output": "4"
},
{
"input": "12\n-1\n1\n2\n3\n-1\n5\n6\n7\n-1\n9\n10\n11",
"output": "4"
},
{
"input": "6\n-1\n-1\n2\n3\n1\n1",
"output": "3"
},
{
"input": "3\n-1\n1\n1",
"output": "2"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n2\n-1",
"output": "2"
},
{
"input": "2\n-1\n-1",
"output": "1"
},
{
"input": "3\n2\n-1\n1",
"output": "3"
},
{
"input": "3\n-1\n-1\n-1",
"output": "1"
},
{
"input": "5\n4\n5\n1\n-1\n4",
"output": "3"
},
{
"input": "12\n-1\n1\n1\n1\n1\n1\n3\n4\n3\n3\n4\n7",
"output": "4"
},
{
"input": "12\n-1\n-1\n1\n-1\n1\n1\n5\n11\n8\n6\n6\n4",
"output": "5"
},
{
"input": "12\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n2\n-1\n-1\n-1",
"output": "2"
},
{
"input": "12\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1",
"output": "1"
},
{
"input": "12\n3\n4\n2\n8\n7\n1\n10\n12\n5\n-1\n9\n11",
"output": "12"
},
{
"input": "12\n5\n6\n7\n1\n-1\n9\n12\n4\n8\n-1\n3\n2",
"output": "11"
},
{
"input": "12\n-1\n9\n11\n6\n6\n-1\n6\n3\n8\n6\n1\n6",
"output": "6"
},
{
"input": "12\n7\n8\n4\n12\n7\n9\n-1\n-1\n-1\n8\n6\n-1",
"output": "3"
},
{
"input": "12\n-1\n10\n-1\n1\n-1\n5\n9\n12\n-1\n-1\n3\n-1",
"output": "2"
},
{
"input": "12\n-1\n7\n9\n12\n1\n7\n-1\n-1\n8\n5\n4\n-1",
"output": "3"
},
{
"input": "12\n11\n11\n8\n9\n1\n1\n2\n-1\n10\n3\n-1\n8",
"output": "5"
},
{
"input": "12\n-1\n8\n9\n-1\n4\n2\n11\n1\n-1\n6\n-1\n10",
"output": "6"
},
{
"input": "12\n7\n4\n4\n-1\n6\n7\n9\n7\n-1\n7\n4\n1",
"output": "4"
},
{
"input": "12\n-1\n6\n10\n6\n1\n11\n5\n9\n11\n5\n1\n9",
"output": "4"
},
{
"input": "12\n8\n6\n6\n8\n6\n-1\n6\n6\n8\n6\n8\n8",
"output": "3"
},
{
"input": "12\n3\n8\n9\n12\n2\n8\n11\n12\n2\n9\n-1\n11",
"output": "7"
},
{
"input": "7\n7\n6\n-1\n-1\n4\n4\n-1",
"output": "3"
},
{
"input": "77\n53\n-1\n48\n-1\n51\n-1\n54\n43\n70\n19\n64\n31\n45\n58\n6\n61\n41\n56\n34\n-1\n54\n-1\n66\n65\n74\n16\n38\n1\n2\n61\n-1\n34\n-1\n-1\n7\n19\n57\n13\n61\n42\n-1\n34\n65\n16\n31\n61\n6\n5\n34\n15\n-1\n13\n4\n22\n74\n7\n-1\n70\n38\n61\n45\n53\n46\n22\n-1\n65\n34\n19\n43\n48\n33\n58\n36\n-1\n47\n24\n34",
"output": "6"
},
{
"input": "5\n2\n3\n4\n5\n-1",
"output": "5"
}
] | 1,670,280,632
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
using namespace std;
int dfs(int a, int vis[],vector<int> edge[],int depth){
vis[a]=1;
int x=depth;
for (auto s:edge[a]){
if(vis[s]==0) depth =max(depth,dfs(s,vis,edge,x+1));
}
return depth;
}
int main(){
int n,m,cnt=0;
cin>>n;
vector<int> edge[n+1];
int vis[n+1];
for (int i=0;i<n+1;i++){
vis[i]=0;
}
for (int i=1;i<n+1;i++){
cin>>m;
if (m==-1) m=0;
edge[m].push_back(i);
edge[i].push_back(m);
}
int depth=0;
for (int j=0;j<n+1;j++){
if (vis[j]==0) depth=max(depth ,dfs(j,vis,edge,0));
}
cout<<depth;
}
|
Title: Party
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A company has *n* employees numbered from 1 to *n*. Each employee either has no immediate manager or exactly one immediate manager, who is another employee with a different number. An employee *A* is said to be the superior of another employee *B* if at least one of the following is true:
- Employee *A* is the immediate manager of employee *B* - Employee *B* has an immediate manager employee *C* such that employee *A* is the superior of employee *C*.
The company will not have a managerial cycle. That is, there will not exist an employee who is the superior of his/her own immediate manager.
Today the company is going to arrange a party. This involves dividing all *n* employees into several groups: every employee must belong to exactly one group. Furthermore, within any single group, there must not be two employees *A* and *B* such that *A* is the superior of *B*.
What is the minimum number of groups that must be formed?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of employees.
The next *n* lines contain the integers *p**i* (1<=≤<=*p**i*<=≤<=*n* or *p**i*<==<=-1). Every *p**i* denotes the immediate manager for the *i*-th employee. If *p**i* is -1, that means that the *i*-th employee does not have an immediate manager.
It is guaranteed, that no employee will be the immediate manager of him/herself (*p**i*<=≠<=*i*). Also, there will be no managerial cycles.
Output Specification:
Print a single integer denoting the minimum number of groups that will be formed in the party.
Demo Input:
['5\n-1\n1\n2\n1\n-1\n']
Demo Output:
['3\n']
Note:
For the first example, three groups are sufficient, for example:
- Employee 1 - Employees 2 and 4 - Employees 3 and 5
|
```python
#include <bits/stdc++.h>
using namespace std;
int dfs(int a, int vis[],vector<int> edge[],int depth){
vis[a]=1;
int x=depth;
for (auto s:edge[a]){
if(vis[s]==0) depth =max(depth,dfs(s,vis,edge,x+1));
}
return depth;
}
int main(){
int n,m,cnt=0;
cin>>n;
vector<int> edge[n+1];
int vis[n+1];
for (int i=0;i<n+1;i++){
vis[i]=0;
}
for (int i=1;i<n+1;i++){
cin>>m;
if (m==-1) m=0;
edge[m].push_back(i);
edge[i].push_back(m);
}
int depth=0;
for (int j=0;j<n+1;j++){
if (vis[j]==0) depth=max(depth ,dfs(j,vis,edge,0));
}
cout<<depth;
}
```
| -1
|
|
754
|
A
|
Lesha and array splitting
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"greedy",
"implementation"
] | null | null |
One spring day on his way to university Lesha found an array *A*. Lesha likes to split arrays into several parts. This time Lesha decided to split the array *A* into several, possibly one, new arrays so that the sum of elements in each of the new arrays is not zero. One more condition is that if we place the new arrays one after another they will form the old array *A*.
Lesha is tired now so he asked you to split the array. Help Lesha!
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array *A*.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=103<=≤<=*a**i*<=≤<=103) — the elements of the array *A*.
|
If it is not possible to split the array *A* and satisfy all the constraints, print single line containing "NO" (without quotes).
Otherwise in the first line print "YES" (without quotes). In the next line print single integer *k* — the number of new arrays. In each of the next *k* lines print two integers *l**i* and *r**i* which denote the subarray *A*[*l**i*... *r**i*] of the initial array *A* being the *i*-th new array. Integers *l**i*, *r**i* should satisfy the following conditions:
- *l*1<==<=1 - *r**k*<==<=*n* - *r**i*<=+<=1<==<=*l**i*<=+<=1 for each 1<=≤<=*i*<=<<=*k*.
If there are multiple answers, print any of them.
|
[
"3\n1 2 -3\n",
"8\n9 -12 3 4 -4 -10 7 3\n",
"1\n0\n",
"4\n1 2 3 -5\n"
] |
[
"YES\n2\n1 2\n3 3\n",
"YES\n2\n1 2\n3 8\n",
"NO\n",
"YES\n4\n1 1\n2 2\n3 3\n4 4\n"
] |
none
| 500
|
[
{
"input": "3\n1 2 -3",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "8\n9 -12 3 4 -4 -10 7 3",
"output": "YES\n8\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "4\n1 2 3 -5",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "6\n0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n507 -724 -243 -846 697 -569 -786 472 756 -272 731 -534 -664 202 592 -381 161 -668 -895 296 472 -868 599 396 -617 310 -283 -118 829 -218 807 939 -152 -343 -96 692 -570 110 442 159 -446 -631 -881 784 894 -3 -792 654 -273 -791 638 -599 -763 586 -812 248 -590 455 926 -402 61 228 209 419 -511 310 -283 857 369 472 -82 -435 -717 -421 862 -384 659 -235 406 793 -167 -504 -432 -951 0 165 36 650 -145 -500 988 -513 -495 -476 312 -754 332 819 -797 -715",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "100\n1 -2 -1 -1 2 2 0 1 -1 1 0 -2 1 -1 0 -2 -1 -1 2 0 -1 2 0 1 -2 -2 -1 1 2 0 -2 -2 -1 1 1 -1 -2 -1 0 -1 2 1 -1 -2 0 2 1 1 -2 1 1 -1 2 -2 2 0 1 -1 1 -2 0 0 0 0 0 0 -2 -2 2 1 2 2 0 -1 1 1 -2 -2 -2 1 0 2 -1 -2 -1 0 0 0 2 1 -2 0 -2 0 2 1 -2 -1 2 1",
"output": "YES\n78\n1 1\n2 2\n3 3\n4 4\n5 5\n6 7\n8 8\n9 9\n10 11\n12 12\n13 13\n14 15\n16 16\n17 17\n18 18\n19 20\n21 21\n22 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 39\n40 40\n41 41\n42 42\n43 43\n44 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 56\n57 57\n58 58\n59 59\n60 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 73\n74 74\n75 75\n76 76\n77 77\n78 78\n79 79\n80 81\n82 82\n83 83\n84 84\n85 88\n89 89\n90 90\n91 92\n93 94\n95 95\n96 96\n..."
},
{
"input": "7\n0 0 0 0 3 -3 0",
"output": "YES\n2\n1 5\n6 7"
},
{
"input": "5\n0 0 -4 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "100\n2 -38 51 -71 -24 19 35 -27 48 18 64 -4 30 -28 74 -17 -19 -25 54 41 3 -46 -43 -42 87 -76 -62 28 1 32 7 -76 15 0 -82 -33 17 40 -41 -7 43 -18 -27 65 -27 -13 46 -38 75 7 62 -23 7 -12 80 36 37 14 6 -40 -11 -35 -77 -24 -59 75 -41 -21 17 -21 -14 67 -36 16 -1 34 -26 30 -62 -4 -63 15 -49 18 57 7 77 23 -26 8 -20 8 -16 9 50 -24 -33 9 -9 -33",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75 75\n76..."
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -38 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 100"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n0 0 -17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 34\n35 100"
},
{
"input": "3\n1 -3 3",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "3\n1 0 -1",
"output": "YES\n2\n1 2\n3 3"
},
{
"input": "3\n3 0 0",
"output": "YES\n1\n1 3"
},
{
"input": "3\n0 0 0",
"output": "NO"
},
{
"input": "3\n-3 3 0",
"output": "YES\n2\n1 1\n2 3"
},
{
"input": "4\n3 -2 -1 3",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "4\n-1 0 1 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "4\n0 0 0 3",
"output": "YES\n1\n1 4"
},
{
"input": "4\n0 0 0 0",
"output": "NO"
},
{
"input": "4\n3 0 -3 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "5\n-3 2 2 0 -2",
"output": "YES\n4\n1 1\n2 2\n3 4\n5 5"
},
{
"input": "5\n0 -1 2 0 -1",
"output": "YES\n3\n1 2\n3 4\n5 5"
},
{
"input": "5\n0 2 0 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "5\n0 0 0 0 0",
"output": "NO"
},
{
"input": "5\n0 0 0 0 0",
"output": "NO"
},
{
"input": "20\n101 89 -166 -148 -38 -135 -138 193 14 -134 -185 -171 -52 -191 195 39 -148 200 51 -73",
"output": "YES\n20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "20\n-118 -5 101 7 9 144 55 -55 -9 -126 -71 -71 189 -64 -187 123 0 -48 -12 138",
"output": "YES\n19\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 17\n18 18\n19 19\n20 20"
},
{
"input": "20\n-161 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 20"
},
{
"input": "20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 -137 0 0 0 0 137",
"output": "YES\n2\n1 19\n20 20"
},
{
"input": "40\n64 -94 -386 -78 35 -233 33 82 -5 -200 368 -259 124 353 390 -305 -247 -133 379 44 133 -146 151 -217 -16 53 -157 186 -203 -8 117 -71 272 -290 -97 133 52 113 -280 -176",
"output": "YES\n40\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40"
},
{
"input": "40\n120 -96 -216 131 231 -80 -166 -102 16 227 -120 105 43 -83 -53 229 24 190 -268 119 230 348 -33 19 0 -187 -349 -25 80 -38 -30 138 -104 337 -98 0 1 -66 -243 -231",
"output": "YES\n38\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 36\n37 37\n38 38\n39 39\n40 40"
},
{
"input": "40\n0 0 0 0 0 0 324 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 40"
},
{
"input": "40\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "40\n0 0 0 0 0 308 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -308 0 0 0 0 0 0 0",
"output": "YES\n2\n1 32\n33 40"
},
{
"input": "60\n-288 -213 -213 -23 496 489 137 -301 -219 -296 -577 269 -153 -52 -505 -138 -377 500 -256 405 588 274 -115 375 -93 117 -360 -160 429 -339 502 310 502 572 -41 -26 152 -203 562 -525 -179 -67 424 62 -329 -127 352 -474 417 -30 518 326 200 -598 471 107 339 107 -9 -244",
"output": "YES\n60\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60"
},
{
"input": "60\n112 141 -146 -389 175 399 -59 327 -41 397 263 -422 157 0 471 -2 -381 -438 99 368 173 9 -171 118 24 111 120 70 11 317 -71 -574 -139 0 -477 -211 -116 -367 16 568 -75 -430 75 -179 -21 156 291 -422 441 -224 -8 -337 -104 381 60 -138 257 91 103 -359",
"output": "YES\n58\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -238 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 60"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 -98 0 0 0 0 0 0 0 0 98 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 18\n19 60"
},
{
"input": "80\n-295 -774 -700 -366 -304 -173 -672 288 -721 -256 -348 650 223 211 379 -13 -483 162 800 631 -550 -704 -357 -306 490 713 -80 -234 -669 675 -688 471 315 607 -87 -327 -799 514 248 379 271 325 -244 98 -100 -447 574 -154 554 -377 380 -423 -140 -147 -189 -420 405 464 -110 273 -226 -109 -578 641 -426 -548 214 -184 -397 570 -428 -676 652 -155 127 462 338 534 -782 -481",
"output": "YES\n80\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "80\n237 66 409 -208 -460 4 -448 29 -420 -192 -21 -76 -147 435 205 -42 -299 -29 244 -480 -4 -38 2 -214 -311 556 692 111 -19 -84 -90 -350 -354 125 -207 -137 93 367 -481 -462 -440 -92 424 -107 221 -100 -631 -72 105 201 226 -90 197 -264 427 113 202 -144 -115 398 331 147 56 -24 292 -267 -31 -11 202 506 334 -103 534 -155 -472 -124 -257 209 12 360",
"output": "YES\n80\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 668 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 80"
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 -137 137 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 13\n14 80"
},
{
"input": "100\n-98 369 544 197 -991 231 399 521 582 -820 -650 -919 -615 -411 -843 -974 231 140 239 -209 721 84 -834 -27 162 460 -157 -40 0 -778 -491 -607 -34 -647 834 -7 -518 -5 -31 -766 -54 -698 -838 497 980 -77 238 549 -135 7 -629 -892 455 181 527 314 465 -321 656 -390 368 384 601 332 561 -1000 -636 -106 412 -216 -58 -365 -155 -445 404 114 260 -392 -20 840 -395 620 -860 -936 1 882 958 536 589 235 300 676 478 434 229 698 157 -95 908 -170",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75 75\n76..."
},
{
"input": "100\n-149 -71 -300 288 -677 -580 248 49 -167 264 -215 878 7 252 -239 25 -369 -22 526 -415 -175 173 549 679 161 -411 743 -454 -34 -714 282 -198 -47 -519 -45 71 615 -214 -317 399 86 -97 246 689 -22 -197 -139 237 -501 477 -385 -421 -463 -641 409 -279 538 -382 48 189 652 -696 74 303 6 -183 336 17 -178 -617 -739 280 -202 454 864 218 480 293 -118 -518 -24 -866 -357 410 239 -833 510 316 -168 38 -370 -22 741 470 -60 -507 -209 704 141 -148",
"output": "YES\n100\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n7..."
},
{
"input": "100\n0 0 697 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 100"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -475 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 475 0 0 0 0",
"output": "YES\n2\n1 95\n96 100"
},
{
"input": "4\n0 0 3 -3",
"output": "YES\n2\n1 3\n4 4"
},
{
"input": "4\n1 0 0 0",
"output": "YES\n1\n1 4"
},
{
"input": "4\n3 3 3 3",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "2\n0 1",
"output": "YES\n1\n1 2"
},
{
"input": "4\n0 -1 1 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "1\n1",
"output": "YES\n1\n1 1"
},
{
"input": "5\n0 0 1 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "4\n0 0 1 0",
"output": "YES\n1\n1 4"
},
{
"input": "10\n1 2 0 0 3 -3 0 0 -3 0",
"output": "YES\n5\n1 1\n2 4\n5 5\n6 8\n9 10"
},
{
"input": "3\n0 -1 0",
"output": "YES\n1\n1 3"
},
{
"input": "2\n1 0",
"output": "YES\n1\n1 2"
},
{
"input": "5\n3 -3 0 0 0",
"output": "YES\n2\n1 1\n2 5"
},
{
"input": "3\n0 1 0",
"output": "YES\n1\n1 3"
},
{
"input": "4\n0 0 0 1",
"output": "YES\n1\n1 4"
},
{
"input": "4\n1 -1 1 -1",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "1\n-1",
"output": "YES\n1\n1 1"
},
{
"input": "2\n1 1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n1 -1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n0 0",
"output": "NO"
},
{
"input": "2\n0 -1",
"output": "YES\n1\n1 2"
},
{
"input": "2\n-1 1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n-1 0",
"output": "YES\n1\n1 2"
},
{
"input": "2\n-1 -1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "3\n5 -5 5",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "5\n1 0 -1 0 1",
"output": "YES\n3\n1 2\n3 4\n5 5"
},
{
"input": "6\n0 0 0 3 0 0",
"output": "YES\n1\n1 6"
},
{
"input": "3\n1 -1 1",
"output": "YES\n3\n1 1\n2 2\n3 3"
}
] | 1,640,692,684
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n=int(input()
lst=list(map(int,input().split()))
sum=0
for i in range(n):
sum=lst[i]+sum
if(sum==0):
print("NO")
elif(sum):
print("YES\n1\n1")
else:
print("YES\n[2]\n[1]\n,sum,sum+1")
|
Title: Lesha and array splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One spring day on his way to university Lesha found an array *A*. Lesha likes to split arrays into several parts. This time Lesha decided to split the array *A* into several, possibly one, new arrays so that the sum of elements in each of the new arrays is not zero. One more condition is that if we place the new arrays one after another they will form the old array *A*.
Lesha is tired now so he asked you to split the array. Help Lesha!
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array *A*.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=103<=≤<=*a**i*<=≤<=103) — the elements of the array *A*.
Output Specification:
If it is not possible to split the array *A* and satisfy all the constraints, print single line containing "NO" (without quotes).
Otherwise in the first line print "YES" (without quotes). In the next line print single integer *k* — the number of new arrays. In each of the next *k* lines print two integers *l**i* and *r**i* which denote the subarray *A*[*l**i*... *r**i*] of the initial array *A* being the *i*-th new array. Integers *l**i*, *r**i* should satisfy the following conditions:
- *l*1<==<=1 - *r**k*<==<=*n* - *r**i*<=+<=1<==<=*l**i*<=+<=1 for each 1<=≤<=*i*<=<<=*k*.
If there are multiple answers, print any of them.
Demo Input:
['3\n1 2 -3\n', '8\n9 -12 3 4 -4 -10 7 3\n', '1\n0\n', '4\n1 2 3 -5\n']
Demo Output:
['YES\n2\n1 2\n3 3\n', 'YES\n2\n1 2\n3 8\n', 'NO\n', 'YES\n4\n1 1\n2 2\n3 3\n4 4\n']
Note:
none
|
```python
n=int(input()
lst=list(map(int,input().split()))
sum=0
for i in range(n):
sum=lst[i]+sum
if(sum==0):
print("NO")
elif(sum):
print("YES\n1\n1")
else:
print("YES\n[2]\n[1]\n,sum,sum+1")
```
| -1
|
|
386
|
A
|
Second-Price Auction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction).
Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
|
The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
|
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
|
[
"2\n5 7\n",
"3\n10 2 8\n",
"6\n3 8 2 9 4 14\n"
] |
[
"2 5\n",
"1 8\n",
"6 9\n"
] |
none
| 500
|
[
{
"input": "2\n5 7",
"output": "2 5"
},
{
"input": "3\n10 2 8",
"output": "1 8"
},
{
"input": "6\n3 8 2 9 4 14",
"output": "6 9"
},
{
"input": "4\n4707 7586 4221 5842",
"output": "2 5842"
},
{
"input": "5\n3304 4227 4869 6937 6002",
"output": "4 6002"
},
{
"input": "6\n5083 3289 7708 5362 9031 7458",
"output": "5 7708"
},
{
"input": "7\n9038 6222 3392 1706 3778 1807 2657",
"output": "1 6222"
},
{
"input": "8\n7062 2194 4481 3864 7470 1814 8091 733",
"output": "7 7470"
},
{
"input": "9\n2678 5659 9199 2628 7906 7496 4524 2663 3408",
"output": "3 7906"
},
{
"input": "2\n3458 1504",
"output": "1 1504"
},
{
"input": "50\n9237 3904 407 9052 6657 9229 9752 3888 7732 2512 4614 1055 2355 7108 6506 6849 2529 8862 159 8630 7906 7941 960 8470 333 8659 54 9475 3163 5625 6393 6814 2656 3388 169 7918 4881 8468 9983 6281 6340 280 5108 2996 101 7617 3313 8172 326 1991",
"output": "39 9752"
},
{
"input": "100\n2515 3324 7975 6171 4240 1217 4829 5203 8603 6900 3031 4699 4732 6070 4221 3228 6497 7359 9130 4346 4619 1109 3945 5442 3271 16 9711 2045 6410 2301 3406 8125 6003 1892 1260 9661 3940 6692 4708 7027 4930 6925 1979 5361 4263 3144 867 8639 6230 5562 9714 3676 4231 3347 4733 4920 4881 3431 1059 7313 8912 3038 9308 72 9583 7009 3034 7425 2398 6141 3245 2495 2933 6710 8289 9806 1226 8393 7349 6462 1618 9613 3546 6012 2964 9995 1578 210 2123 4874 1252 8625 348 8020 803 7244 9080 5088 706 2602",
"output": "86 9806"
},
{
"input": "2\n2 1",
"output": "1 1"
},
{
"input": "2\n1 2",
"output": "2 1"
},
{
"input": "3\n10 20 30",
"output": "3 20"
},
{
"input": "3\n10 30 20",
"output": "2 20"
},
{
"input": "3\n20 10 30",
"output": "3 20"
},
{
"input": "3\n20 30 10",
"output": "2 20"
},
{
"input": "3\n30 10 20",
"output": "1 20"
},
{
"input": "3\n30 20 10",
"output": "1 20"
},
{
"input": "2\n1 10000",
"output": "2 1"
},
{
"input": "2\n10000 999",
"output": "1 999"
},
{
"input": "3\n3 4 1",
"output": "2 3"
},
{
"input": "6\n1 2 24 6 5 7",
"output": "3 7"
}
] | 1,607,147,707
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include<stdio.h>
using namespace std;
int main(){
int
}
|
Title: Second-Price Auction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction).
Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
Output Specification:
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
Demo Input:
['2\n5 7\n', '3\n10 2 8\n', '6\n3 8 2 9 4 14\n']
Demo Output:
['2 5\n', '1 8\n', '6 9\n']
Note:
none
|
```python
#include<stdio.h>
using namespace std;
int main(){
int
}
```
| -1
|
|
919
|
B
|
Perfect Number
|
PROGRAMMING
| 1,100
|
[
"binary search",
"brute force",
"dp",
"implementation",
"number theory"
] | null | null |
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
|
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
|
A single number, denoting the $k$-th smallest perfect integer.
|
[
"1\n",
"2\n"
] |
[
"19\n",
"28\n"
] |
The first perfect integer is $19$ and the second one is $28$.
| 750
|
[
{
"input": "1",
"output": "19"
},
{
"input": "2",
"output": "28"
},
{
"input": "13",
"output": "136"
},
{
"input": "101",
"output": "1432"
},
{
"input": "1023",
"output": "100270"
},
{
"input": "9999",
"output": "10800010"
},
{
"input": "10000",
"output": "10800100"
},
{
"input": "2333",
"output": "310060"
},
{
"input": "9139",
"output": "10134010"
},
{
"input": "9859",
"output": "10422001"
},
{
"input": "5987",
"output": "2221201"
},
{
"input": "3",
"output": "37"
},
{
"input": "4",
"output": "46"
},
{
"input": "5",
"output": "55"
},
{
"input": "7",
"output": "73"
},
{
"input": "9",
"output": "91"
},
{
"input": "10",
"output": "109"
},
{
"input": "15",
"output": "154"
},
{
"input": "51",
"output": "613"
},
{
"input": "99",
"output": "1414"
},
{
"input": "138",
"output": "2224"
},
{
"input": "233",
"output": "5050"
},
{
"input": "666",
"output": "27100"
},
{
"input": "1234",
"output": "110206"
},
{
"input": "3567",
"output": "1033003"
},
{
"input": "4445",
"output": "1221301"
},
{
"input": "5689",
"output": "2114002"
},
{
"input": "6666",
"output": "3102004"
},
{
"input": "7777",
"output": "5300200"
},
{
"input": "8888",
"output": "10110061"
},
{
"input": "9411",
"output": "10214200"
},
{
"input": "5539",
"output": "2101114"
},
{
"input": "6259",
"output": "2511100"
},
{
"input": "2387",
"output": "312220"
},
{
"input": "8515",
"output": "10030114"
}
] | 1,679,232,416
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 46
| 0
|
a = input()
x = [1,2,3,4,5,6,7,8,9]
sum=0
for i in a:
sum+=int(i)
print(i,end="")
print(10-sum)
|
Title: Perfect Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
Input Specification:
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
Output Specification:
A single number, denoting the $k$-th smallest perfect integer.
Demo Input:
['1\n', '2\n']
Demo Output:
['19\n', '28\n']
Note:
The first perfect integer is $19$ and the second one is $28$.
|
```python
a = input()
x = [1,2,3,4,5,6,7,8,9]
sum=0
for i in a:
sum+=int(i)
print(i,end="")
print(10-sum)
```
| 0
|
|
558
|
A
|
Lala Land and Apple Trees
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Amr lives in Lala Land. Lala Land is a very beautiful country that is located on a coordinate line. Lala Land is famous with its apple trees growing everywhere.
Lala Land has exactly *n* apple trees. Tree number *i* is located in a position *x**i* and has *a**i* apples growing on it. Amr wants to collect apples from the apple trees. Amr currently stands in *x*<==<=0 position. At the beginning, he can choose whether to go right or left. He'll continue in his direction until he meets an apple tree he didn't visit before. He'll take all of its apples and then reverse his direction, continue walking in this direction until he meets another apple tree he didn't visit before and so on. In the other words, Amr reverses his direction when visiting each new apple tree. Amr will stop collecting apples when there are no more trees he didn't visit in the direction he is facing.
What is the maximum number of apples he can collect?
|
The first line contains one number *n* (1<=≤<=*n*<=≤<=100), the number of apple trees in Lala Land.
The following *n* lines contains two integers each *x**i*, *a**i* (<=-<=105<=≤<=*x**i*<=≤<=105, *x**i*<=≠<=0, 1<=≤<=*a**i*<=≤<=105), representing the position of the *i*-th tree and number of apples on it.
It's guaranteed that there is at most one apple tree at each coordinate. It's guaranteed that no tree grows in point 0.
|
Output the maximum number of apples Amr can collect.
|
[
"2\n-1 5\n1 5\n",
"3\n-2 2\n1 4\n-1 3\n",
"3\n1 9\n3 5\n7 10\n"
] |
[
"10",
"9",
"9"
] |
In the first sample test it doesn't matter if Amr chose at first to go left or right. In both cases he'll get all the apples.
In the second sample test the optimal solution is to go left to *x* = - 1, collect apples from there, then the direction will be reversed, Amr has to go to *x* = 1, collect apples from there, then the direction will be reversed and Amr goes to the final tree *x* = - 2.
In the third sample test the optimal solution is to go right to *x* = 1, collect apples from there, then the direction will be reversed and Amr will not be able to collect anymore apples because there are no apple trees to his left.
| 500
|
[
{
"input": "2\n-1 5\n1 5",
"output": "10"
},
{
"input": "3\n-2 2\n1 4\n-1 3",
"output": "9"
},
{
"input": "3\n1 9\n3 5\n7 10",
"output": "9"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "4\n10000 100000\n-1000 100000\n-2 100000\n-1 100000",
"output": "300000"
},
{
"input": "1\n-1 1",
"output": "1"
},
{
"input": "27\n-30721 24576\n-6620 92252\n88986 24715\n-94356 10509\n-6543 29234\n-68554 69530\n39176 96911\n67266 99669\n95905 51002\n-94093 92134\n65382 23947\n-6525 79426\n-448 67531\n-70083 26921\n-86333 50029\n48924 8036\n-27228 5349\n6022 10691\n-13840 56735\n50398 58794\n-63258 45557\n-27792 77057\n98295 1203\n-51294 18757\n35037 61941\n-30112 13076\n82334 20463",
"output": "1036452"
},
{
"input": "18\n-18697 44186\n56333 51938\n-75688 49735\n77762 14039\n-43996 81060\n69700 49107\n74532 45568\n-94476 203\n-92347 90745\n58921 44650\n57563 63561\n44630 8486\n35750 5999\n3249 34202\n75358 68110\n-33245 60458\n-88148 2342\n87856 85532",
"output": "632240"
},
{
"input": "28\n49728 91049\n-42863 4175\n-89214 22191\n77977 16965\n-42960 87627\n-84329 97494\n89270 75906\n-13695 28908\n-72279 13607\n-97327 87062\n-58682 32094\n39108 99936\n29304 93784\n-63886 48237\n-77359 57648\n-87013 79017\n-41086 35033\n-60613 83555\n-48955 56816\n-20568 26802\n52113 25160\n-88885 45294\n22601 42971\n62693 65662\n-15985 5357\n86671 8522\n-59921 11271\n-79304 25044",
"output": "891593"
},
{
"input": "25\n5704 67795\n6766 31836\n-41715 89987\n76854 9848\n11648 90020\n-79763 10107\n96971 92636\n-64205 71937\n87997 38273\n-9782 57187\n22186 6905\n-41130 40258\n-28403 66579\n19578 43375\n35735 52929\n-52417 89388\n-89430 1939\n9401 43491\n-11228 10112\n-86859 16024\n-51486 33467\n-80578 65080\n-52820 98445\n-89165 7657\n-97106 79422",
"output": "1109655"
},
{
"input": "16\n-41732 47681\n44295 28942\n-75194 99827\n69982 18020\n-75378 22026\n80032 22908\n-34879 41113\n36257 48574\n-35882 84333\n29646 71151\n-86214 80886\n72724 39364\n-42529 60880\n29150 29921\n-8471 80781\n79387 70834",
"output": "847241"
},
{
"input": "3\n-94146 4473\n28707 99079\n-4153 8857",
"output": "112409"
},
{
"input": "3\n-3 3\n-2 2\n-1 1",
"output": "1"
},
{
"input": "2\n100000 3\n-100000 9",
"output": "12"
},
{
"input": "2\n-100000 100000\n100000 99999",
"output": "199999"
}
] | 1,680,685,953
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 8
| 31
| 0
|
n = int(input())
counter_pos , counter_neg = 0 , 0
data_pos =[]
data_neg =[]
for i in range(n) :
s = list(map(int ,input().split()))
if s[0] > 0 :
counter_pos += 1
data_pos.append(s)
else :
counter_neg += 1
data_neg.append(s)
res = 0
if counter_neg == 0 :
res = min(data_pos)[1]
elif counter_pos == 0 :
res = min(data_neg)[1]
elif counter_pos >= counter_neg :
flag1 ,flag2 =True ,False
for i in range(n) :
if flag1 :
if data_pos == [] :
continue
res += min(data_pos)[1]
data_pos.remove(min(data_pos))
flag1 = False
flag2 = True
elif flag2 :
if data_neg == [] :
continue
res += min(data_neg)[1]
data_neg.remove(min(data_neg))
flag1 = True
flag2 = False
elif counter_pos < counter_neg :
flag1 ,flag2 =True ,False
for i in range(n) :
if flag1 :
if data_neg == [] :
continue
res += min(data_neg)[1]
data_neg.remove(min(data_neg))
flag1 = False
flag2 = True
elif flag2 :
if data_pos == [] :
continue
res += min(data_pos)[1]
data_pos.remove(min(data_pos))
flag1 = True
flag2 = False
print(res)
|
Title: Lala Land and Apple Trees
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr lives in Lala Land. Lala Land is a very beautiful country that is located on a coordinate line. Lala Land is famous with its apple trees growing everywhere.
Lala Land has exactly *n* apple trees. Tree number *i* is located in a position *x**i* and has *a**i* apples growing on it. Amr wants to collect apples from the apple trees. Amr currently stands in *x*<==<=0 position. At the beginning, he can choose whether to go right or left. He'll continue in his direction until he meets an apple tree he didn't visit before. He'll take all of its apples and then reverse his direction, continue walking in this direction until he meets another apple tree he didn't visit before and so on. In the other words, Amr reverses his direction when visiting each new apple tree. Amr will stop collecting apples when there are no more trees he didn't visit in the direction he is facing.
What is the maximum number of apples he can collect?
Input Specification:
The first line contains one number *n* (1<=≤<=*n*<=≤<=100), the number of apple trees in Lala Land.
The following *n* lines contains two integers each *x**i*, *a**i* (<=-<=105<=≤<=*x**i*<=≤<=105, *x**i*<=≠<=0, 1<=≤<=*a**i*<=≤<=105), representing the position of the *i*-th tree and number of apples on it.
It's guaranteed that there is at most one apple tree at each coordinate. It's guaranteed that no tree grows in point 0.
Output Specification:
Output the maximum number of apples Amr can collect.
Demo Input:
['2\n-1 5\n1 5\n', '3\n-2 2\n1 4\n-1 3\n', '3\n1 9\n3 5\n7 10\n']
Demo Output:
['10', '9', '9']
Note:
In the first sample test it doesn't matter if Amr chose at first to go left or right. In both cases he'll get all the apples.
In the second sample test the optimal solution is to go left to *x* = - 1, collect apples from there, then the direction will be reversed, Amr has to go to *x* = 1, collect apples from there, then the direction will be reversed and Amr goes to the final tree *x* = - 2.
In the third sample test the optimal solution is to go right to *x* = 1, collect apples from there, then the direction will be reversed and Amr will not be able to collect anymore apples because there are no apple trees to his left.
|
```python
n = int(input())
counter_pos , counter_neg = 0 , 0
data_pos =[]
data_neg =[]
for i in range(n) :
s = list(map(int ,input().split()))
if s[0] > 0 :
counter_pos += 1
data_pos.append(s)
else :
counter_neg += 1
data_neg.append(s)
res = 0
if counter_neg == 0 :
res = min(data_pos)[1]
elif counter_pos == 0 :
res = min(data_neg)[1]
elif counter_pos >= counter_neg :
flag1 ,flag2 =True ,False
for i in range(n) :
if flag1 :
if data_pos == [] :
continue
res += min(data_pos)[1]
data_pos.remove(min(data_pos))
flag1 = False
flag2 = True
elif flag2 :
if data_neg == [] :
continue
res += min(data_neg)[1]
data_neg.remove(min(data_neg))
flag1 = True
flag2 = False
elif counter_pos < counter_neg :
flag1 ,flag2 =True ,False
for i in range(n) :
if flag1 :
if data_neg == [] :
continue
res += min(data_neg)[1]
data_neg.remove(min(data_neg))
flag1 = False
flag2 = True
elif flag2 :
if data_pos == [] :
continue
res += min(data_pos)[1]
data_pos.remove(min(data_pos))
flag1 = True
flag2 = False
print(res)
```
| 0
|
|
408
|
A
|
Line to Cashier
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≤<=*k**i*<=≤<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≤<=*m**i*,<=*j*<=≤<=100) — the number of products the *j*-th person in the queue for the *i*-th cash has.
|
Print a single integer — the minimum number of seconds Vasya needs to get to the cashier.
|
[
"1\n1\n1\n",
"4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n"
] |
[
"20\n",
"100\n"
] |
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1·5 + 2·5 + 2·5 + 3·5 + 4·15 = 100 seconds. He will need 1·5 + 9·5 + 1·5 + 3·15 = 100 seconds for the third one and 7·5 + 8·5 + 2·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
| 500
|
[
{
"input": "1\n1\n1",
"output": "20"
},
{
"input": "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8",
"output": "100"
},
{
"input": "4\n5 4 5 5\n3 1 3 1 2\n3 1 1 3\n1 1 1 2 2\n2 2 1 1 3",
"output": "100"
},
{
"input": "5\n5 3 6 6 4\n7 5 3 3 9\n6 8 2\n1 10 8 5 9 2\n9 7 8 5 9 10\n9 8 3 3",
"output": "125"
},
{
"input": "5\n10 10 10 10 10\n6 7 8 6 8 5 9 8 10 5\n9 6 9 8 7 8 8 10 8 5\n8 7 7 8 7 5 6 8 9 5\n6 5 10 5 5 10 7 8 5 5\n10 9 8 7 6 9 7 9 6 5",
"output": "480"
},
{
"input": "10\n9 10 10 10 9 5 9 7 8 7\n11 6 10 4 4 15 7 15 5\n3 9 11 12 11 1 13 13 1 5\n6 15 9 12 3 2 8 12 11 10\n7 1 1 6 10 2 6 1 14 2\n8 14 2 3 6 1 14 1 12\n6 10 9 3 5\n13 12 12 7 13 4 4 8 10\n5 6 4 3 14 9 13\n8 12 1 5 7 4 13 1\n1 9 5 3 5 1 4",
"output": "240"
},
{
"input": "10\n5 5 5 5 5 5 5 5 5 5\n5 5 4 5 4\n6 5 7 7 6\n5 4 4 5 5\n4 4 5 5 5\n7 6 4 5 7\n4 6 5 4 5\n6 6 7 6 6\n4 5 4 4 7\n7 5 4 4 5\n6 6 7 4 4",
"output": "190"
},
{
"input": "1\n1\n100",
"output": "515"
},
{
"input": "1\n90\n90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90",
"output": "41850"
}
] | 1,451,139,058
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 62
| 0
|
N = int(input())
cashiers = []
K_unused = input().split()
for i in range(N):
qu_sum = 0
tmp = list(map(int, input().split()))
queue = len(tmp)
for e in tmp:
qu_sum += (e*5) + 15
cashiers.append(qu_sum)
print(min(cashiers))
|
Title: Line to Cashier
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≤<=*k**i*<=≤<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≤<=*m**i*,<=*j*<=≤<=100) — the number of products the *j*-th person in the queue for the *i*-th cash has.
Output Specification:
Print a single integer — the minimum number of seconds Vasya needs to get to the cashier.
Demo Input:
['1\n1\n1\n', '4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n']
Demo Output:
['20\n', '100\n']
Note:
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1·5 + 2·5 + 2·5 + 3·5 + 4·15 = 100 seconds. He will need 1·5 + 9·5 + 1·5 + 3·15 = 100 seconds for the third one and 7·5 + 8·5 + 2·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
|
```python
N = int(input())
cashiers = []
K_unused = input().split()
for i in range(N):
qu_sum = 0
tmp = list(map(int, input().split()))
queue = len(tmp)
for e in tmp:
qu_sum += (e*5) + 15
cashiers.append(qu_sum)
print(min(cashiers))
```
| 3
|
|
412
|
B
|
Network Configuration
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] | null | null |
The R1 company wants to hold a web search championship. There were *n* computers given for the competition, each of them is connected to the Internet. The organizers believe that the data transfer speed directly affects the result. The higher the speed of the Internet is, the faster the participant will find the necessary information. Therefore, before the competition started, each computer had its maximum possible data transfer speed measured. On the *i*-th computer it was *a**i* kilobits per second.
There will be *k* participants competing in the championship, each should get a separate computer. The organizing company does not want any of the participants to have an advantage over the others, so they want to provide the same data transfer speed to each participant's computer. Also, the organizers want to create the most comfortable conditions for the participants, so the data transfer speed on the participants' computers should be as large as possible.
The network settings of the R1 company has a special option that lets you to cut the initial maximum data transfer speed of any computer to any lower speed. How should the R1 company configure the network using the described option so that at least *k* of *n* computers had the same data transfer speed and the data transfer speed on these computers was as large as possible?
|
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of computers and the number of participants, respectively. In the second line you have a space-separated sequence consisting of *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (16<=≤<=*a**i*<=≤<=32768); number *a**i* denotes the maximum data transfer speed on the *i*-th computer.
|
Print a single integer — the maximum Internet speed value. It is guaranteed that the answer to the problem is always an integer.
|
[
"3 2\n40 20 30\n",
"6 4\n100 20 40 20 50 50\n"
] |
[
"30\n",
"40\n"
] |
In the first test case the organizers can cut the first computer's speed to 30 kilobits. Then two computers (the first and the third one) will have the same speed of 30 kilobits. They should be used as the participants' computers. This answer is optimal.
| 1,000
|
[
{
"input": "3 2\n40 20 30",
"output": "30"
},
{
"input": "6 4\n100 20 40 20 50 50",
"output": "40"
},
{
"input": "1 1\n16",
"output": "16"
},
{
"input": "2 1\n10000 17",
"output": "10000"
},
{
"input": "2 2\n200 300",
"output": "200"
},
{
"input": "3 1\n21 25 16",
"output": "25"
},
{
"input": "3 2\n23 20 26",
"output": "23"
},
{
"input": "3 3\n19 29 28",
"output": "19"
},
{
"input": "100 2\n82 37 88 28 98 30 38 76 90 68 79 29 67 93 19 71 122 103 110 79 20 75 68 101 16 120 114 68 73 71 103 114 99 70 73 18 36 31 32 87 32 79 44 72 58 25 44 72 106 38 47 17 83 41 75 23 49 30 73 67 117 52 22 117 109 89 66 88 75 62 17 35 83 69 63 60 23 120 93 18 112 93 39 72 116 109 106 72 27 123 117 119 87 72 33 73 70 110 43 43",
"output": "122"
},
{
"input": "30 13\n36 82 93 91 48 62 59 96 72 40 45 68 97 70 26 22 35 98 92 83 72 49 70 39 53 94 97 65 37 28",
"output": "70"
},
{
"input": "50 49\n20 77 31 40 18 87 44 64 70 48 29 59 98 33 95 17 69 84 81 17 24 66 37 54 97 55 77 79 42 21 23 42 36 55 81 83 94 45 25 84 20 97 37 95 46 92 73 39 90 71",
"output": "17"
},
{
"input": "40 40\n110 674 669 146 882 590 650 844 427 187 380 711 122 94 38 216 414 874 380 31 895 390 414 557 913 68 665 964 895 708 594 17 24 621 780 509 837 550 630 568",
"output": "17"
},
{
"input": "40 1\n851 110 1523 1572 945 4966 4560 756 2373 4760 144 2579 4022 220 1924 1042 160 2792 2425 4483 2154 4120 319 4617 4686 2502 4797 4941 4590 4478 4705 4355 695 684 1560 684 2780 1090 4995 3113",
"output": "4995"
},
{
"input": "70 12\n6321 2502 557 2734 16524 10133 13931 5045 3897 18993 5745 8687 12344 1724 12071 2345 3852 9312 14432 8615 7461 2439 4751 19872 12266 12997 8276 8155 9502 3047 7226 12754 9447 17349 1888 14564 18257 18099 8924 14199 738 13693 10917 15554 15773 17859 13391 13176 10567 19658 16494 3968 13977 14694 10537 4044 16402 9714 4425 13599 19660 2426 19687 2455 2382 3413 5754 113 7542 8353",
"output": "16402"
},
{
"input": "80 60\n6159 26457 23753 27073 9877 4492 11957 10989 27151 6552 1646 7773 23924 27554 10517 8788 31160 455 12625 22009 22133 15657 14968 31871 15344 16550 27414 876 31213 10895 21508 17516 12747 59 11786 10497 30143 25548 22003 2809 11694 30395 8122 31248 23075 19013 31614 9133 27942 27346 15969 19415 10367 8424 29355 18903 3396 6327 4201 24124 24266 22586 724 1595 3972 17526 2843 20982 23655 12714 18050 15225 2658 7236 27555 13023 729 9022 17386 2585",
"output": "8122"
},
{
"input": "100 1\n199 348 489 76 638 579 982 125 28 401 228 117 195 337 80 914 752 98 679 417 47 225 357 413 849 622 477 620 487 223 321 240 439 393 733 660 652 500 877 40 788 246 376 723 952 601 912 316 598 809 476 932 384 147 982 271 202 695 129 303 304 712 49 306 598 141 833 730 946 708 724 788 202 465 951 118 279 706 214 655 152 976 998 231 487 311 342 317 243 554 977 232 365 643 336 501 761 400 600 528",
"output": "998"
},
{
"input": "80 50\n15160 6853 20254 11358 19535 27691 2983 31650 9219 11833 32053 31695 21511 4320 4384 24843 1454 31543 18796 13815 1546 27926 16276 14315 12542 25370 24890 29647 3584 17867 12446 15072 19852 30207 16361 7964 5343 398 10837 31114 9252 12767 15098 22562 32637 31823 8160 12658 6422 19142 12448 6765 7373 868 31712 24856 23251 29200 8159 16144 27165 4308 13652 12502 4183 7961 3032 26855 8687 12263 24319 7722 19460 30700 29806 1280 21141 25965 25550 26881",
"output": "12448"
},
{
"input": "50 16\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 1\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 2\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 100\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 99\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
}
] | 1,631,544,129
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 6,758,400
|
n, k = map(int, input().split())
l = list(map(int, input().split()))
print(sum(l) // n * 10)
|
Title: Network Configuration
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The R1 company wants to hold a web search championship. There were *n* computers given for the competition, each of them is connected to the Internet. The organizers believe that the data transfer speed directly affects the result. The higher the speed of the Internet is, the faster the participant will find the necessary information. Therefore, before the competition started, each computer had its maximum possible data transfer speed measured. On the *i*-th computer it was *a**i* kilobits per second.
There will be *k* participants competing in the championship, each should get a separate computer. The organizing company does not want any of the participants to have an advantage over the others, so they want to provide the same data transfer speed to each participant's computer. Also, the organizers want to create the most comfortable conditions for the participants, so the data transfer speed on the participants' computers should be as large as possible.
The network settings of the R1 company has a special option that lets you to cut the initial maximum data transfer speed of any computer to any lower speed. How should the R1 company configure the network using the described option so that at least *k* of *n* computers had the same data transfer speed and the data transfer speed on these computers was as large as possible?
Input Specification:
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of computers and the number of participants, respectively. In the second line you have a space-separated sequence consisting of *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (16<=≤<=*a**i*<=≤<=32768); number *a**i* denotes the maximum data transfer speed on the *i*-th computer.
Output Specification:
Print a single integer — the maximum Internet speed value. It is guaranteed that the answer to the problem is always an integer.
Demo Input:
['3 2\n40 20 30\n', '6 4\n100 20 40 20 50 50\n']
Demo Output:
['30\n', '40\n']
Note:
In the first test case the organizers can cut the first computer's speed to 30 kilobits. Then two computers (the first and the third one) will have the same speed of 30 kilobits. They should be used as the participants' computers. This answer is optimal.
|
```python
n, k = map(int, input().split())
l = list(map(int, input().split()))
print(sum(l) // n * 10)
```
| 0
|
|
864
|
A
|
Fair Game
|
PROGRAMMING
| 1,000
|
[
"implementation",
"sortings"
] | null | null |
Petya and Vasya decided to play a game. They have *n* cards (*n* is an even number). A single integer is written on each card.
Before the game Petya will choose an integer and after that Vasya will choose another integer (different from the number that Petya chose). During the game each player takes all the cards with number he chose. For example, if Petya chose number 5 before the game he will take all cards on which 5 is written and if Vasya chose number 10 before the game he will take all cards on which 10 is written.
The game is considered fair if Petya and Vasya can take all *n* cards, and the number of cards each player gets is the same.
Determine whether Petya and Vasya can choose integer numbers before the game so that the game is fair.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=100) — number of cards. It is guaranteed that *n* is an even number.
The following *n* lines contain a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (one integer per line, 1<=≤<=*a**i*<=≤<=100) — numbers written on the *n* cards.
|
If it is impossible for Petya and Vasya to choose numbers in such a way that the game will be fair, print "NO" (without quotes) in the first line. In this case you should not print anything more.
In the other case print "YES" (without quotes) in the first line. In the second line print two distinct integers — number that Petya should choose and the number that Vasya should choose to make the game fair. If there are several solutions, print any of them.
|
[
"4\n11\n27\n27\n11\n",
"2\n6\n6\n",
"6\n10\n20\n30\n20\n10\n20\n",
"6\n1\n1\n2\n2\n3\n3\n"
] |
[
"YES\n11 27\n",
"NO\n",
"NO\n",
"NO\n"
] |
In the first example the game will be fair if, for example, Petya chooses number 11, and Vasya chooses number 27. Then the will take all cards — Petya will take cards 1 and 4, and Vasya will take cards 2 and 3. Thus, each of them will take exactly two cards.
In the second example fair game is impossible because the numbers written on the cards are equal, but the numbers that Petya and Vasya should choose should be distinct.
In the third example it is impossible to take all cards. Petya and Vasya can take at most five cards — for example, Petya can choose number 10 and Vasya can choose number 20. But for the game to be fair it is necessary to take 6 cards.
| 500
|
[
{
"input": "4\n11\n27\n27\n11",
"output": "YES\n11 27"
},
{
"input": "2\n6\n6",
"output": "NO"
},
{
"input": "6\n10\n20\n30\n20\n10\n20",
"output": "NO"
},
{
"input": "6\n1\n1\n2\n2\n3\n3",
"output": "NO"
},
{
"input": "2\n1\n100",
"output": "YES\n1 100"
},
{
"input": "2\n1\n1",
"output": "NO"
},
{
"input": "2\n100\n100",
"output": "NO"
},
{
"input": "14\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43",
"output": "NO"
},
{
"input": "100\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32",
"output": "YES\n14 32"
},
{
"input": "2\n50\n100",
"output": "YES\n50 100"
},
{
"input": "2\n99\n100",
"output": "YES\n99 100"
},
{
"input": "4\n4\n4\n5\n5",
"output": "YES\n4 5"
},
{
"input": "10\n10\n10\n10\n10\n10\n23\n23\n23\n23\n23",
"output": "YES\n10 23"
},
{
"input": "20\n34\n34\n34\n34\n34\n34\n34\n34\n34\n34\n11\n11\n11\n11\n11\n11\n11\n11\n11\n11",
"output": "YES\n11 34"
},
{
"input": "40\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30",
"output": "YES\n20 30"
},
{
"input": "58\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "YES\n1 100"
},
{
"input": "98\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99",
"output": "YES\n2 99"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "YES\n1 100"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2",
"output": "YES\n1 2"
},
{
"input": "100\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12",
"output": "YES\n12 49"
},
{
"input": "100\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94",
"output": "YES\n15 94"
},
{
"input": "100\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42",
"output": "YES\n33 42"
},
{
"input": "100\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35",
"output": "YES\n16 35"
},
{
"input": "100\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44",
"output": "YES\n33 44"
},
{
"input": "100\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98",
"output": "YES\n54 98"
},
{
"input": "100\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12",
"output": "YES\n12 81"
},
{
"input": "100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "NO"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "NO"
},
{
"input": "40\n20\n20\n30\n30\n20\n20\n20\n30\n30\n20\n20\n30\n30\n30\n30\n20\n30\n30\n30\n30\n20\n20\n30\n30\n30\n20\n30\n20\n30\n20\n30\n20\n20\n20\n30\n20\n20\n20\n30\n30",
"output": "NO"
},
{
"input": "58\n100\n100\n100\n100\n100\n1\n1\n1\n1\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n100\n1\n100\n100\n100\n100\n100\n1\n1\n100\n100\n100\n100\n1\n100\n1\n1\n1\n1\n1",
"output": "NO"
},
{
"input": "98\n2\n99\n99\n99\n99\n2\n99\n99\n99\n2\n2\n99\n2\n2\n2\n2\n99\n99\n2\n99\n2\n2\n99\n99\n99\n99\n2\n2\n99\n2\n99\n99\n2\n2\n99\n2\n99\n2\n99\n2\n2\n2\n99\n2\n2\n2\n2\n99\n99\n99\n99\n2\n2\n2\n2\n2\n2\n2\n2\n99\n2\n99\n99\n2\n2\n99\n99\n99\n99\n99\n99\n99\n99\n2\n99\n2\n99\n2\n2\n2\n99\n99\n99\n99\n99\n99\n2\n99\n99\n2\n2\n2\n2\n2\n99\n99\n99\n2",
"output": "NO"
},
{
"input": "100\n100\n1\n100\n1\n1\n100\n1\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n1\n100\n1\n100\n1\n100\n100\n1\n100\n1\n100\n1\n1\n1\n1\n1\n100\n1\n100\n100\n100\n1\n100\n100\n1\n100\n1\n1\n100\n100\n100\n1\n100\n100\n1\n1\n100\n100\n1\n100\n1\n100\n1\n1\n100\n100\n100\n100\n100\n100\n1\n100\n100\n1\n100\n100\n1\n100\n1\n1\n1\n100\n100\n1\n100\n1\n100\n1\n1\n1\n1\n100\n1\n1\n100\n1\n100\n100\n1\n100\n1\n100",
"output": "NO"
},
{
"input": "100\n100\n100\n100\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n100\n1\n100\n1\n100\n1\n100\n100\n100\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n1\n100\n100\n1\n100\n1\n1\n100\n1\n1\n100\n1\n100\n100\n100\n1\n100\n100\n100\n1\n100\n1\n100\n100\n100\n1\n1\n100\n100\n100\n100\n1\n100\n36\n100\n1\n100\n1\n100\n100\n100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n100\n1\n1\n100\n100\n100\n100\n100\n1\n100\n1\n100\n1\n1\n100\n100\n1\n100",
"output": "NO"
},
{
"input": "100\n2\n1\n1\n2\n2\n1\n1\n1\n1\n2\n1\n1\n1\n2\n2\n2\n1\n1\n1\n2\n1\n2\n2\n2\n2\n1\n1\n2\n1\n1\n2\n1\n27\n1\n1\n1\n2\n2\n2\n1\n2\n1\n2\n1\n1\n2\n2\n2\n2\n2\n2\n2\n2\n1\n2\n2\n2\n2\n1\n2\n1\n1\n1\n1\n1\n2\n1\n1\n1\n2\n2\n2\n2\n2\n2\n1\n1\n1\n1\n2\n2\n1\n2\n2\n1\n1\n1\n2\n1\n2\n2\n1\n1\n2\n1\n1\n1\n2\n2\n1",
"output": "NO"
},
{
"input": "100\n99\n99\n100\n99\n99\n100\n100\n100\n99\n100\n99\n99\n100\n99\n99\n99\n99\n99\n99\n100\n100\n100\n99\n100\n100\n99\n100\n99\n100\n100\n99\n100\n99\n99\n99\n100\n99\n10\n99\n100\n100\n100\n99\n100\n100\n100\n100\n100\n100\n100\n99\n100\n100\n100\n99\n99\n100\n99\n100\n99\n100\n100\n99\n99\n99\n99\n100\n99\n100\n100\n100\n100\n100\n100\n99\n99\n100\n100\n99\n99\n99\n99\n99\n99\n100\n99\n99\n100\n100\n99\n100\n99\n99\n100\n99\n99\n99\n99\n100\n100",
"output": "NO"
},
{
"input": "100\n29\n43\n43\n29\n43\n29\n29\n29\n43\n29\n29\n29\n29\n43\n29\n29\n29\n29\n43\n29\n29\n29\n43\n29\n29\n29\n43\n43\n43\n43\n43\n43\n29\n29\n43\n43\n43\n29\n43\n43\n43\n29\n29\n29\n43\n29\n29\n29\n43\n43\n43\n43\n29\n29\n29\n29\n43\n29\n43\n43\n29\n29\n43\n43\n29\n29\n95\n29\n29\n29\n43\n43\n29\n29\n29\n29\n29\n43\n43\n43\n43\n29\n29\n43\n43\n43\n43\n43\n43\n29\n43\n43\n43\n43\n43\n43\n29\n43\n29\n43",
"output": "NO"
},
{
"input": "100\n98\n98\n98\n88\n88\n88\n88\n98\n98\n88\n98\n88\n98\n88\n88\n88\n88\n88\n98\n98\n88\n98\n98\n98\n88\n88\n88\n98\n98\n88\n88\n88\n98\n88\n98\n88\n98\n88\n88\n98\n98\n98\n88\n88\n98\n98\n88\n88\n88\n88\n88\n98\n98\n98\n88\n98\n88\n88\n98\n98\n88\n98\n88\n88\n98\n88\n88\n98\n27\n88\n88\n88\n98\n98\n88\n88\n98\n98\n98\n98\n98\n88\n98\n88\n98\n98\n98\n98\n88\n88\n98\n88\n98\n88\n98\n98\n88\n98\n98\n88",
"output": "NO"
},
{
"input": "100\n50\n1\n1\n50\n50\n50\n50\n1\n50\n100\n50\n50\n50\n100\n1\n100\n1\n100\n50\n50\n50\n50\n50\n1\n50\n1\n100\n1\n1\n50\n100\n50\n50\n100\n50\n50\n100\n1\n50\n50\n100\n1\n1\n50\n1\n100\n50\n50\n100\n100\n1\n100\n1\n50\n100\n50\n50\n1\n1\n50\n100\n50\n100\n100\n100\n50\n50\n1\n1\n50\n100\n1\n50\n100\n100\n1\n50\n50\n50\n100\n50\n50\n100\n1\n50\n50\n50\n50\n1\n50\n50\n50\n50\n1\n50\n50\n100\n1\n50\n100",
"output": "NO"
},
{
"input": "100\n45\n45\n45\n45\n45\n45\n44\n44\n44\n43\n45\n44\n44\n45\n44\n44\n45\n44\n43\n44\n43\n43\n43\n45\n43\n45\n44\n45\n43\n44\n45\n45\n45\n45\n45\n45\n45\n45\n43\n45\n43\n43\n45\n44\n45\n45\n45\n44\n45\n45\n45\n45\n45\n45\n44\n43\n45\n45\n43\n44\n45\n45\n45\n45\n44\n45\n45\n45\n43\n43\n44\n44\n43\n45\n43\n45\n45\n45\n44\n44\n43\n43\n44\n44\n44\n43\n45\n43\n44\n43\n45\n43\n43\n45\n45\n44\n45\n43\n43\n45",
"output": "NO"
},
{
"input": "100\n12\n12\n97\n15\n97\n12\n15\n97\n12\n97\n12\n12\n97\n12\n15\n12\n12\n15\n12\n12\n97\n12\n12\n15\n15\n12\n97\n15\n12\n97\n15\n12\n12\n15\n15\n15\n97\n15\n97\n12\n12\n12\n12\n12\n97\n12\n97\n12\n15\n15\n12\n15\n12\n15\n12\n12\n12\n12\n12\n12\n12\n12\n97\n97\n12\n12\n97\n12\n97\n97\n15\n97\n12\n97\n97\n12\n12\n12\n97\n97\n15\n12\n12\n15\n12\n15\n97\n97\n12\n15\n12\n12\n97\n12\n15\n15\n15\n15\n12\n12",
"output": "NO"
},
{
"input": "12\n2\n3\n1\n3\n3\n1\n2\n1\n2\n1\n3\n2",
"output": "NO"
},
{
"input": "48\n99\n98\n100\n100\n99\n100\n99\n100\n100\n98\n99\n98\n98\n99\n98\n99\n98\n100\n100\n98\n100\n98\n99\n100\n98\n99\n98\n99\n99\n100\n98\n99\n99\n98\n100\n99\n98\n99\n98\n100\n100\n100\n99\n98\n99\n98\n100\n100",
"output": "NO"
},
{
"input": "4\n1\n3\n3\n3",
"output": "NO"
},
{
"input": "6\n1\n1\n1\n1\n2\n2",
"output": "NO"
},
{
"input": "4\n1\n1\n1\n2",
"output": "NO"
},
{
"input": "4\n1\n2\n2\n2",
"output": "NO"
},
{
"input": "4\n1\n2\n3\n4",
"output": "NO"
},
{
"input": "8\n1\n1\n2\n2\n3\n3\n4\n4",
"output": "NO"
},
{
"input": "4\n1\n3\n2\n4",
"output": "NO"
},
{
"input": "4\n10\n10\n10\n20",
"output": "NO"
},
{
"input": "4\n11\n12\n13\n13",
"output": "NO"
},
{
"input": "4\n1\n1\n1\n3",
"output": "NO"
},
{
"input": "6\n1\n1\n2\n2\n2\n2",
"output": "NO"
},
{
"input": "10\n1\n1\n2\n2\n2\n3\n3\n4\n4\n4",
"output": "NO"
}
] | 1,506,794,749
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 28
| 62
| 0
|
n = int(input())
A = set()
for _ in range(n):
A.add(int(input()))
if len(A) == 2:
print('YES')
A = list(A)
print(A[0], A[1])
else:
print('NO')
|
Title: Fair Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya and Vasya decided to play a game. They have *n* cards (*n* is an even number). A single integer is written on each card.
Before the game Petya will choose an integer and after that Vasya will choose another integer (different from the number that Petya chose). During the game each player takes all the cards with number he chose. For example, if Petya chose number 5 before the game he will take all cards on which 5 is written and if Vasya chose number 10 before the game he will take all cards on which 10 is written.
The game is considered fair if Petya and Vasya can take all *n* cards, and the number of cards each player gets is the same.
Determine whether Petya and Vasya can choose integer numbers before the game so that the game is fair.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=100) — number of cards. It is guaranteed that *n* is an even number.
The following *n* lines contain a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (one integer per line, 1<=≤<=*a**i*<=≤<=100) — numbers written on the *n* cards.
Output Specification:
If it is impossible for Petya and Vasya to choose numbers in such a way that the game will be fair, print "NO" (without quotes) in the first line. In this case you should not print anything more.
In the other case print "YES" (without quotes) in the first line. In the second line print two distinct integers — number that Petya should choose and the number that Vasya should choose to make the game fair. If there are several solutions, print any of them.
Demo Input:
['4\n11\n27\n27\n11\n', '2\n6\n6\n', '6\n10\n20\n30\n20\n10\n20\n', '6\n1\n1\n2\n2\n3\n3\n']
Demo Output:
['YES\n11 27\n', 'NO\n', 'NO\n', 'NO\n']
Note:
In the first example the game will be fair if, for example, Petya chooses number 11, and Vasya chooses number 27. Then the will take all cards — Petya will take cards 1 and 4, and Vasya will take cards 2 and 3. Thus, each of them will take exactly two cards.
In the second example fair game is impossible because the numbers written on the cards are equal, but the numbers that Petya and Vasya should choose should be distinct.
In the third example it is impossible to take all cards. Petya and Vasya can take at most five cards — for example, Petya can choose number 10 and Vasya can choose number 20. But for the game to be fair it is necessary to take 6 cards.
|
```python
n = int(input())
A = set()
for _ in range(n):
A.add(int(input()))
if len(A) == 2:
print('YES')
A = list(A)
print(A[0], A[1])
else:
print('NO')
```
| 0
|
|
855
|
B
|
Marvolo Gaunt's Ring
|
PROGRAMMING
| 1,500
|
[
"brute force",
"data structures",
"dp"
] | null | null |
Professor Dumbledore is helping Harry destroy the Horcruxes. He went to Gaunt Shack as he suspected a Horcrux to be present there. He saw Marvolo Gaunt's Ring and identified it as a Horcrux. Although he destroyed it, he is still affected by its curse. Professor Snape is helping Dumbledore remove the curse. For this, he wants to give Dumbledore exactly *x* drops of the potion he made.
Value of *x* is calculated as maximum of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* for given *p*,<=*q*,<=*r* and array *a*1,<=*a*2,<=... *a**n* such that 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*. Help Snape find the value of *x*. Do note that the value of *x* may be negative.
|
First line of input contains 4 integers *n*,<=*p*,<=*q*,<=*r* (<=-<=109<=≤<=*p*,<=*q*,<=*r*<=≤<=109,<=1<=≤<=*n*<=≤<=105).
Next line of input contains *n* space separated integers *a*1,<=*a*2,<=... *a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
|
Output a single integer the maximum value of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* that can be obtained provided 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*.
|
[
"5 1 2 3\n1 2 3 4 5\n",
"5 1 2 -3\n-1 -2 -3 -4 -5\n"
] |
[
"30\n",
"12\n"
] |
In the first sample case, we can take *i* = *j* = *k* = 5, thus making the answer as 1·5 + 2·5 + 3·5 = 30.
In second sample case, selecting *i* = *j* = 1 and *k* = 5 gives the answer 12.
| 1,000
|
[
{
"input": "5 1 2 3\n1 2 3 4 5",
"output": "30"
},
{
"input": "5 1 2 -3\n-1 -2 -3 -4 -5",
"output": "12"
},
{
"input": "5 886327859 82309257 -68295239\n-731225382 354766539 -48222231 -474691998 360965777",
"output": "376059240645059046"
},
{
"input": "4 -96405765 -495906217 625385006\n-509961652 392159235 -577128498 -744548876",
"output": "547306902373544674"
},
{
"input": "43 959134961 -868367850 142426380\n921743429 63959718 -797293233 122041422 -407576197 700139744 299598010 168207043 362252658 591926075 941946099 812263640 -76679927 -824267725 89529990 -73303355 83596189 -982699817 -235197848 654773327 125211479 -497091570 -2301804 203486596 -126652024 309810546 -581289415 -740125230 64425927 -501018049 304730559 34930193 -762964086 723645139 -826821494 495947907 816331024 9932423 -876541603 -782692568 322360800 841436938 40787162",
"output": "1876641179289775029"
},
{
"input": "1 0 0 0\n0",
"output": "0"
},
{
"input": "1 1000000000 1000000000 1000000000\n1000000000",
"output": "3000000000000000000"
},
{
"input": "1 -1000000000 -1000000000 1000000000\n1000000000",
"output": "-1000000000000000000"
},
{
"input": "1 -1000000000 -1000000000 -1000000000\n1000000000",
"output": "-3000000000000000000"
},
{
"input": "3 1000000000 1000000000 1000000000\n-1000000000 -1000000000 -1000000000",
"output": "-3000000000000000000"
},
{
"input": "1 1 1 1\n-1",
"output": "-3"
},
{
"input": "1 -1 -1 -1\n1",
"output": "-3"
},
{
"input": "1 1000000000 1000000000 1000000000\n-1000000000",
"output": "-3000000000000000000"
},
{
"input": "1 1 2 3\n-1",
"output": "-6"
},
{
"input": "3 -1000000000 -1000000000 -1000000000\n1000000000 1000000000 1000000000",
"output": "-3000000000000000000"
},
{
"input": "2 -1000000000 -1000000000 -1000000000\n1000000000 1000000000",
"output": "-3000000000000000000"
},
{
"input": "3 1 1 1\n-1 -1 -1",
"output": "-3"
},
{
"input": "1 -1000000000 0 0\n1000000000",
"output": "-1000000000000000000"
},
{
"input": "1 -100 -100 -100\n100",
"output": "-30000"
},
{
"input": "5 -1000000000 -1000000000 -1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "-3000000000000000000"
},
{
"input": "1 999999999 999999999 999999999\n-999999999",
"output": "-2999999994000000003"
},
{
"input": "3 -1000000000 -1000000000 1\n1000000000 1000000000 1000000000",
"output": "-1999999999000000000"
},
{
"input": "3 -2 3 -2\n1 2 1",
"output": "2"
},
{
"input": "2 1 -1 1\n1 -1",
"output": "1"
},
{
"input": "1 -1000000000 1 -1000000000\n1000000000",
"output": "-1999999999000000000"
},
{
"input": "1 1000000000 1000000000 -1000000000\n-1000000000",
"output": "-1000000000000000000"
},
{
"input": "1 -1000000000 -1000000000 0\n1000000000",
"output": "-2000000000000000000"
}
] | 1,584,062,855
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 108
| 307,200
|
#!/usr/bin/python3
# -*- coding: UTF-8 -*-
from math import inf
# Função que lê uma quantidade qualquer de inteiros em uma só linha
read_int = lambda string: list(map(int, string.split()))
def max_sum(k, arr, y):
x = -inf
for i in range(len(arr)):
x = max(x, k * arr[i] + y)
return x
def main():
n, p, q, r = read_int(input())
arr = read_int(input())
x1 = max_sum(p, arr, 0)
x2 = max_sum(q, arr, x1)
x3 = max_sum(r, arr, x2)
print(x3)
if __name__ == '__main__':
main()
|
Title: Marvolo Gaunt's Ring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor Dumbledore is helping Harry destroy the Horcruxes. He went to Gaunt Shack as he suspected a Horcrux to be present there. He saw Marvolo Gaunt's Ring and identified it as a Horcrux. Although he destroyed it, he is still affected by its curse. Professor Snape is helping Dumbledore remove the curse. For this, he wants to give Dumbledore exactly *x* drops of the potion he made.
Value of *x* is calculated as maximum of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* for given *p*,<=*q*,<=*r* and array *a*1,<=*a*2,<=... *a**n* such that 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*. Help Snape find the value of *x*. Do note that the value of *x* may be negative.
Input Specification:
First line of input contains 4 integers *n*,<=*p*,<=*q*,<=*r* (<=-<=109<=≤<=*p*,<=*q*,<=*r*<=≤<=109,<=1<=≤<=*n*<=≤<=105).
Next line of input contains *n* space separated integers *a*1,<=*a*2,<=... *a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Output a single integer the maximum value of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* that can be obtained provided 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*.
Demo Input:
['5 1 2 3\n1 2 3 4 5\n', '5 1 2 -3\n-1 -2 -3 -4 -5\n']
Demo Output:
['30\n', '12\n']
Note:
In the first sample case, we can take *i* = *j* = *k* = 5, thus making the answer as 1·5 + 2·5 + 3·5 = 30.
In second sample case, selecting *i* = *j* = 1 and *k* = 5 gives the answer 12.
|
```python
#!/usr/bin/python3
# -*- coding: UTF-8 -*-
from math import inf
# Função que lê uma quantidade qualquer de inteiros em uma só linha
read_int = lambda string: list(map(int, string.split()))
def max_sum(k, arr, y):
x = -inf
for i in range(len(arr)):
x = max(x, k * arr[i] + y)
return x
def main():
n, p, q, r = read_int(input())
arr = read_int(input())
x1 = max_sum(p, arr, 0)
x2 = max_sum(q, arr, x1)
x3 = max_sum(r, arr, x2)
print(x3)
if __name__ == '__main__':
main()
```
| 0
|
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,693,824,981
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 14
| 92
| 0
|
#Представте себя в яблонинивем саду лежашем на траве, слева обдувает прохладный ветерок, а ты в ожидании своего нового вертолёта#
n=list(input())
for i in n:
if i not in 'aeiouAEIOU':
print('.'+i.lower(),end='')
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
#Представте себя в яблонинивем саду лежашем на траве, слева обдувает прохладный ветерок, а ты в ожидании своего нового вертолёта#
n=list(input())
for i in n:
if i not in 'aeiouAEIOU':
print('.'+i.lower(),end='')
```
| 0
|
|
350
|
B
|
Resort
|
PROGRAMMING
| 1,500
|
[
"graphs"
] | null | null |
Valera's finally decided to go on holiday! He packed up and headed for a ski resort.
Valera's fancied a ski trip but he soon realized that he could get lost in this new place. Somebody gave him a useful hint: the resort has *n* objects (we will consider the objects indexed in some way by integers from 1 to *n*), each object is either a hotel or a mountain.
Valera has also found out that the ski resort had multiple ski tracks. Specifically, for each object *v*, the resort has at most one object *u*, such that there is a ski track built from object *u* to object *v*. We also know that no hotel has got a ski track leading from the hotel to some object.
Valera is afraid of getting lost on the resort. So he wants you to come up with a path he would walk along. The path must consist of objects *v*1,<=*v*2,<=...,<=*v**k* (*k*<=≥<=1) and meet the following conditions:
1. Objects with numbers *v*1,<=*v*2,<=...,<=*v**k*<=-<=1 are mountains and the object with number *v**k* is the hotel. 1. For any integer *i* (1<=≤<=*i*<=<<=*k*), there is exactly one ski track leading from object *v**i*. This track goes to object *v**i*<=+<=1. 1. The path contains as many objects as possible (*k* is maximal).
Help Valera. Find such path that meets all the criteria of our hero!
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of objects.
The second line contains *n* space-separated integers *type*1,<=*type*2,<=...,<=*type**n* — the types of the objects. If *type**i* equals zero, then the *i*-th object is the mountain. If *type**i* equals one, then the *i*-th object is the hotel. It is guaranteed that at least one object is a hotel.
The third line of the input contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*) — the description of the ski tracks. If number *a**i* equals zero, then there is no such object *v*, that has a ski track built from *v* to *i*. If number *a**i* doesn't equal zero, that means that there is a track built from object *a**i* to object *i*.
|
In the first line print *k* — the maximum possible path length for Valera. In the second line print *k* integers *v*1,<=*v*2,<=...,<=*v**k* — the path. If there are multiple solutions, you can print any of them.
|
[
"5\n0 0 0 0 1\n0 1 2 3 4\n",
"5\n0 0 1 0 1\n0 1 2 2 4\n",
"4\n1 0 0 0\n2 3 4 2\n"
] |
[
"5\n1 2 3 4 5\n",
"2\n4 5\n",
"1\n1\n"
] |
none
| 1,000
|
[
{
"input": "5\n0 0 0 0 1\n0 1 2 3 4",
"output": "5\n1 2 3 4 5"
},
{
"input": "5\n0 0 1 0 1\n0 1 2 2 4",
"output": "2\n4 5"
},
{
"input": "4\n1 0 0 0\n2 3 4 2",
"output": "1\n1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 1\n4 0 8 4 7 8 5 5 7 2",
"output": "2\n2 10"
},
{
"input": "50\n0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 1 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 1 1 0 0 0 1 0\n28 4 33 22 4 35 36 31 42 25 50 33 25 36 18 23 23 28 43 3 18 31 1 2 15 22 40 43 29 32 28 35 18 27 48 40 14 36 27 50 40 5 48 14 36 24 32 33 26 50",
"output": "2\n3 20"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0\n86 12 47 46 45 31 20 47 58 79 23 70 35 72 37 20 16 64 46 87 57 7 84 72 70 3 14 40 17 42 30 99 12 20 38 98 14 40 4 83 10 15 47 30 83 58 12 7 97 46 17 6 41 13 87 37 36 12 7 25 26 35 69 13 18 5 9 53 72 28 13 51 5 57 14 64 28 25 91 96 57 69 9 12 97 7 56 42 31 15 88 16 41 88 86 13 89 81 3 42",
"output": "1\n44"
},
{
"input": "10\n1 0 0 0 0 0 0 0 0 0\n6 2 7 8 2 9 0 5 4 2",
"output": "6\n5 8 4 9 6 1"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n38 2 49 55 6 42 12 100 25 69 85 76 13 22 78 73 37 64 5 21 0 23 61 87 4 16 44 3 98 54 1 91 18 26 82 24 18 50 95 21 75 97 51 9 67 73 51 19 63 92 27 82 8 7 20 84 2 93 40 11 39 80 58 85 74 48 72 78 34 33 31 65 46 71 32 36 33 88 47 4 66 84 16 27 16 14 90 16 79 41 99 30 57 73 28 89 45 81 86 29",
"output": "52\n57 93 58 63 49 3 28 95 39 61 23 22 14 86 99 91 32 75 41 90 87 24 36 76 12 7 54 30 92 50 38 1 31 71 74 65 72 67 45 97 42 6 5 19 48 66 81 98 29 100 8 53"
},
{
"input": "2\n1 1\n0 0",
"output": "1\n1"
},
{
"input": "1\n1\n0",
"output": "1\n1"
}
] | 1,603,159,632
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
#include <vector>
using namespace std;
pair<int, vector<int>> getAns(int f, int *paths, bool *types, bool *more_than_one) {
vector<int> res;
if (types[f]) {
res.push_back(f);
return make_pair(1, res);
}
if (more_than_one[f] || paths[f] == -1) {
return make_pair(0, res);
}
pair<int, vector<int>> nextAns = getAns(paths[f], paths, types, more_than_one);
if (nextAns.first == 0) return make_pair(0, res);
else {
res.push_back(f);
for (vector<int>::iterator i=nextAns.second.begin(); i<nextAns.second.end(); i++) res.push_back(*i);
return make_pair(nextAns.first+1, res);
}
}
int main() {
int n, f, max_length=0;
vector<int> max_path;
cin >> n;
int paths[n];
bool types[n], more_than_one[n];
for (int _=0; _<n; _++) {
paths[_] = -1;
more_than_one[_] = false;
cin >> types[_];
}
for (int i=0; i<n; i++) {
cin >> f;
f -= 1;
if (paths[f] >= 0) more_than_one[f] = true;
paths[f] = i;
}
for (int i=0; i<n; i++) {
pair<int, vector<int>> res = getAns(i, paths, types, more_than_one);
if (res.first > max_length) {
max_length = res.first;
max_path = res.second;
}
}
cout << max_length << '\n';
for (vector<int>::iterator i=max_path.begin(); i<max_path.end(); i++) {
cout << *i+1 << ' ';
}
}
|
Title: Resort
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera's finally decided to go on holiday! He packed up and headed for a ski resort.
Valera's fancied a ski trip but he soon realized that he could get lost in this new place. Somebody gave him a useful hint: the resort has *n* objects (we will consider the objects indexed in some way by integers from 1 to *n*), each object is either a hotel or a mountain.
Valera has also found out that the ski resort had multiple ski tracks. Specifically, for each object *v*, the resort has at most one object *u*, such that there is a ski track built from object *u* to object *v*. We also know that no hotel has got a ski track leading from the hotel to some object.
Valera is afraid of getting lost on the resort. So he wants you to come up with a path he would walk along. The path must consist of objects *v*1,<=*v*2,<=...,<=*v**k* (*k*<=≥<=1) and meet the following conditions:
1. Objects with numbers *v*1,<=*v*2,<=...,<=*v**k*<=-<=1 are mountains and the object with number *v**k* is the hotel. 1. For any integer *i* (1<=≤<=*i*<=<<=*k*), there is exactly one ski track leading from object *v**i*. This track goes to object *v**i*<=+<=1. 1. The path contains as many objects as possible (*k* is maximal).
Help Valera. Find such path that meets all the criteria of our hero!
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of objects.
The second line contains *n* space-separated integers *type*1,<=*type*2,<=...,<=*type**n* — the types of the objects. If *type**i* equals zero, then the *i*-th object is the mountain. If *type**i* equals one, then the *i*-th object is the hotel. It is guaranteed that at least one object is a hotel.
The third line of the input contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*) — the description of the ski tracks. If number *a**i* equals zero, then there is no such object *v*, that has a ski track built from *v* to *i*. If number *a**i* doesn't equal zero, that means that there is a track built from object *a**i* to object *i*.
Output Specification:
In the first line print *k* — the maximum possible path length for Valera. In the second line print *k* integers *v*1,<=*v*2,<=...,<=*v**k* — the path. If there are multiple solutions, you can print any of them.
Demo Input:
['5\n0 0 0 0 1\n0 1 2 3 4\n', '5\n0 0 1 0 1\n0 1 2 2 4\n', '4\n1 0 0 0\n2 3 4 2\n']
Demo Output:
['5\n1 2 3 4 5\n', '2\n4 5\n', '1\n1\n']
Note:
none
|
```python
#include <iostream>
#include <vector>
using namespace std;
pair<int, vector<int>> getAns(int f, int *paths, bool *types, bool *more_than_one) {
vector<int> res;
if (types[f]) {
res.push_back(f);
return make_pair(1, res);
}
if (more_than_one[f] || paths[f] == -1) {
return make_pair(0, res);
}
pair<int, vector<int>> nextAns = getAns(paths[f], paths, types, more_than_one);
if (nextAns.first == 0) return make_pair(0, res);
else {
res.push_back(f);
for (vector<int>::iterator i=nextAns.second.begin(); i<nextAns.second.end(); i++) res.push_back(*i);
return make_pair(nextAns.first+1, res);
}
}
int main() {
int n, f, max_length=0;
vector<int> max_path;
cin >> n;
int paths[n];
bool types[n], more_than_one[n];
for (int _=0; _<n; _++) {
paths[_] = -1;
more_than_one[_] = false;
cin >> types[_];
}
for (int i=0; i<n; i++) {
cin >> f;
f -= 1;
if (paths[f] >= 0) more_than_one[f] = true;
paths[f] = i;
}
for (int i=0; i<n; i++) {
pair<int, vector<int>> res = getAns(i, paths, types, more_than_one);
if (res.first > max_length) {
max_length = res.first;
max_path = res.second;
}
}
cout << max_length << '\n';
for (vector<int>::iterator i=max_path.begin(); i<max_path.end(); i++) {
cout << *i+1 << ' ';
}
}
```
| -1
|
|
18
|
A
|
Triangle
|
PROGRAMMING
| 1,500
|
[
"brute force",
"geometry"
] |
A. Triangle
|
2
|
64
|
At a geometry lesson Bob learnt that a triangle is called right-angled if it is nondegenerate and one of its angles is right. Bob decided to draw such a triangle immediately: on a sheet of paper he drew three points with integer coordinates, and joined them with segments of straight lines, then he showed the triangle to Peter. Peter said that Bob's triangle is not right-angled, but is almost right-angled: the triangle itself is not right-angled, but it is possible to move one of the points exactly by distance 1 so, that all the coordinates remain integer, and the triangle become right-angled. Bob asks you to help him and find out if Peter tricks him. By the given coordinates of the triangle you should find out if it is right-angled, almost right-angled, or neither of these.
|
The first input line contains 6 space-separated integers *x*1,<=*y*1,<=*x*2,<=*y*2,<=*x*3,<=*y*3 — coordinates of the triangle's vertices. All the coordinates are integer and don't exceed 100 in absolute value. It's guaranteed that the triangle is nondegenerate, i.e. its total area is not zero.
|
If the given triangle is right-angled, output RIGHT, if it is almost right-angled, output ALMOST, and if it is neither of these, output NEITHER.
|
[
"0 0 2 0 0 1\n",
"2 3 4 5 6 6\n",
"-1 0 2 0 0 1\n"
] |
[
"RIGHT\n",
"NEITHER\n",
"ALMOST\n"
] |
none
| 0
|
[
{
"input": "0 0 2 0 0 1",
"output": "RIGHT"
},
{
"input": "2 3 4 5 6 6",
"output": "NEITHER"
},
{
"input": "-1 0 2 0 0 1",
"output": "ALMOST"
},
{
"input": "27 74 85 23 100 99",
"output": "NEITHER"
},
{
"input": "-97 -19 17 62 30 -76",
"output": "NEITHER"
},
{
"input": "28 -15 86 32 98 -41",
"output": "NEITHER"
},
{
"input": "-66 24 8 -29 17 62",
"output": "NEITHER"
},
{
"input": "-83 40 -80 52 -71 43",
"output": "NEITHER"
},
{
"input": "-88 67 -62 37 -49 75",
"output": "NEITHER"
},
{
"input": "58 45 6 22 13 79",
"output": "NEITHER"
},
{
"input": "75 86 -82 89 -37 -35",
"output": "NEITHER"
},
{
"input": "34 74 -2 -95 63 -33",
"output": "NEITHER"
},
{
"input": "-7 63 78 74 -39 -30",
"output": "NEITHER"
},
{
"input": "-49 -99 7 92 61 -28",
"output": "NEITHER"
},
{
"input": "-90 90 87 -92 -40 -26",
"output": "NEITHER"
},
{
"input": "-100 -100 100 -100 0 73",
"output": "NEITHER"
},
{
"input": "39 22 94 25 69 -23",
"output": "NEITHER"
},
{
"input": "100 100 -100 100 1 -73",
"output": "NEITHER"
},
{
"input": "0 0 0 1 1 0",
"output": "RIGHT"
},
{
"input": "-100 -100 100 100 -100 100",
"output": "RIGHT"
},
{
"input": "29 83 35 35 74 65",
"output": "NEITHER"
},
{
"input": "28 -15 86 32 -19 43",
"output": "RIGHT"
},
{
"input": "-28 12 -97 67 -83 -57",
"output": "RIGHT"
},
{
"input": "-83 40 -80 52 -79 39",
"output": "RIGHT"
},
{
"input": "30 8 49 13 25 27",
"output": "RIGHT"
},
{
"input": "23 6 63 -40 69 46",
"output": "RIGHT"
},
{
"input": "49 -7 19 -76 26 3",
"output": "RIGHT"
},
{
"input": "0 0 1 0 2 1",
"output": "ALMOST"
},
{
"input": "0 0 1 0 3 1",
"output": "ALMOST"
},
{
"input": "0 0 1 0 2 2",
"output": "ALMOST"
},
{
"input": "0 0 1 0 4 1",
"output": "NEITHER"
},
{
"input": "0 0 1 0 100 1",
"output": "NEITHER"
},
{
"input": "60 4 90 -53 32 -12",
"output": "ALMOST"
},
{
"input": "52 -34 -37 -63 23 54",
"output": "ALMOST"
},
{
"input": "39 22 95 25 42 -33",
"output": "ALMOST"
},
{
"input": "-10 -11 62 6 -12 -3",
"output": "ALMOST"
},
{
"input": "22 -15 -24 77 -69 -60",
"output": "ALMOST"
},
{
"input": "99 85 90 87 64 -20",
"output": "ALMOST"
},
{
"input": "-50 -37 -93 -6 -80 -80",
"output": "ALMOST"
},
{
"input": "4 -13 4 -49 -24 -13",
"output": "RIGHT"
},
{
"input": "0 -3 -3 -10 4 -7",
"output": "NEITHER"
},
{
"input": "-45 -87 -34 -79 -60 -62",
"output": "NEITHER"
},
{
"input": "-67 49 89 -76 -37 87",
"output": "NEITHER"
},
{
"input": "22 32 -33 -30 -18 68",
"output": "NEITHER"
},
{
"input": "36 1 -17 -54 -19 55",
"output": "ALMOST"
},
{
"input": "55 44 15 14 23 83",
"output": "NEITHER"
},
{
"input": "-19 0 -89 -54 25 -57",
"output": "NEITHER"
},
{
"input": "69 -45 1 11 56 -63",
"output": "NEITHER"
},
{
"input": "72 68 56 72 33 -88",
"output": "RIGHT"
},
{
"input": "59 86 74 -49 77 88",
"output": "RIGHT"
},
{
"input": "-50 0 0 50 0 -50",
"output": "RIGHT"
},
{
"input": "-50 0 0 50 0 -51",
"output": "ALMOST"
},
{
"input": "-50 0 0 50 0 -49",
"output": "ALMOST"
},
{
"input": "-50 0 0 50 1 -50",
"output": "ALMOST"
},
{
"input": "-50 0 0 50 -1 -50",
"output": "ALMOST"
},
{
"input": "-50 0 0 49 0 -50",
"output": "ALMOST"
},
{
"input": "-50 0 0 51 0 -50",
"output": "ALMOST"
},
{
"input": "-50 0 1 50 0 -50",
"output": "ALMOST"
},
{
"input": "-50 0 -1 50 0 -50",
"output": "ALMOST"
},
{
"input": "-50 1 0 50 0 -50",
"output": "ALMOST"
},
{
"input": "-50 -1 0 50 0 -50",
"output": "ALMOST"
},
{
"input": "-51 0 0 50 0 -50",
"output": "ALMOST"
},
{
"input": "-49 0 0 50 0 -50",
"output": "ALMOST"
}
] | 1,691,252,200
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
def triangle(pt):
a = (pt[0] - pt[2]) **2 + (pt[1] - pt[3]) **2
b = (pt[0] - pt[4]) **2 + (pt[1] - pt[5]) **2
c = (pt[2] - pt[4]) **2 + (pt[3] - pt[5]) **2
return a and b and c and (a + b == c or a + c == b or b + c == a)
pt = list(map(int, input().strip().split()))
if triangle(point):
print('RIGHT')
return
for i in range(6):
p = point[i]
point[i] = p + 1
if triangle(point):
print('ALMOST')
return
point[i] = p - 1
if triangle(point):
print('ALMOST')
return
point[i] = p
print('NEITHER')
|
Title: Triangle
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
At a geometry lesson Bob learnt that a triangle is called right-angled if it is nondegenerate and one of its angles is right. Bob decided to draw such a triangle immediately: on a sheet of paper he drew three points with integer coordinates, and joined them with segments of straight lines, then he showed the triangle to Peter. Peter said that Bob's triangle is not right-angled, but is almost right-angled: the triangle itself is not right-angled, but it is possible to move one of the points exactly by distance 1 so, that all the coordinates remain integer, and the triangle become right-angled. Bob asks you to help him and find out if Peter tricks him. By the given coordinates of the triangle you should find out if it is right-angled, almost right-angled, or neither of these.
Input Specification:
The first input line contains 6 space-separated integers *x*1,<=*y*1,<=*x*2,<=*y*2,<=*x*3,<=*y*3 — coordinates of the triangle's vertices. All the coordinates are integer and don't exceed 100 in absolute value. It's guaranteed that the triangle is nondegenerate, i.e. its total area is not zero.
Output Specification:
If the given triangle is right-angled, output RIGHT, if it is almost right-angled, output ALMOST, and if it is neither of these, output NEITHER.
Demo Input:
['0 0 2 0 0 1\n', '2 3 4 5 6 6\n', '-1 0 2 0 0 1\n']
Demo Output:
['RIGHT\n', 'NEITHER\n', 'ALMOST\n']
Note:
none
|
```python
def triangle(pt):
a = (pt[0] - pt[2]) **2 + (pt[1] - pt[3]) **2
b = (pt[0] - pt[4]) **2 + (pt[1] - pt[5]) **2
c = (pt[2] - pt[4]) **2 + (pt[3] - pt[5]) **2
return a and b and c and (a + b == c or a + c == b or b + c == a)
pt = list(map(int, input().strip().split()))
if triangle(point):
print('RIGHT')
return
for i in range(6):
p = point[i]
point[i] = p + 1
if triangle(point):
print('ALMOST')
return
point[i] = p - 1
if triangle(point):
print('ALMOST')
return
point[i] = p
print('NEITHER')
```
| -1
|
329
|
A
|
Purification
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"greedy"
] | null | null |
You are an adventurer currently journeying inside an evil temple. After defeating a couple of weak zombies, you arrived at a square room consisting of tiles forming an *n*<=×<=*n* grid. The rows are numbered 1 through *n* from top to bottom, and the columns are numbered 1 through *n* from left to right. At the far side of the room lies a door locked with evil magical forces. The following inscriptions are written on the door:
Being a very senior adventurer, you immediately realize what this means. You notice that every single cell in the grid are initially evil. You should purify all of these cells.
The only method of tile purification known to you is by casting the "Purification" spell. You cast this spell on a single tile — then, all cells that are located in the same row and all cells that are located in the same column as the selected tile become purified (including the selected tile)! It is allowed to purify a cell more than once.
You would like to purify all *n*<=×<=*n* cells while minimizing the number of times you cast the "Purification" spell. This sounds very easy, but you just noticed that some tiles are particularly more evil than the other tiles. You cannot cast the "Purification" spell on those particularly more evil tiles, not even after they have been purified. They can still be purified if a cell sharing the same row or the same column gets selected by the "Purification" spell.
Please find some way to purify all the cells with the minimum number of spells cast. Print -1 if there is no such way.
|
The first line will contain a single integer *n* (1<=≤<=*n*<=≤<=100). Then, *n* lines follows, each contains *n* characters. The *j*-th character in the *i*-th row represents the cell located at row *i* and column *j*. It will be the character 'E' if it is a particularly more evil cell, and '.' otherwise.
|
If there exists no way to purify all the cells, output -1. Otherwise, if your solution casts *x* "Purification" spells (where *x* is the minimum possible number of spells), output *x* lines. Each line should consist of two integers denoting the row and column numbers of the cell on which you should cast the "Purification" spell.
|
[
"3\n.E.\nE.E\n.E.\n",
"3\nEEE\nE..\nE.E\n",
"5\nEE.EE\nE.EE.\nE...E\n.EE.E\nEE.EE\n"
] |
[
"1 1\n2 2\n3 3\n",
"-1\n",
"3 3\n1 3\n2 2\n4 4\n5 3"
] |
The first example is illustrated as follows. Purple tiles are evil tiles that have not yet been purified. Red tile is the tile on which "Purification" is cast. Yellow tiles are the tiles being purified as a result of the current "Purification" spell. Green tiles are tiles that have been purified previously.
In the second example, it is impossible to purify the cell located at row 1 and column 1.
For the third example:
| 500
|
[
{
"input": "3\n.E.\nE.E\n.E.",
"output": "1 1\n2 2\n3 1"
},
{
"input": "3\nEEE\nE..\nE.E",
"output": "-1"
},
{
"input": "5\nEE.EE\nE.EE.\nE...E\n.EE.E\nEE.EE",
"output": "1 3\n2 2\n3 2\n4 1\n5 3"
},
{
"input": "3\n.EE\n.EE\n.EE",
"output": "1 1\n2 1\n3 1"
},
{
"input": "5\nEE.EE\nEE..E\nEEE..\nEE..E\nEE.EE",
"output": "1 3\n2 3\n3 4\n4 3\n5 3"
},
{
"input": "1\nE",
"output": "-1"
},
{
"input": "8\nE.EEE..E\nEEE.E.E.\nEEE.E.E.\nEE.E.E..\nE...EE..\nE.EE....\n..EE....\nE..E.EE.",
"output": "1 2\n2 4\n3 4\n4 3\n5 2\n6 2\n7 1\n8 2"
},
{
"input": "17\nEE...E.EE.EE..E..\nE.....EE..E..E..E\nEEEE.EEEE..E..E.E\n.E.E.EEE.EEEEE...\nEEEEEEEEEEEEEEEEE\nEE.E.EEEEE.E.....\n..E.EE.EEE.E....E\n.E..E..E...EE.E.E\nEEEE.EEE.E.EEEE..\n...E...EEEEEEE.E.\n..E.E.EE..E.EE..E\n.E..E..E.EEE.....\n.E.....E..EEE.EE.\nEE.E...E.EEEE.EE.\n...EEEEEEE.E..E.E\nEEEE.EEEEEE....E.\n..EEEEEEE....EEEE",
"output": "-1"
},
{
"input": "17\n.EEEEE...EEEE..EE\nEEE..E...EEEEE..E\n.E..E..EEE.EE...E\n.EEE.EE..EE...E..\nE..EEEEEE.EE.....\nE.EE...EEEEEEE.E.\nEEEE....EE..E.EEE\n...EEEEE.E..EE...\nEEE.E..EEEE.EEE..\n..E.E....EEE.....\nEE..E..E.E..EEEEE\nEEE..E.EEEEE.E...\n..EEEEE.E..EE.EE.\nEE.E...E..E..E.EE\n..E.EEE.EE..EE.E.\nE..EE........E.E.\nE..E..EEE.E...E..",
"output": "1 1\n2 4\n3 1\n4 1\n5 2\n6 2\n7 5\n8 1\n9 4\n10 1\n11 3\n12 4\n13 1\n14 3\n15 1\n16 2\n17 2"
},
{
"input": "1\n.",
"output": "1 1"
},
{
"input": "2\nEE\nEE",
"output": "-1"
},
{
"input": "2\n.E\n.E",
"output": "1 1\n2 1"
},
{
"input": "3\n.EE\nEEE\nEEE",
"output": "-1"
},
{
"input": "3\n...\nEEE\n..E",
"output": "1 1\n1 2\n1 3"
},
{
"input": "4\nE...\nE.EE\nEEEE\nEEEE",
"output": "-1"
},
{
"input": "4\n....\nE..E\nEEE.\n.EE.",
"output": "1 1\n2 2\n3 4\n4 1"
},
{
"input": "8\nE..EEEEE\nEE..EEE.\nEE..E...\nEEE.E..E\n.E.EEEE.\nEEEEEEEE\n.EEEE.EE\n.EE.E.E.",
"output": "-1"
},
{
"input": "3\nE..\nEEE\nE..",
"output": "-1"
},
{
"input": "4\nEEEE\n..E.\n..E.\n..E.",
"output": "-1"
},
{
"input": "3\n..E\n.EE\n.EE",
"output": "1 1\n2 1\n3 1"
},
{
"input": "6\n.EEEEE\n.EEEEE\n......\n......\n......\nEEEEEE",
"output": "1 1\n3 2\n3 3\n3 4\n3 5\n3 6"
}
] | 1,625,331,984
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 65
| 312
| 2,560,000
|
import traceback
import math
from collections import defaultdict
from functools import lru_cache
def main():
N = int(input())
grid = []
for _ in range(N):
s = input()
grid.append(s)
if all('.' in [grid[i][j] for j in range(N)] for i in range(N)):
for i in range(N):
for j in range(N):
if grid[i][j] == '.':
print(i+1, j+1)
break
elif all('.' in [grid[i][j] for i in range(N)] for j in range(N)):
for j in range(N):
for i in range(N):
if grid[i][j] == '.':
print(i+1, j+1)
break
else:
print(-1)
try:
ans = main()
# print(ans)
except Exception as e:
traceback.print_exc()
|
Title: Purification
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are an adventurer currently journeying inside an evil temple. After defeating a couple of weak zombies, you arrived at a square room consisting of tiles forming an *n*<=×<=*n* grid. The rows are numbered 1 through *n* from top to bottom, and the columns are numbered 1 through *n* from left to right. At the far side of the room lies a door locked with evil magical forces. The following inscriptions are written on the door:
Being a very senior adventurer, you immediately realize what this means. You notice that every single cell in the grid are initially evil. You should purify all of these cells.
The only method of tile purification known to you is by casting the "Purification" spell. You cast this spell on a single tile — then, all cells that are located in the same row and all cells that are located in the same column as the selected tile become purified (including the selected tile)! It is allowed to purify a cell more than once.
You would like to purify all *n*<=×<=*n* cells while minimizing the number of times you cast the "Purification" spell. This sounds very easy, but you just noticed that some tiles are particularly more evil than the other tiles. You cannot cast the "Purification" spell on those particularly more evil tiles, not even after they have been purified. They can still be purified if a cell sharing the same row or the same column gets selected by the "Purification" spell.
Please find some way to purify all the cells with the minimum number of spells cast. Print -1 if there is no such way.
Input Specification:
The first line will contain a single integer *n* (1<=≤<=*n*<=≤<=100). Then, *n* lines follows, each contains *n* characters. The *j*-th character in the *i*-th row represents the cell located at row *i* and column *j*. It will be the character 'E' if it is a particularly more evil cell, and '.' otherwise.
Output Specification:
If there exists no way to purify all the cells, output -1. Otherwise, if your solution casts *x* "Purification" spells (where *x* is the minimum possible number of spells), output *x* lines. Each line should consist of two integers denoting the row and column numbers of the cell on which you should cast the "Purification" spell.
Demo Input:
['3\n.E.\nE.E\n.E.\n', '3\nEEE\nE..\nE.E\n', '5\nEE.EE\nE.EE.\nE...E\n.EE.E\nEE.EE\n']
Demo Output:
['1 1\n2 2\n3 3\n', '-1\n', '3 3\n1 3\n2 2\n4 4\n5 3']
Note:
The first example is illustrated as follows. Purple tiles are evil tiles that have not yet been purified. Red tile is the tile on which "Purification" is cast. Yellow tiles are the tiles being purified as a result of the current "Purification" spell. Green tiles are tiles that have been purified previously.
In the second example, it is impossible to purify the cell located at row 1 and column 1.
For the third example:
|
```python
import traceback
import math
from collections import defaultdict
from functools import lru_cache
def main():
N = int(input())
grid = []
for _ in range(N):
s = input()
grid.append(s)
if all('.' in [grid[i][j] for j in range(N)] for i in range(N)):
for i in range(N):
for j in range(N):
if grid[i][j] == '.':
print(i+1, j+1)
break
elif all('.' in [grid[i][j] for i in range(N)] for j in range(N)):
for j in range(N):
for i in range(N):
if grid[i][j] == '.':
print(i+1, j+1)
break
else:
print(-1)
try:
ans = main()
# print(ans)
except Exception as e:
traceback.print_exc()
```
| 3
|
|
873
|
B
|
Balanced Substring
|
PROGRAMMING
| 1,500
|
[
"dp",
"implementation"
] | null | null |
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
|
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
|
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
|
[
"8\n11010111\n",
"3\n111\n"
] |
[
"4\n",
"0\n"
] |
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring.
| 0
|
[
{
"input": "8\n11010111",
"output": "4"
},
{
"input": "3\n111",
"output": "0"
},
{
"input": "11\n00001000100",
"output": "2"
},
{
"input": "10\n0100000000",
"output": "2"
},
{
"input": "13\n0001000011010",
"output": "6"
},
{
"input": "14\n00000100101011",
"output": "10"
},
{
"input": "14\n01111101111111",
"output": "2"
},
{
"input": "18\n110010101101111111",
"output": "10"
},
{
"input": "11\n00010000011",
"output": "4"
},
{
"input": "10\n1000010110",
"output": "6"
},
{
"input": "15\n100000100000011",
"output": "4"
},
{
"input": "18\n011010101110111101",
"output": "8"
},
{
"input": "10\n0011011111",
"output": "6"
},
{
"input": "3\n011",
"output": "2"
},
{
"input": "14\n11111111111111",
"output": "0"
},
{
"input": "65\n11001000110001001011011110111100000000101001001010101111000100010",
"output": "48"
},
{
"input": "10\n0011111000",
"output": "10"
},
{
"input": "13\n1110000001110",
"output": "12"
},
{
"input": "3\n110",
"output": "2"
},
{
"input": "4\n1110",
"output": "2"
},
{
"input": "9\n001011001",
"output": "8"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n01",
"output": "2"
},
{
"input": "12\n110000110000",
"output": "8"
},
{
"input": "3\n001",
"output": "2"
},
{
"input": "14\n11000011000000",
"output": "8"
},
{
"input": "19\n0000011111111100000",
"output": "18"
},
{
"input": "45\n011010001100001111110001011100000001101100111",
"output": "44"
},
{
"input": "18\n000001111111100000",
"output": "16"
},
{
"input": "4\n0101",
"output": "4"
},
{
"input": "12\n000101011001",
"output": "10"
}
] | 1,610,038,585
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 139
| 0
|
n=int(input())
s=input()
out=0
tmp=0
i=0
while i<len(s)-1:
if(s[i]=='0' and s[i+1]=='1' or s[i]=='1' and s[i+1]=='0'):
tmp+=2
out=max(out,tmp)
i+=2
else:
if(tmp>0):
i-=1
else:
i+=1
tmp=0
print(out)
|
Title: Balanced Substring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
Input Specification:
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
Output Specification:
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
Demo Input:
['8\n11010111\n', '3\n111\n']
Demo Output:
['4\n', '0\n']
Note:
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring.
|
```python
n=int(input())
s=input()
out=0
tmp=0
i=0
while i<len(s)-1:
if(s[i]=='0' and s[i+1]=='1' or s[i]=='1' and s[i+1]=='0'):
tmp+=2
out=max(out,tmp)
i+=2
else:
if(tmp>0):
i-=1
else:
i+=1
tmp=0
print(out)
```
| 0
|
|
463
|
B
|
Caisa and Pylons
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
|
Print a single number representing the minimum number of dollars paid by Caisa.
|
[
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
] |
[
"4\n",
"4\n"
] |
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
| 1,000
|
[
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
] | 1,672,060,910
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
n = int(input())
lst = list(map(int,input().split(" ")))[:n]
ans,prev = 0,10**5
for i in lst:
if prev-i<0:
ans+=abs(i-prev)
prev = i
if ans ==0:
print(lst[0])
else:
print(ans+1)
|
Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
|
```python
n = int(input())
lst = list(map(int,input().split(" ")))[:n]
ans,prev = 0,10**5
for i in lst:
if prev-i<0:
ans+=abs(i-prev)
prev = i
if ans ==0:
print(lst[0])
else:
print(ans+1)
```
| 0
|
|
157
|
B
|
Trace
|
PROGRAMMING
| 1,000
|
[
"geometry",
"sortings"
] | null | null |
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
|
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
|
[
"1\n1\n",
"3\n1 4 2\n"
] |
[
"3.1415926536\n",
"40.8407044967\n"
] |
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
| 1,000
|
[
{
"input": "1\n1",
"output": "3.1415926536"
},
{
"input": "3\n1 4 2",
"output": "40.8407044967"
},
{
"input": "4\n4 1 3 2",
"output": "31.4159265359"
},
{
"input": "4\n100 10 2 1",
"output": "31111.1920484997"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "172.7875959474"
},
{
"input": "1\n1000",
"output": "3141592.6535897931"
},
{
"input": "8\n8 1 7 2 6 3 5 4",
"output": "113.0973355292"
},
{
"input": "100\n1000 999 998 997 996 995 994 993 992 991 990 989 988 987 986 985 984 983 982 981 980 979 978 977 976 975 974 973 972 971 970 969 968 967 966 965 964 963 962 961 960 959 958 957 956 955 954 953 952 951 950 949 948 947 946 945 944 943 942 941 940 939 938 937 936 935 934 933 932 931 930 929 928 927 926 925 924 923 922 921 920 919 918 917 916 915 914 913 912 911 910 909 908 907 906 905 904 903 902 901",
"output": "298608.3817237098"
},
{
"input": "6\n109 683 214 392 678 10",
"output": "397266.9574170437"
},
{
"input": "2\n151 400",
"output": "431023.3704798660"
},
{
"input": "6\n258 877 696 425 663 934",
"output": "823521.3902487604"
},
{
"input": "9\n635 707 108 234 52 180 910 203 782",
"output": "1100144.9065826489"
},
{
"input": "8\n885 879 891 428 522 176 135 983",
"output": "895488.9947571954"
},
{
"input": "3\n269 918 721",
"output": "1241695.6467754442"
},
{
"input": "7\n920 570 681 428 866 935 795",
"output": "1469640.1849419588"
},
{
"input": "2\n517 331",
"output": "495517.1260654109"
},
{
"input": "2\n457 898",
"output": "1877274.3981158488"
},
{
"input": "8\n872 704 973 612 183 274 739 253",
"output": "1780774.0965755312"
},
{
"input": "74\n652 446 173 457 760 847 670 25 196 775 998 279 656 809 883 148 969 884 792 502 641 800 663 938 362 339 545 608 107 184 834 666 149 458 864 72 199 658 618 987 126 723 806 643 689 958 626 904 944 415 427 498 628 331 636 261 281 276 478 220 513 595 510 384 354 561 469 462 799 449 747 109 903 456",
"output": "1510006.5089479341"
},
{
"input": "76\n986 504 673 158 87 332 124 218 714 235 212 122 878 370 938 81 686 323 386 348 410 468 875 107 50 960 82 834 234 663 651 422 794 633 294 771 945 607 146 913 950 858 297 88 882 725 247 872 645 749 799 987 115 394 380 382 971 429 593 426 652 353 351 233 868 598 889 116 71 376 916 464 414 976 138 903",
"output": "1528494.7817143100"
},
{
"input": "70\n12 347 748 962 514 686 192 159 990 4 10 788 602 542 946 215 523 727 799 717 955 796 529 465 897 103 181 515 495 153 710 179 747 145 16 585 943 998 923 708 156 399 770 547 775 285 9 68 713 722 570 143 913 416 663 624 925 218 64 237 797 138 942 213 188 818 780 840 480 758",
"output": "1741821.4892636713"
},
{
"input": "26\n656 508 45 189 561 366 96 486 547 386 703 570 780 689 264 26 11 74 466 76 421 48 982 886 215 650",
"output": "1818821.9252031571"
},
{
"input": "52\n270 658 808 249 293 707 700 78 791 167 92 772 807 502 830 991 945 102 968 376 556 578 326 980 688 368 280 853 646 256 666 638 424 737 321 996 925 405 199 680 953 541 716 481 727 143 577 919 892 355 346 298",
"output": "1272941.9273080483"
},
{
"input": "77\n482 532 200 748 692 697 171 863 586 547 301 149 326 812 147 698 303 691 527 805 681 387 619 947 598 453 167 799 840 508 893 688 643 974 998 341 804 230 538 669 271 404 477 759 943 596 949 235 880 160 151 660 832 82 969 539 708 889 258 81 224 655 790 144 462 582 646 256 445 52 456 920 67 819 631 484 534",
"output": "2045673.1891262225"
},
{
"input": "27\n167 464 924 575 775 97 944 390 297 315 668 296 533 829 851 406 702 366 848 512 71 197 321 900 544 529 116",
"output": "1573959.9105970615"
},
{
"input": "38\n488 830 887 566 720 267 583 102 65 200 884 220 263 858 510 481 316 804 754 568 412 166 374 869 356 977 145 421 500 58 664 252 745 70 381 927 670 772",
"output": "1479184.3434235646"
},
{
"input": "64\n591 387 732 260 840 397 563 136 571 876 831 953 799 493 579 13 559 872 53 678 256 232 969 993 847 14 837 365 547 997 604 199 834 529 306 443 739 49 19 276 343 835 904 588 900 870 439 576 975 955 518 117 131 347 800 83 432 882 869 709 32 950 314 450",
"output": "1258248.6984672088"
},
{
"input": "37\n280 281 169 68 249 389 977 101 360 43 448 447 368 496 125 507 747 392 338 270 916 150 929 428 118 266 589 470 774 852 263 644 187 817 808 58 637",
"output": "1495219.0323274869"
},
{
"input": "97\n768 569 306 968 437 779 227 561 412 60 44 807 234 645 169 858 580 396 343 145 842 723 416 80 456 247 81 150 297 116 760 964 312 558 101 850 549 650 299 868 121 435 579 705 118 424 302 812 970 397 659 565 916 183 933 459 6 593 518 717 326 305 744 470 75 981 824 221 294 324 194 293 251 446 481 215 338 861 528 829 921 945 540 89 450 178 24 460 990 392 148 219 934 615 932 340 937",
"output": "1577239.7333274092"
},
{
"input": "94\n145 703 874 425 277 652 239 496 458 658 339 842 564 699 893 352 625 980 432 121 798 872 499 859 850 721 414 825 543 843 304 111 342 45 219 311 50 748 465 902 781 822 504 985 919 656 280 310 917 438 464 527 491 713 906 329 635 777 223 810 501 535 156 252 806 112 971 719 103 443 165 98 579 554 244 996 221 560 301 51 977 422 314 858 528 772 448 626 185 194 536 66 577 677",
"output": "1624269.3753516484"
},
{
"input": "97\n976 166 649 81 611 927 480 231 998 711 874 91 969 521 531 414 993 790 317 981 9 261 437 332 173 573 904 777 882 990 658 878 965 64 870 896 271 732 431 53 761 943 418 602 708 949 930 130 512 240 363 458 673 319 131 784 224 48 919 126 208 212 911 59 677 535 450 273 479 423 79 807 336 18 72 290 724 28 123 605 287 228 350 897 250 392 885 655 746 417 643 114 813 378 355 635 905",
"output": "1615601.7212203942"
},
{
"input": "91\n493 996 842 9 748 178 1 807 841 519 796 998 84 670 778 143 707 208 165 893 154 943 336 150 761 881 434 112 833 55 412 682 552 945 758 189 209 600 354 325 440 844 410 20 136 665 88 791 688 17 539 821 133 236 94 606 483 446 429 60 960 476 915 134 137 852 754 908 276 482 117 252 297 903 981 203 829 811 471 135 188 667 710 393 370 302 874 872 551 457 692",
"output": "1806742.5014501044"
},
{
"input": "95\n936 736 17 967 229 607 589 291 242 244 29 698 800 566 630 667 90 416 11 94 812 838 668 520 678 111 490 823 199 973 681 676 683 721 262 896 682 713 402 691 874 44 95 704 56 322 822 887 639 433 406 35 988 61 176 496 501 947 440 384 372 959 577 370 754 802 1 945 427 116 746 408 308 391 397 730 493 183 203 871 831 862 461 565 310 344 504 378 785 137 279 123 475 138 415",
"output": "1611115.5269110680"
},
{
"input": "90\n643 197 42 218 582 27 66 704 195 445 641 675 285 639 503 686 242 327 57 955 848 287 819 992 756 749 363 48 648 736 580 117 752 921 923 372 114 313 202 337 64 497 399 25 883 331 24 871 917 8 517 486 323 529 325 92 891 406 864 402 263 773 931 253 625 31 17 271 140 131 232 586 893 525 846 54 294 562 600 801 214 55 768 683 389 738 314 284 328 804",
"output": "1569819.2914796301"
},
{
"input": "98\n29 211 984 75 333 96 840 21 352 168 332 433 130 944 215 210 620 442 363 877 91 491 513 955 53 82 351 19 998 706 702 738 770 453 344 117 893 590 723 662 757 16 87 546 312 669 568 931 224 374 927 225 751 962 651 587 361 250 256 240 282 600 95 64 384 589 813 783 39 918 412 648 506 283 886 926 443 173 946 241 310 33 622 565 261 360 547 339 943 367 354 25 479 743 385 485 896 741",
"output": "2042921.1539616778"
},
{
"input": "93\n957 395 826 67 185 4 455 880 683 654 463 84 258 878 553 592 124 585 9 133 20 609 43 452 725 125 801 537 700 685 771 155 566 376 19 690 383 352 174 208 177 416 304 1000 533 481 87 509 358 233 681 22 507 659 36 859 952 259 138 271 594 779 576 782 119 69 608 758 283 616 640 523 710 751 34 106 774 92 874 568 864 660 998 992 474 679 180 409 15 297 990 689 501",
"output": "1310703.8710041976"
},
{
"input": "97\n70 611 20 30 904 636 583 262 255 501 604 660 212 128 199 138 545 576 506 528 12 410 77 888 783 972 431 188 338 485 148 793 907 678 281 922 976 680 252 724 253 920 177 361 721 798 960 572 99 622 712 466 608 49 612 345 266 751 63 594 40 695 532 789 520 930 825 929 48 59 405 135 109 735 508 186 495 772 375 587 201 324 447 610 230 947 855 318 856 956 313 810 931 175 668 183 688",
"output": "1686117.9099228707"
},
{
"input": "96\n292 235 391 180 840 172 218 997 166 287 329 20 886 325 400 471 182 356 448 337 417 319 58 106 366 764 393 614 90 831 924 314 667 532 64 874 3 434 350 352 733 795 78 640 967 63 47 879 635 272 145 569 468 792 153 761 770 878 281 467 209 208 298 37 700 18 334 93 5 750 412 779 523 517 360 649 447 328 311 653 57 578 767 460 647 663 50 670 151 13 511 580 625 907 227 89",
"output": "1419726.5608617242"
},
{
"input": "100\n469 399 735 925 62 153 707 723 819 529 200 624 57 708 245 384 889 11 639 638 260 419 8 142 403 298 204 169 887 388 241 983 885 267 643 943 417 237 452 562 6 839 149 742 832 896 100 831 712 754 679 743 135 222 445 680 210 955 220 63 960 487 514 824 481 584 441 997 795 290 10 45 510 678 844 503 407 945 850 84 858 934 500 320 936 663 736 592 161 670 606 465 864 969 293 863 868 393 899 744",
"output": "1556458.0979239127"
},
{
"input": "100\n321 200 758 415 190 710 920 992 873 898 814 259 359 66 971 210 838 545 663 652 684 277 36 756 963 459 335 484 462 982 532 423 131 703 307 229 391 938 253 847 542 975 635 928 220 980 222 567 557 181 366 824 900 180 107 979 112 564 525 413 300 422 876 615 737 343 902 8 654 628 469 913 967 785 893 314 909 215 912 262 20 709 363 915 997 954 986 454 596 124 74 159 660 550 787 418 895 786 293 50",
"output": "1775109.8050211088"
},
{
"input": "100\n859 113 290 762 701 63 188 431 810 485 671 673 99 658 194 227 511 435 941 212 551 124 89 222 42 321 657 815 898 171 216 482 707 567 724 491 414 942 820 351 48 653 685 312 586 24 20 627 602 498 533 173 463 262 621 466 119 299 580 964 510 987 40 698 521 998 847 651 746 215 808 563 785 837 631 772 404 923 682 244 232 214 390 350 968 771 517 900 70 543 934 554 681 368 642 575 891 728 478 317",
"output": "1447969.4788174964"
},
{
"input": "100\n941 283 349 457 52 837 299 284 796 305 893 624 101 972 738 204 121 70 17 704 836 791 95 111 162 952 472 724 733 580 878 177 705 804 11 211 463 417 288 409 410 485 896 755 921 267 164 656 505 765 539 439 535 19 991 689 220 474 114 944 884 144 926 849 486 566 117 35 749 499 797 303 362 905 690 890 976 66 590 183 234 683 39 297 769 787 376 541 571 759 495 200 261 352 73 493 831 442 273 339",
"output": "1597889.4218394549"
},
{
"input": "100\n110 868 147 888 291 282 916 542 917 337 235 595 498 621 814 249 261 713 445 666 142 275 319 49 900 543 333 606 487 670 620 769 852 258 230 867 603 491 714 839 879 37 21 74 590 190 397 506 499 967 152 862 200 107 145 23 614 167 857 475 79 598 270 906 626 116 89 59 651 846 723 201 50 699 522 408 634 132 226 414 824 764 513 586 526 238 556 162 667 173 684 415 527 743 10 442 552 274 350 822",
"output": "1567230.6191330721"
},
{
"input": "100\n901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "298608.3817237098"
}
] | 1,661,520,105
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 92
| 0
|
import math
tc = int(input())
arr = list(map(int, input().split()))
arr.sort(reverse = True)
c = 0
for i in range(tc):
c += (-1 if i % 2 == 1 else 1) * arr[i] ** 2
print(c * math.pi)
|
Title: Trace
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
Output Specification:
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
Demo Input:
['1\n1\n', '3\n1 4 2\n']
Demo Output:
['3.1415926536\n', '40.8407044967\n']
Note:
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
|
```python
import math
tc = int(input())
arr = list(map(int, input().split()))
arr.sort(reverse = True)
c = 0
for i in range(tc):
c += (-1 if i % 2 == 1 else 1) * arr[i] ** 2
print(c * math.pi)
```
| 3
|
|
10
|
A
|
Power Consumption Calculation
|
PROGRAMMING
| 900
|
[
"implementation"
] |
A. Power Consumption Calculation
|
1
|
256
|
Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*].
|
The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=1440, *r**i*<=<<=*l**i*<=+<=1 for *i*<=<<=*n*), which stand for the start and the end of the *i*-th period of work.
|
Output the answer to the problem.
|
[
"1 3 2 1 5 10\n0 10\n",
"2 8 4 2 5 10\n20 30\n50 100\n"
] |
[
"30",
"570"
] |
none
| 0
|
[
{
"input": "1 3 2 1 5 10\n0 10",
"output": "30"
},
{
"input": "2 8 4 2 5 10\n20 30\n50 100",
"output": "570"
},
{
"input": "3 15 9 95 39 19\n873 989\n1003 1137\n1172 1436",
"output": "8445"
},
{
"input": "4 73 2 53 58 16\n51 52\n209 242\n281 407\n904 945",
"output": "52870"
},
{
"input": "5 41 20 33 43 4\n46 465\n598 875\n967 980\n1135 1151\n1194 1245",
"output": "46995"
},
{
"input": "6 88 28 100 53 36\n440 445\n525 614\n644 844\n1238 1261\n1305 1307\n1425 1434",
"output": "85540"
},
{
"input": "7 46 61 55 28 59\n24 26\n31 61\n66 133\n161 612\n741 746\n771 849\n1345 1357",
"output": "67147"
},
{
"input": "8 83 18 30 28 5\n196 249\n313 544\n585 630\n718 843\n1040 1194\n1207 1246\n1268 1370\n1414 1422",
"output": "85876"
},
{
"input": "9 31 65 27 53 54\n164 176\n194 210\n485 538\n617 690\n875 886\n888 902\n955 957\n1020 1200\n1205 1282",
"output": "38570"
},
{
"input": "30 3 1 58 44 7\n11 13\n14 32\n37 50\n70 74\n101 106\n113 129\n184 195\n197 205\n213 228\n370 394\n443 446\n457 460\n461 492\n499 585\n602 627\n709 776\n812 818\n859 864\n910 913\n918 964\n1000 1010\n1051 1056\n1063 1075\n1106 1145\n1152 1189\n1211 1212\n1251 1259\n1272 1375\n1412 1417\n1430 1431",
"output": "11134"
},
{
"input": "30 42 3 76 28 26\n38 44\n55 66\n80 81\n84 283\n298 314\n331 345\n491 531\n569 579\n597 606\n612 617\n623 701\n723 740\n747 752\n766 791\n801 827\n842 846\n853 891\n915 934\n945 949\n955 964\n991 1026\n1051 1059\n1067 1179\n1181 1191\n1214 1226\n1228 1233\n1294 1306\n1321 1340\n1371 1374\n1375 1424",
"output": "59043"
},
{
"input": "30 46 5 93 20 46\n12 34\n40 41\n54 58\n100 121\n162 182\n220 349\n358 383\n390 398\n401 403\n408 409\n431 444\n466 470\n471 535\n556 568\n641 671\n699 709\n767 777\n786 859\n862 885\n912 978\n985 997\n1013 1017\n1032 1038\n1047 1048\n1062 1080\n1094 1097\n1102 1113\n1122 1181\n1239 1280\n1320 1369",
"output": "53608"
},
{
"input": "30 50 74 77 4 57\n17 23\n24 61\n67 68\n79 87\n93 101\n104 123\n150 192\n375 377\n398 414\n461 566\n600 633\n642 646\n657 701\n771 808\n812 819\n823 826\n827 833\n862 875\n880 891\n919 920\n928 959\n970 1038\n1057 1072\n1074 1130\n1165 1169\n1171 1230\n1265 1276\n1279 1302\n1313 1353\n1354 1438",
"output": "84067"
},
{
"input": "30 54 76 95 48 16\n9 11\n23 97\n112 116\n126 185\n214 223\n224 271\n278 282\n283 348\n359 368\n373 376\n452 463\n488 512\n532 552\n646 665\n681 685\n699 718\n735 736\n750 777\n791 810\n828 838\n841 858\n874 1079\n1136 1171\n1197 1203\n1210 1219\n1230 1248\n1280 1292\n1324 1374\n1397 1435\n1438 1439",
"output": "79844"
},
{
"input": "30 58 78 12 41 28\n20 26\n27 31\n35 36\n38 99\n103 104\n106 112\n133 143\n181 246\n248 251\n265 323\n350 357\n378 426\n430 443\n466 476\n510 515\n517 540\n542 554\n562 603\n664 810\n819 823\n826 845\n869 895\n921 973\n1002 1023\n1102 1136\n1143 1148\n1155 1288\n1316 1388\n1394 1403\n1434 1437",
"output": "82686"
},
{
"input": "30 62 80 97 25 47\n19 20\n43 75\n185 188\n199 242\n252 258\n277 310\n316 322\n336 357\n398 399\n404 436\n443 520\n549 617\n637 649\n679 694\n705 715\n725 730\n731 756\n768 793\n806 833\n834 967\n1003 1079\n1088 1097\n1100 1104\n1108 1121\n1127 1164\n1240 1263\n1274 1307\n1367 1407\n1419 1425\n1433 1437",
"output": "92356"
},
{
"input": "30 100 48 14 9 7\n26 55\n75 107\n145 146\n158 167\n197 199\n201 213\n222 238\n257 265\n271 338\n357 439\n454 462\n463 562\n633 660\n670 691\n696 829\n844 864\n880 888\n891 894\n895 900\n950 973\n1004 1007\n1018 1021\n1045 1049\n1062 1073\n1138 1184\n1240 1272\n1278 1315\n1403 1410\n1412 1418\n1426 1434",
"output": "107490"
},
{
"input": "30 3 50 32 1 18\n46 60\n66 94\n99 141\n162 239\n309 334\n400 550\n594 630\n659 663\n664 701\n735 736\n741 755\n756 801\n823 854\n865 915\n937 964\n984 986\n990 1007\n1008 1031\n1052 1064\n1073 1080\n1190 1191\n1192 1254\n1265 1266\n1272 1273\n1274 1277\n1284 1302\n1308 1312\n1358 1383\n1388 1389\n1390 1401",
"output": "25258"
},
{
"input": "30 7 52 49 46 37\n2 73\n129 130\n131 140\n143 150\n187 190\n217 238\n248 271\n375 426\n465 470\n475 503\n506 541\n569 571\n578 585\n680 683\n690 738\n742 761\n868 877\n890 892\n904 915\n935 961\n1076 1100\n1103 1114\n1232 1244\n1246 1247\n1257 1261\n1271 1276\n1280 1298\n1346 1360\n1373 1382\n1407 1419",
"output": "23992"
}
] | 1,698,146,799
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
import sys
input = sys.stdin.readline
|
Title: Power Consumption Calculation
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*].
Input Specification:
The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=1440, *r**i*<=<<=*l**i*<=+<=1 for *i*<=<<=*n*), which stand for the start and the end of the *i*-th period of work.
Output Specification:
Output the answer to the problem.
Demo Input:
['1 3 2 1 5 10\n0 10\n', '2 8 4 2 5 10\n20 30\n50 100\n']
Demo Output:
['30', '570']
Note:
none
|
```python
import sys
input = sys.stdin.readline
```
| 0
|
525
|
A
|
Vitaliy and Pie
|
PROGRAMMING
| 1,100
|
[
"greedy",
"hashing",
"strings"
] | null | null |
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
|
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
|
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
|
[
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] |
[
"0\n",
"3\n",
"2\n"
] |
none
| 250
|
[
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,558,700,237
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 202
| 409,600
|
n = int(input())
s = input()
keys = ''
cnt = 0
for i in range((n*2)-2):
if i % 2 == 0:
keys += s[i]
else:
if keys.count(s[i].lower()) > 0:
keys = keys.replace(s[i].lower(), '')
else:
cnt += 1
print(cnt)
|
Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none
|
```python
n = int(input())
s = input()
keys = ''
cnt = 0
for i in range((n*2)-2):
if i % 2 == 0:
keys += s[i]
else:
if keys.count(s[i].lower()) > 0:
keys = keys.replace(s[i].lower(), '')
else:
cnt += 1
print(cnt)
```
| 0
|
|
771
|
B
|
Bear and Different Names
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"greedy"
] | null | null |
In the army, it isn't easy to form a group of soldiers that will be effective on the battlefield. The communication is crucial and thus no two soldiers should share a name (what would happen if they got an order that Bob is a scouter, if there are two Bobs?).
A group of soldiers is effective if and only if their names are different. For example, a group (John, Bob, Limak) would be effective, while groups (Gary, Bob, Gary) and (Alice, Alice) wouldn't.
You are a spy in the enemy's camp. You noticed *n* soldiers standing in a row, numbered 1 through *n*. The general wants to choose a group of *k* consecutive soldiers. For every *k* consecutive soldiers, the general wrote down whether they would be an effective group or not.
You managed to steal the general's notes, with *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1, each either "YES" or "NO".
- The string *s*1 describes a group of soldiers 1 through *k* ("YES" if the group is effective, and "NO" otherwise). - The string *s*2 describes a group of soldiers 2 through *k*<=+<=1. - And so on, till the string *s**n*<=-<=*k*<=+<=1 that describes a group of soldiers *n*<=-<=*k*<=+<=1 through *n*.
Your task is to find possible names of *n* soldiers. Names should match the stolen notes. Each name should be a string that consists of between 1 and 10 English letters, inclusive. The first letter should be uppercase, and all other letters should be lowercase. Names don't have to be existing names — it's allowed to print "Xyzzzdj" or "T" for example.
Find and print any solution. It can be proved that there always exists at least one solution.
|
The first line of the input contains two integers *n* and *k* (2<=≤<=*k*<=≤<=*n*<=≤<=50) — the number of soldiers and the size of a group respectively.
The second line contains *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1. The string *s**i* is "YES" if the group of soldiers *i* through *i*<=+<=*k*<=-<=1 is effective, and "NO" otherwise.
|
Find any solution satisfying all given conditions. In one line print *n* space-separated strings, denoting possible names of soldiers in the order. The first letter of each name should be uppercase, while the other letters should be lowercase. Each name should contain English letters only and has length from 1 to 10.
If there are multiple valid solutions, print any of them.
|
[
"8 3\nNO NO YES YES YES NO\n",
"9 8\nYES NO\n",
"3 2\nNO NO\n"
] |
[
"Adam Bob Bob Cpqepqwer Limak Adam Bob Adam",
"R Q Ccccccccc Ccocc Ccc So Strong Samples Ccc",
"Na Na Na"
] |
In the first sample, there are 8 soldiers. For every 3 consecutive ones we know whether they would be an effective group. Let's analyze the provided sample output:
- First three soldiers (i.e. Adam, Bob, Bob) wouldn't be an effective group because there are two Bobs. Indeed, the string *s*<sub class="lower-index">1</sub> is "NO". - Soldiers 2 through 4 (Bob, Bob, Cpqepqwer) wouldn't be effective either, and the string *s*<sub class="lower-index">2</sub> is "NO". - Soldiers 3 through 5 (Bob, Cpqepqwer, Limak) would be effective, and the string *s*<sub class="lower-index">3</sub> is "YES". - ..., - Soldiers 6 through 8 (Adam, Bob, Adam) wouldn't be effective, and the string *s*<sub class="lower-index">6</sub> is "NO".
| 500
|
[
{
"input": "8 3\nNO NO YES YES YES NO",
"output": "Ab Ac Ab Ac Af Ag Ah Ag "
},
{
"input": "9 8\nYES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Ac "
},
{
"input": "3 2\nNO NO",
"output": "Ab Ab Ab "
},
{
"input": "2 2\nYES",
"output": "Ab Ac "
},
{
"input": "2 2\nNO",
"output": "Ab Ab "
},
{
"input": "7 2\nYES NO YES YES NO YES",
"output": "Ab Ac Ac Ae Af Af Ah "
},
{
"input": "18 7\nYES YES YES YES YES YES YES NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ai Aj Ak Al Am "
},
{
"input": "50 3\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO YES NO",
"output": "Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Ab Ac Bx Ac "
},
{
"input": "19 15\nNO YES YES YES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ab Aq Ar As Af "
},
{
"input": "3 2\nNO NO",
"output": "Ab Ab Ab "
},
{
"input": "3 2\nNO YES",
"output": "Ab Ab Ad "
},
{
"input": "3 2\nYES NO",
"output": "Ab Ac Ac "
},
{
"input": "3 2\nYES YES",
"output": "Ab Ac Ad "
},
{
"input": "26 17\nNO YES YES YES NO YES NO YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ab As At Au Af Aw Ah Ay Az Ba "
},
{
"input": "12 2\nYES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am "
},
{
"input": "16 2\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab Ab "
},
{
"input": "42 20\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq "
},
{
"input": "37 14\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al "
},
{
"input": "29 10\nYES NO YES NO YES NO YES YES YES YES YES NO NO NO NO NO YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Ac Am Ae Ao Ag Aq Ar As At Au Am Ae Ao Ag Aq Ba Bb Bc Bd "
},
{
"input": "37 3\nYES NO YES NO YES NO YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES NO NO YES NO NO YES YES YES YES NO",
"output": "Ab Ac Ad Ac Af Ac Ah Ac Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Ba Bb Be Bb Be Bh Bi Bj Bk Bj "
},
{
"input": "44 11\nNO NO YES NO YES NO YES YES YES YES YES YES YES YES YES YES YES YES YES NO YES YES YES YES YES NO NO YES NO NO YES YES YES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Ab Ac An Ae Ap Ag Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Au Bf Bg Bh Bi Bj Ba Bb Bm Bd Au Bp Bq Br Bi "
},
{
"input": "50 49\nNO YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Ab By "
},
{
"input": "50 49\nYES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "50 49\nNO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Ab Ac "
},
{
"input": "50 49\nYES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx Ac "
},
{
"input": "46 42\nNO YES YES YES NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Ab Br Bs Bt Af "
},
{
"input": "45 26\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt "
},
{
"input": "45 26\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au "
},
{
"input": "50 3\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES",
"output": "Ab Ac Ab Ae Ab Ag Ab Ai Ab Ak Ab Am Ab Ao Ab Aq Ab As Ab Au Ab Aw Ab Ay Ab Ba Ab Bc Ab Be Ab Bg Ab Bi Ab Bk Ab Bm Ab Bo Ab Bq Ab Bs Ab Bu Ab Bw Ab By "
},
{
"input": "50 2\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO",
"output": "Ab Ab Ad Ad Af Af Ah Ah Aj Aj Al Al An An Ap Ap Ar Ar At At Av Av Ax Ax Az Az Bb Bb Bd Bd Bf Bf Bh Bh Bj Bj Bl Bl Bn Bn Bp Bp Br Br Bt Bt Bv Bv Bx Bx "
},
{
"input": "50 3\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES YES YES YES YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES",
"output": "Ab Ac Ab Ae Ab Ag Ab Ai Ab Ak Ab Am Ab Ao Ab Aq Ab As Ab Au Ab Aw Ab Ay Ab Ba Ab Bc Bd Be Bf Bg Bf Bi Bf Bk Bf Bm Bf Bo Bf Bq Bf Bs Bf Bu Bf Bw Bf By "
},
{
"input": "49 2\nNO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO NO NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES NO YES",
"output": "Ab Ab Ad Ad Af Af Ah Ah Aj Aj Al Al An An Ap Ap Ar Ar At At Av Av Ax Ax Ax Ax Bb Bb Bd Bd Bf Bf Bh Bh Bj Bj Bl Bl Bn Bn Bp Bp Br Br Bt Bt Bv Bv Bx "
},
{
"input": "35 22\nNO NO NO NO NO NO NO NO NO NO NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao "
},
{
"input": "46 41\nYES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu "
},
{
"input": "12 4\nYES YES NO NO NO NO NO YES YES",
"output": "Ab Ac Ad Ae Af Ad Ae Af Ad Ae Al Am "
},
{
"input": "50 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "50 4\nYES YES YES YES YES NO YES YES YES YES NO NO YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES NO YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Ag Ak Al Am An Al Am Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bc Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "34 5\nYES YES YES YES YES NO YES YES YES YES NO NO YES YES YES NO NO YES NO YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ag Al Am An Ao Al Am Ar As At Am Ar Aw At Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi "
},
{
"input": "50 43\nYES NO YES NO YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Ac Bt Ae Bv Bw Bx By "
},
{
"input": "38 30\nNO NO YES NO YES NO NO NO NO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Ab Ac Bg Ae Bi Ag Ah Ai Aj "
},
{
"input": "50 50\nNO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx Ab "
},
{
"input": "50 50\nYES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "5 3\nYES NO YES",
"output": "Ab Ac Ad Ac Af "
},
{
"input": "30 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be "
},
{
"input": "50 50\nYES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "27 27\nYES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb "
},
{
"input": "28 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc "
},
{
"input": "50 2\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "8 3\nYES NO YES NO YES NO",
"output": "Ab Ac Ad Ac Af Ac Ah Ac "
},
{
"input": "42 30\nNO YES YES NO NO YES NO YES NO YES NO NO YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Ab Bf Bg Ae Af Bj Ah Bl Aj Bn Al Am Bq "
},
{
"input": "50 49\nYES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "50 3\nYES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By "
},
{
"input": "7 5\nYES NO YES",
"output": "Ab Ac Ad Ae Af Ac Ah "
},
{
"input": "8 4\nNO YES NO YES NO",
"output": "Ab Ac Ad Ab Af Ad Ah Af "
},
{
"input": "50 50\nNO",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx Ab "
},
{
"input": "50 48\nYES NO YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Ac By "
},
{
"input": "29 14\nYES NO YES NO NO YES YES NO NO YES YES NO NO YES YES YES",
"output": "Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ac Aq Ae Af At Au Ai Aj Ax Ay Am An Bb Bc Bd "
},
{
"input": "10 3\nNO YES NO YES NO YES NO YES",
"output": "Ab Ac Ab Ae Ab Ag Ab Ai Ab Ak "
},
{
"input": "10 5\nYES NO YES NO YES NO",
"output": "Ab Ac Ad Ae Af Ac Ah Ae Aj Ac "
}
] | 1,489,853,800
| 2,500
|
PyPy 3
|
WRONG_ANSWER
|
PRETESTS
| 0
| 124
| 23,142,400
|
names = ["A", "B", "C", "D", "E", "F", "G", "H", "I",
"J", "K", "L", "M", "N", "O", "P", "Q", "R",
"S", "T", "U", "V", "W", "X", "Y", "Z", "Aa",
"Bb", "Cc", "Dd", "Ee", "Ff", "Gg", "Hh", "Ii",
"Jj", "Kk", "Ll", "Mm", "Nn", "Oo", "Pp", "Qq", "Rr",
"Ss", "Tt", "Uu", "Vv", "Ww", "Xx", "Yy", "Zz" ]
n, k = [int(i) for i in input().split()]
s = input().split()
res = ["" for i in range(n)]
for i in range(len(s)):
if s[i] == "YES":
for j in range(i, k+i):
if res[j] == "":
res[j] = names.pop()
while "" in res:
for i in range(len(res)):
if res[i] == "":
if i != 0:
res[i] = res[i-1]
if res[i] == "":
if i != len(res)-1:
res[i] = res[i+1]
print(res)
|
Title: Bear and Different Names
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the army, it isn't easy to form a group of soldiers that will be effective on the battlefield. The communication is crucial and thus no two soldiers should share a name (what would happen if they got an order that Bob is a scouter, if there are two Bobs?).
A group of soldiers is effective if and only if their names are different. For example, a group (John, Bob, Limak) would be effective, while groups (Gary, Bob, Gary) and (Alice, Alice) wouldn't.
You are a spy in the enemy's camp. You noticed *n* soldiers standing in a row, numbered 1 through *n*. The general wants to choose a group of *k* consecutive soldiers. For every *k* consecutive soldiers, the general wrote down whether they would be an effective group or not.
You managed to steal the general's notes, with *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1, each either "YES" or "NO".
- The string *s*1 describes a group of soldiers 1 through *k* ("YES" if the group is effective, and "NO" otherwise). - The string *s*2 describes a group of soldiers 2 through *k*<=+<=1. - And so on, till the string *s**n*<=-<=*k*<=+<=1 that describes a group of soldiers *n*<=-<=*k*<=+<=1 through *n*.
Your task is to find possible names of *n* soldiers. Names should match the stolen notes. Each name should be a string that consists of between 1 and 10 English letters, inclusive. The first letter should be uppercase, and all other letters should be lowercase. Names don't have to be existing names — it's allowed to print "Xyzzzdj" or "T" for example.
Find and print any solution. It can be proved that there always exists at least one solution.
Input Specification:
The first line of the input contains two integers *n* and *k* (2<=≤<=*k*<=≤<=*n*<=≤<=50) — the number of soldiers and the size of a group respectively.
The second line contains *n*<=-<=*k*<=+<=1 strings *s*1,<=*s*2,<=...,<=*s**n*<=-<=*k*<=+<=1. The string *s**i* is "YES" if the group of soldiers *i* through *i*<=+<=*k*<=-<=1 is effective, and "NO" otherwise.
Output Specification:
Find any solution satisfying all given conditions. In one line print *n* space-separated strings, denoting possible names of soldiers in the order. The first letter of each name should be uppercase, while the other letters should be lowercase. Each name should contain English letters only and has length from 1 to 10.
If there are multiple valid solutions, print any of them.
Demo Input:
['8 3\nNO NO YES YES YES NO\n', '9 8\nYES NO\n', '3 2\nNO NO\n']
Demo Output:
['Adam Bob Bob Cpqepqwer Limak Adam Bob Adam', 'R Q Ccccccccc Ccocc Ccc So Strong Samples Ccc', 'Na Na Na']
Note:
In the first sample, there are 8 soldiers. For every 3 consecutive ones we know whether they would be an effective group. Let's analyze the provided sample output:
- First three soldiers (i.e. Adam, Bob, Bob) wouldn't be an effective group because there are two Bobs. Indeed, the string *s*<sub class="lower-index">1</sub> is "NO". - Soldiers 2 through 4 (Bob, Bob, Cpqepqwer) wouldn't be effective either, and the string *s*<sub class="lower-index">2</sub> is "NO". - Soldiers 3 through 5 (Bob, Cpqepqwer, Limak) would be effective, and the string *s*<sub class="lower-index">3</sub> is "YES". - ..., - Soldiers 6 through 8 (Adam, Bob, Adam) wouldn't be effective, and the string *s*<sub class="lower-index">6</sub> is "NO".
|
```python
names = ["A", "B", "C", "D", "E", "F", "G", "H", "I",
"J", "K", "L", "M", "N", "O", "P", "Q", "R",
"S", "T", "U", "V", "W", "X", "Y", "Z", "Aa",
"Bb", "Cc", "Dd", "Ee", "Ff", "Gg", "Hh", "Ii",
"Jj", "Kk", "Ll", "Mm", "Nn", "Oo", "Pp", "Qq", "Rr",
"Ss", "Tt", "Uu", "Vv", "Ww", "Xx", "Yy", "Zz" ]
n, k = [int(i) for i in input().split()]
s = input().split()
res = ["" for i in range(n)]
for i in range(len(s)):
if s[i] == "YES":
for j in range(i, k+i):
if res[j] == "":
res[j] = names.pop()
while "" in res:
for i in range(len(res)):
if res[i] == "":
if i != 0:
res[i] = res[i-1]
if res[i] == "":
if i != len(res)-1:
res[i] = res[i+1]
print(res)
```
| 0
|
|
599
|
B
|
Spongebob and Joke
|
PROGRAMMING
| 1,500
|
[
"implementation"
] | null | null |
While Patrick was gone shopping, Spongebob decided to play a little trick on his friend. The naughty Sponge browsed through Patrick's personal stuff and found a sequence *a*1,<=*a*2,<=...,<=*a**m* of length *m*, consisting of integers from 1 to *n*, not necessarily distinct. Then he picked some sequence *f*1,<=*f*2,<=...,<=*f**n* of length *n* and for each number *a**i* got number *b**i*<==<=*f**a**i*. To finish the prank he erased the initial sequence *a**i*.
It's hard to express how sad Patrick was when he returned home from shopping! We will just say that Spongebob immediately got really sorry about what he has done and he is now trying to restore the original sequence. Help him do this or determine that this is impossible.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100<=000) — the lengths of sequences *f**i* and *b**i* respectively.
The second line contains *n* integers, determining sequence *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*).
The last line contains *m* integers, determining sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*).
|
Print "Possible" if there is exactly one sequence *a**i*, such that *b**i*<==<=*f**a**i* for all *i* from 1 to *m*. Then print *m* integers *a*1,<=*a*2,<=...,<=*a**m*.
If there are multiple suitable sequences *a**i*, print "Ambiguity".
If Spongebob has made a mistake in his calculations and no suitable sequence *a**i* exists, print "Impossible".
|
[
"3 3\n3 2 1\n1 2 3\n",
"3 3\n1 1 1\n1 1 1\n",
"3 3\n1 2 1\n3 3 3\n"
] |
[
"Possible\n3 2 1 \n",
"Ambiguity\n",
"Impossible\n"
] |
In the first sample 3 is replaced by 1 and vice versa, while 2 never changes. The answer exists and is unique.
In the second sample all numbers are replaced by 1, so it is impossible to unambiguously restore the original sequence.
In the third sample *f*<sub class="lower-index">*i*</sub> ≠ 3 for all *i*, so no sequence *a*<sub class="lower-index">*i*</sub> transforms into such *b*<sub class="lower-index">*i*</sub> and we can say for sure that Spongebob has made a mistake.
| 1,000
|
[
{
"input": "3 3\n3 2 1\n1 2 3",
"output": "Possible\n3 2 1 "
},
{
"input": "3 3\n1 1 1\n1 1 1",
"output": "Ambiguity"
},
{
"input": "3 3\n1 2 1\n3 3 3",
"output": "Impossible"
},
{
"input": "2 100\n2 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "Possible\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "5 6\n5 2 4 3 5\n1 2 3 4 4 5",
"output": "Impossible"
},
{
"input": "7 10\n1 2 2 1 3 7 5\n1 2 1 2 3 7 5 4 4 4",
"output": "Impossible"
},
{
"input": "1 1\n1\n1",
"output": "Possible\n1 "
},
{
"input": "1 10\n1\n1 1 1 1 1 1 1 1 1 1",
"output": "Possible\n1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "10 1\n1 2 3 4 5 6 1 8 9 10\n7",
"output": "Impossible"
},
{
"input": "3 3\n2 2 2\n2 3 3",
"output": "Impossible"
},
{
"input": "4 4\n1 1 1 4\n1 1 1 3",
"output": "Impossible"
},
{
"input": "3 3\n1 1 2\n1 2 3",
"output": "Impossible"
},
{
"input": "3 3\n2 2 1\n2 3 1",
"output": "Impossible"
},
{
"input": "3 2\n1 1 3\n1 2",
"output": "Impossible"
},
{
"input": "3 3\n1 1 1\n1 2 2",
"output": "Impossible"
},
{
"input": "3 1\n1 1 2\n2",
"output": "Possible\n3 "
},
{
"input": "3 3\n1 1 1\n1 1 2",
"output": "Impossible"
},
{
"input": "5 5\n1 1 5 5 5\n1 2 3 4 5",
"output": "Impossible"
},
{
"input": "2 2\n1 1\n1 2",
"output": "Impossible"
},
{
"input": "3 3\n1 1 2\n1 1 3",
"output": "Impossible"
},
{
"input": "3 2\n1 1 2\n1 3",
"output": "Impossible"
},
{
"input": "4 10\n1 2 3 3\n1 2 1 2 1 2 1 2 3 3",
"output": "Ambiguity"
},
{
"input": "3 3\n1 2 1\n2 2 2",
"output": "Possible\n2 2 2 "
},
{
"input": "4 2\n4 3 2 3\n4 4",
"output": "Possible\n1 1 "
}
] | 1,678,971,312
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 61
| 280
| 13,824,000
|
n, m = map(int, input().split())
f, b = [int(e) for e in input().split()], [int(e) for e in input().split()]
F, l = {}, []
for e, u in enumerate(f):
if u in F:
F[u] = 0
else:
F[u] = e+1
for e in b:
if e in F:
if F[e] > 0:
l += [F[e]]
else:
print('Impossible')
break
else:
if len(l) == m:
print('Possible')
print(*l)
else:
print('Ambiguity')
|
Title: Spongebob and Joke
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While Patrick was gone shopping, Spongebob decided to play a little trick on his friend. The naughty Sponge browsed through Patrick's personal stuff and found a sequence *a*1,<=*a*2,<=...,<=*a**m* of length *m*, consisting of integers from 1 to *n*, not necessarily distinct. Then he picked some sequence *f*1,<=*f*2,<=...,<=*f**n* of length *n* and for each number *a**i* got number *b**i*<==<=*f**a**i*. To finish the prank he erased the initial sequence *a**i*.
It's hard to express how sad Patrick was when he returned home from shopping! We will just say that Spongebob immediately got really sorry about what he has done and he is now trying to restore the original sequence. Help him do this or determine that this is impossible.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100<=000) — the lengths of sequences *f**i* and *b**i* respectively.
The second line contains *n* integers, determining sequence *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*).
The last line contains *m* integers, determining sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*).
Output Specification:
Print "Possible" if there is exactly one sequence *a**i*, such that *b**i*<==<=*f**a**i* for all *i* from 1 to *m*. Then print *m* integers *a*1,<=*a*2,<=...,<=*a**m*.
If there are multiple suitable sequences *a**i*, print "Ambiguity".
If Spongebob has made a mistake in his calculations and no suitable sequence *a**i* exists, print "Impossible".
Demo Input:
['3 3\n3 2 1\n1 2 3\n', '3 3\n1 1 1\n1 1 1\n', '3 3\n1 2 1\n3 3 3\n']
Demo Output:
['Possible\n3 2 1 \n', 'Ambiguity\n', 'Impossible\n']
Note:
In the first sample 3 is replaced by 1 and vice versa, while 2 never changes. The answer exists and is unique.
In the second sample all numbers are replaced by 1, so it is impossible to unambiguously restore the original sequence.
In the third sample *f*<sub class="lower-index">*i*</sub> ≠ 3 for all *i*, so no sequence *a*<sub class="lower-index">*i*</sub> transforms into such *b*<sub class="lower-index">*i*</sub> and we can say for sure that Spongebob has made a mistake.
|
```python
n, m = map(int, input().split())
f, b = [int(e) for e in input().split()], [int(e) for e in input().split()]
F, l = {}, []
for e, u in enumerate(f):
if u in F:
F[u] = 0
else:
F[u] = e+1
for e in b:
if e in F:
if F[e] > 0:
l += [F[e]]
else:
print('Impossible')
break
else:
if len(l) == m:
print('Possible')
print(*l)
else:
print('Ambiguity')
```
| 3
|
|
898
|
A
|
Rounding
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
|
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
|
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
|
[
"5\n",
"113\n",
"1000000000\n",
"5432359\n"
] |
[
"0\n",
"110\n",
"1000000000\n",
"5432360\n"
] |
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
| 500
|
[
{
"input": "5",
"output": "0"
},
{
"input": "113",
"output": "110"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "5432359",
"output": "5432360"
},
{
"input": "999999994",
"output": "999999990"
},
{
"input": "10",
"output": "10"
},
{
"input": "9",
"output": "10"
},
{
"input": "1",
"output": "0"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "6",
"output": "10"
},
{
"input": "7",
"output": "10"
},
{
"input": "8",
"output": "10"
},
{
"input": "19",
"output": "20"
},
{
"input": "100",
"output": "100"
},
{
"input": "997",
"output": "1000"
},
{
"input": "9994",
"output": "9990"
},
{
"input": "10002",
"output": "10000"
},
{
"input": "100000",
"output": "100000"
},
{
"input": "99999",
"output": "100000"
},
{
"input": "999999999",
"output": "1000000000"
},
{
"input": "999999998",
"output": "1000000000"
},
{
"input": "999999995",
"output": "999999990"
},
{
"input": "999999990",
"output": "999999990"
},
{
"input": "1000000",
"output": "1000000"
},
{
"input": "1000010",
"output": "1000010"
},
{
"input": "10000010",
"output": "10000010"
},
{
"input": "100000011",
"output": "100000010"
},
{
"input": "400000003",
"output": "400000000"
},
{
"input": "234234",
"output": "234230"
},
{
"input": "675621",
"output": "675620"
},
{
"input": "43532",
"output": "43530"
},
{
"input": "4576453",
"output": "4576450"
},
{
"input": "65754674",
"output": "65754670"
},
{
"input": "3245526",
"output": "3245530"
},
{
"input": "123445",
"output": "123440"
},
{
"input": "234217",
"output": "234220"
},
{
"input": "23451218",
"output": "23451220"
},
{
"input": "1231239",
"output": "1231240"
},
{
"input": "1923140",
"output": "1923140"
},
{
"input": "307910310",
"output": "307910310"
},
{
"input": "780961030",
"output": "780961030"
},
{
"input": "103509421",
"output": "103509420"
},
{
"input": "576560141",
"output": "576560140"
},
{
"input": "48851642",
"output": "48851640"
},
{
"input": "226935072",
"output": "226935070"
},
{
"input": "844450763",
"output": "844450760"
},
{
"input": "22534183",
"output": "22534180"
},
{
"input": "640049874",
"output": "640049870"
},
{
"input": "818133304",
"output": "818133300"
},
{
"input": "730616285",
"output": "730616280"
},
{
"input": "613732415",
"output": "613732410"
},
{
"input": "380991216",
"output": "380991220"
},
{
"input": "559074636",
"output": "559074640"
},
{
"input": "176590327",
"output": "176590330"
},
{
"input": "354673757",
"output": "354673760"
},
{
"input": "267156738",
"output": "267156740"
},
{
"input": "150272868",
"output": "150272870"
},
{
"input": "62755859",
"output": "62755860"
},
{
"input": "945871979",
"output": "945871980"
},
{
"input": "46",
"output": "50"
},
{
"input": "999",
"output": "1000"
},
{
"input": "1397",
"output": "1400"
}
] | 1,655,755,714
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 30
| 0
|
n = int (input() )
if n>4:
up = 10
else:
up = 0
ans = n - (n%10) + up
r = n % 10
down = n - r
print (ans)
|
Title: Rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
Input Specification:
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
Output Specification:
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
Demo Input:
['5\n', '113\n', '1000000000\n', '5432359\n']
Demo Output:
['0\n', '110\n', '1000000000\n', '5432360\n']
Note:
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
|
```python
n = int (input() )
if n>4:
up = 10
else:
up = 0
ans = n - (n%10) + up
r = n % 10
down = n - r
print (ans)
```
| 0
|
|
478
|
A
|
Initial Bet
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
There are five people playing a game called "Generosity". Each person gives some non-zero number of coins *b* as an initial bet. After all players make their bets of *b* coins, the following operation is repeated for several times: a coin is passed from one player to some other player.
Your task is to write a program that can, given the number of coins each player has at the end of the game, determine the size *b* of the initial bet or find out that such outcome of the game cannot be obtained for any positive number of coins *b* in the initial bet.
|
The input consists of a single line containing five integers *c*1,<=*c*2,<=*c*3,<=*c*4 and *c*5 — the number of coins that the first, second, third, fourth and fifth players respectively have at the end of the game (0<=≤<=*c*1,<=*c*2,<=*c*3,<=*c*4,<=*c*5<=≤<=100).
|
Print the only line containing a single positive integer *b* — the number of coins in the initial bet of each player. If there is no such value of *b*, then print the only value "-1" (quotes for clarity).
|
[
"2 5 4 0 4\n",
"4 5 9 2 1\n"
] |
[
"3\n",
"-1\n"
] |
In the first sample the following sequence of operations is possible:
1. One coin is passed from the fourth player to the second player; 1. One coin is passed from the fourth player to the fifth player; 1. One coin is passed from the first player to the third player; 1. One coin is passed from the fourth player to the second player.
| 500
|
[
{
"input": "2 5 4 0 4",
"output": "3"
},
{
"input": "4 5 9 2 1",
"output": "-1"
},
{
"input": "0 0 0 0 0",
"output": "-1"
},
{
"input": "1 2 1 2 3",
"output": "-1"
},
{
"input": "100 0 0 0 0",
"output": "20"
},
{
"input": "2 3 4 5 6",
"output": "4"
},
{
"input": "1 1 1 1 1",
"output": "1"
},
{
"input": "0 1 2 3 4",
"output": "2"
},
{
"input": "100 100 100 100 100",
"output": "100"
},
{
"input": "93 100 99 90 98",
"output": "96"
},
{
"input": "99 99 99 99 99",
"output": "99"
},
{
"input": "99 98 98 99 100",
"output": "-1"
},
{
"input": "43 83 1 0 23",
"output": "30"
},
{
"input": "43 83 1 100 23",
"output": "50"
},
{
"input": "57 83 11 4 93",
"output": "-1"
},
{
"input": "87 38 19 33 100",
"output": "-1"
},
{
"input": "56 0 0 0 4",
"output": "12"
},
{
"input": "0 0 0 0 1",
"output": "-1"
},
{
"input": "99 100 100 100 100",
"output": "-1"
}
] | 1,652,892,716
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 31
| 4,300,800
|
arr = tuple(map(int,input().split()))
x,sm = min(arr)-max(arr),sum(arr)
if x == 0:print(-1)
else:
print(sm // len(arr) if sm % x == 0 else -1)
|
Title: Initial Bet
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are five people playing a game called "Generosity". Each person gives some non-zero number of coins *b* as an initial bet. After all players make their bets of *b* coins, the following operation is repeated for several times: a coin is passed from one player to some other player.
Your task is to write a program that can, given the number of coins each player has at the end of the game, determine the size *b* of the initial bet or find out that such outcome of the game cannot be obtained for any positive number of coins *b* in the initial bet.
Input Specification:
The input consists of a single line containing five integers *c*1,<=*c*2,<=*c*3,<=*c*4 and *c*5 — the number of coins that the first, second, third, fourth and fifth players respectively have at the end of the game (0<=≤<=*c*1,<=*c*2,<=*c*3,<=*c*4,<=*c*5<=≤<=100).
Output Specification:
Print the only line containing a single positive integer *b* — the number of coins in the initial bet of each player. If there is no such value of *b*, then print the only value "-1" (quotes for clarity).
Demo Input:
['2 5 4 0 4\n', '4 5 9 2 1\n']
Demo Output:
['3\n', '-1\n']
Note:
In the first sample the following sequence of operations is possible:
1. One coin is passed from the fourth player to the second player; 1. One coin is passed from the fourth player to the fifth player; 1. One coin is passed from the first player to the third player; 1. One coin is passed from the fourth player to the second player.
|
```python
arr = tuple(map(int,input().split()))
x,sm = min(arr)-max(arr),sum(arr)
if x == 0:print(-1)
else:
print(sm // len(arr) if sm % x == 0 else -1)
```
| 0
|
|
592
|
C
|
The Big Race
|
PROGRAMMING
| 1,800
|
[
"math"
] | null | null |
Vector Willman and Array Bolt are the two most famous athletes of Byteforces. They are going to compete in a race with a distance of *L* meters today.
Willman and Bolt have exactly the same speed, so when they compete the result is always a tie. That is a problem for the organizers because they want a winner.
While watching previous races the organizers have noticed that Willman can perform only steps of length equal to *w* meters, and Bolt can perform only steps of length equal to *b* meters. Organizers decided to slightly change the rules of the race. Now, at the end of the racetrack there will be an abyss, and the winner will be declared the athlete, who manages to run farther from the starting point of the the racetrack (which is not the subject to change by any of the athletes).
Note that none of the athletes can run infinitely far, as they both will at some moment of time face the point, such that only one step further will cause them to fall in the abyss. In other words, the athlete will not fall into the abyss if the total length of all his steps will be less or equal to the chosen distance *L*.
Since the organizers are very fair, the are going to set the length of the racetrack as an integer chosen randomly and uniformly in range from 1 to *t* (both are included). What is the probability that Willman and Bolt tie again today?
|
The first line of the input contains three integers *t*, *w* and *b* (1<=≤<=*t*,<=*w*,<=*b*<=≤<=5·1018) — the maximum possible length of the racetrack, the length of Willman's steps and the length of Bolt's steps respectively.
|
Print the answer to the problem as an irreducible fraction . Follow the format of the samples output.
The fraction (*p* and *q* are integers, and both *p*<=≥<=0 and *q*<=><=0 holds) is called irreducible, if there is no such integer *d*<=><=1, that both *p* and *q* are divisible by *d*.
|
[
"10 3 2\n",
"7 1 2\n"
] |
[
"3/10\n",
"3/7\n"
] |
In the first sample Willman and Bolt will tie in case 1, 6 or 7 are chosen as the length of the racetrack.
| 1,500
|
[
{
"input": "10 3 2",
"output": "3/10"
},
{
"input": "7 1 2",
"output": "3/7"
},
{
"input": "1 1 1",
"output": "1/1"
},
{
"input": "5814 31 7",
"output": "94/2907"
},
{
"input": "94268 813 766",
"output": "765/94268"
},
{
"input": "262610 5583 4717",
"output": "2358/131305"
},
{
"input": "3898439 96326 71937",
"output": "71936/3898439"
},
{
"input": "257593781689876390 32561717 4411677",
"output": "7914548537/257593781689876390"
},
{
"input": "111319886766128339 7862842484895022 3003994959686829",
"output": "3003994959686828/111319886766128339"
},
{
"input": "413850294331656955 570110918058849723 409853735661743839",
"output": "409853735661743838/413850294331656955"
},
{
"input": "3000000000000000000 2999999999999999873 2999999999999999977",
"output": "23437499999999999/23437500000000000"
},
{
"input": "9 6 1",
"output": "1/9"
},
{
"input": "32 9 2",
"output": "3/32"
},
{
"input": "976 5 6",
"output": "41/244"
},
{
"input": "5814 31 7",
"output": "94/2907"
},
{
"input": "94268 714 345",
"output": "689/94268"
},
{
"input": "262610 5583 4717",
"output": "2358/131305"
},
{
"input": "3898439 96326 71937",
"output": "71936/3898439"
},
{
"input": "54682301 778668 253103",
"output": "253102/54682301"
},
{
"input": "329245015 1173508 8918834",
"output": "1173507/329245015"
},
{
"input": "321076647734423976 7 7",
"output": "1/1"
},
{
"input": "455227494055672047 92 28",
"output": "19792499741550983/455227494055672047"
},
{
"input": "595779167455745259 6954 8697",
"output": "205511958419723/595779167455745259"
},
{
"input": "1000000000000000000 1000000000 2000000000",
"output": "1/2"
},
{
"input": "462643382718281828 462643382718281507 462643382718281701",
"output": "33045955908448679/33045955908448702"
},
{
"input": "4000000000000000000 9999999999999997 99999999999999999",
"output": "2499999999999999/1000000000000000000"
},
{
"input": "4003000100004000000 9999999099999999 99999999999999999",
"output": "4999999549999999/2001500050002000000"
},
{
"input": "4903000100004000000 58997960959949999 99933992929999999",
"output": "29498980479974999/2451500050002000000"
},
{
"input": "257593781689876390 32561717 4411677",
"output": "7914548537/257593781689876390"
},
{
"input": "111319886766128339 7862842484895022 3003994959686829",
"output": "3003994959686828/111319886766128339"
},
{
"input": "413850294331656955 570110918058849723 409853735661743839",
"output": "409853735661743838/413850294331656955"
},
{
"input": "232 17 83",
"output": "2/29"
},
{
"input": "5496272 63 200",
"output": "13765/2748136"
},
{
"input": "180 174 53",
"output": "13/45"
},
{
"input": "1954 190 537",
"output": "189/1954"
},
{
"input": "146752429 510 514",
"output": "571199/146752429"
},
{
"input": "579312860 55 70",
"output": "10344881/144828215"
},
{
"input": "1 9 9",
"output": "1/1"
},
{
"input": "95 19 19",
"output": "1/1"
},
{
"input": "404 63 441",
"output": "31/202"
},
{
"input": "5566 4798 4798",
"output": "1/1"
},
{
"input": "118289676 570846883 570846883",
"output": "1/1"
},
{
"input": "763 358 358",
"output": "1/1"
},
{
"input": "85356138 7223 482120804",
"output": "3611/42678069"
},
{
"input": "674664088 435395270 5",
"output": "9/674664088"
},
{
"input": "762200126044291557 370330636048898430 6",
"output": "17/762200126044291557"
},
{
"input": "917148533938841535 47 344459175789842163",
"output": "28/183429706787768307"
},
{
"input": "360212127113008697 877228952036215545 5259",
"output": "5258/360212127113008697"
},
{
"input": "683705963104411677 89876390 116741460012229240",
"output": "539258339/683705963104411677"
},
{
"input": "573003994959686829 275856334120822851 1319886766128339",
"output": "3959660298385016/573003994959686829"
},
{
"input": "409853735661743839 413850294331656955 413850294331656955",
"output": "1/1"
},
{
"input": "19 1 19",
"output": "1/19"
},
{
"input": "576 18 32",
"output": "1/16"
},
{
"input": "9540 10 954",
"output": "1/477"
},
{
"input": "101997840 6 16999640",
"output": "1/8499820"
},
{
"input": "955944 1278 748",
"output": "1/639"
},
{
"input": "482120804 66748 7223",
"output": "1/66748"
},
{
"input": "370330636048898430 61721772674816405 6",
"output": "1/61721772674816405"
},
{
"input": "344459175789842163 7328918633826429 47",
"output": "1/7328918633826429"
},
{
"input": "877228952036215545 166805277055755 5259",
"output": "1/55601759018585"
},
{
"input": "116741460012229240 1298911316 89876390",
"output": "1/649455658"
},
{
"input": "275856334120822851 209 1319886766128339",
"output": "1/1319886766128339"
},
{
"input": "413850294331656955 1 413850294331656955",
"output": "1/413850294331656955"
},
{
"input": "54682301 778668 253103",
"output": "253102/54682301"
},
{
"input": "329245015 3931027 6443236",
"output": "357366/29931365"
},
{
"input": "321076647734423976 7 8",
"output": "1672274206950125/13378193655600999"
},
{
"input": "455227494055672047 71 60",
"output": "6411654845854559/455227494055672047"
},
{
"input": "595779167455745259 9741 9331",
"output": "61162012885196/595779167455745259"
},
{
"input": "6470 80 160",
"output": "327/647"
},
{
"input": "686325 828 1656",
"output": "114511/228775"
},
{
"input": "4535304 2129 4258",
"output": "755973/1511768"
},
{
"input": "40525189 6365 12730",
"output": "20265394/40525189"
},
{
"input": "675297075 25986 51972",
"output": "112553659/225099025"
},
{
"input": "5681598412 75376 226128",
"output": "1893897375/5681598412"
},
{
"input": "384118571739435733 619773000 1859319000",
"output": "128039524053435733/384118571739435733"
},
{
"input": "391554751752251913 625743359 1877230077",
"output": "130518250652782079/391554751752251913"
},
{
"input": "390728504279201198 625082797 1250165594",
"output": "195364252413988195/390728504279201198"
},
{
"input": "389902265396085075 624421544 1248843088",
"output": "64983710976697837/129967421798695025"
},
{
"input": "734812071040507372 857211800 2571635400",
"output": "61234339274051543/183703017760126843"
},
{
"input": "1 1 2",
"output": "0/1"
},
{
"input": "3 1 4",
"output": "0/1"
},
{
"input": "8 2 3",
"output": "3/8"
},
{
"input": "64 32 16",
"output": "1/2"
},
{
"input": "1 1 1000000000",
"output": "0/1"
},
{
"input": "1000000000 1 1",
"output": "1/1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1/1"
},
{
"input": "1000000000 2 4",
"output": "1/2"
},
{
"input": "1000000000 123 456",
"output": "6579023/1000000000"
},
{
"input": "1000000000 123123 654",
"output": "24851/1000000000"
},
{
"input": "123456 123 456",
"output": "215/30864"
},
{
"input": "123456 1234567 123",
"output": "61/61728"
},
{
"input": "314159265 271 8281",
"output": "37939/314159265"
},
{
"input": "11071994 4231 1324",
"output": "2647/11071994"
},
{
"input": "961748927 961748941 982451653",
"output": "1/1"
},
{
"input": "15485221 1259 90863",
"output": "1258/15485221"
},
{
"input": "5000000000000000000 4999999999999999837 4999999999999999963",
"output": "1249999999999999959/1250000000000000000"
},
{
"input": "4000000000000000000 3999999999999999691 3999999999999999887",
"output": "399999999999999969/400000000000000000"
},
{
"input": "999999999999999999 999999999999999709 999999999999999737",
"output": "333333333333333236/333333333333333333"
},
{
"input": "799999999999999999 799999999999999969 799999999999999991",
"output": "799999999999999968/799999999999999999"
},
{
"input": "812312312312312222 812312312312311897 812312312312312029",
"output": "406156156156155948/406156156156156111"
},
{
"input": "500000000000000000 499999999999999927 499999999999999931",
"output": "249999999999999963/250000000000000000"
},
{
"input": "555555555555555555 555555555555555083 555555555555555229",
"output": "50505050505050462/50505050505050505"
},
{
"input": "199419941994199419 199419941994199369 199419941994199391",
"output": "66473313998066456/66473313998066473"
},
{
"input": "145685485411238588 145685485411238483 145685485411238573",
"output": "72842742705619241/72842742705619294"
},
{
"input": "314159265358979323 314159265358979167 314159265358979213",
"output": "314159265358979166/314159265358979323"
},
{
"input": "10 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "5 100000000000000000 99999999999999999",
"output": "1/1"
},
{
"input": "5 1000000000000 1000000000001",
"output": "1/1"
},
{
"input": "5 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "2 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "2 10 11",
"output": "1/1"
},
{
"input": "10 123456789123456789 723456789123456781",
"output": "1/1"
},
{
"input": "12345678910 123456789101112131 123456789101112132",
"output": "1/1"
},
{
"input": "5 499999999999999999 499999999999999998",
"output": "1/1"
}
] | 1,446,311,472
| 2,472
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 3
| 46
| 0
|
a = list(map(int , input().split()))
t = a[0]
w = a[1]
b = a[2]
#val = gcd(w,b)
cnt = 0
for i in range(1,t+1):
f1 = i%w
f2 = i%b
if(f1==f2):
cnt = cnt + 1
print(str(cnt)+ "/" + str(t))
|
Title: The Big Race
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vector Willman and Array Bolt are the two most famous athletes of Byteforces. They are going to compete in a race with a distance of *L* meters today.
Willman and Bolt have exactly the same speed, so when they compete the result is always a tie. That is a problem for the organizers because they want a winner.
While watching previous races the organizers have noticed that Willman can perform only steps of length equal to *w* meters, and Bolt can perform only steps of length equal to *b* meters. Organizers decided to slightly change the rules of the race. Now, at the end of the racetrack there will be an abyss, and the winner will be declared the athlete, who manages to run farther from the starting point of the the racetrack (which is not the subject to change by any of the athletes).
Note that none of the athletes can run infinitely far, as they both will at some moment of time face the point, such that only one step further will cause them to fall in the abyss. In other words, the athlete will not fall into the abyss if the total length of all his steps will be less or equal to the chosen distance *L*.
Since the organizers are very fair, the are going to set the length of the racetrack as an integer chosen randomly and uniformly in range from 1 to *t* (both are included). What is the probability that Willman and Bolt tie again today?
Input Specification:
The first line of the input contains three integers *t*, *w* and *b* (1<=≤<=*t*,<=*w*,<=*b*<=≤<=5·1018) — the maximum possible length of the racetrack, the length of Willman's steps and the length of Bolt's steps respectively.
Output Specification:
Print the answer to the problem as an irreducible fraction . Follow the format of the samples output.
The fraction (*p* and *q* are integers, and both *p*<=≥<=0 and *q*<=><=0 holds) is called irreducible, if there is no such integer *d*<=><=1, that both *p* and *q* are divisible by *d*.
Demo Input:
['10 3 2\n', '7 1 2\n']
Demo Output:
['3/10\n', '3/7\n']
Note:
In the first sample Willman and Bolt will tie in case 1, 6 or 7 are chosen as the length of the racetrack.
|
```python
a = list(map(int , input().split()))
t = a[0]
w = a[1]
b = a[2]
#val = gcd(w,b)
cnt = 0
for i in range(1,t+1):
f1 = i%w
f2 = i%b
if(f1==f2):
cnt = cnt + 1
print(str(cnt)+ "/" + str(t))
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,648,971,740
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
str,k=input(),[]
sm=['a','b','c','d','i','f','j','h','i','g','k','l','m','n','o','p','q','r','s','t','u','e','w','v','x','y','z']
bi=['A','B','C','D','I','F','J','H','I','G','K','L','M','N','O','P','Q','R','S','T','U','E','W','V','X','Y','Z']
sma=0
b=0
def smal(smale,bige,k):
for i in range(len(k)):
if k[i] in bige:
for kl in range(len(bige)):
if k[i]==bige[kl]:
k[i]=smale[kl]
break
return k
def big(smale,bige,k):
for i in range(len(k)):
if k[i] in smale:
for kl in range(len(smale)):
if k[i]==smale[kl]:
k[i]=bige[kl]
break
return k
def pr(sma,b,sm,bi):
for i in range(len(str)):
k.append(str[i])
if str[i] in sm:
sma+=1
elif str[i] in bi:
b+=1
if sma>=b:
return smal(sm,bi,k)
else:
return big(sm,bi,k)
op=pr(0,0,sm,bi)
for i in range(len(op)):
print(op[i],end='')
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
str,k=input(),[]
sm=['a','b','c','d','i','f','j','h','i','g','k','l','m','n','o','p','q','r','s','t','u','e','w','v','x','y','z']
bi=['A','B','C','D','I','F','J','H','I','G','K','L','M','N','O','P','Q','R','S','T','U','E','W','V','X','Y','Z']
sma=0
b=0
def smal(smale,bige,k):
for i in range(len(k)):
if k[i] in bige:
for kl in range(len(bige)):
if k[i]==bige[kl]:
k[i]=smale[kl]
break
return k
def big(smale,bige,k):
for i in range(len(k)):
if k[i] in smale:
for kl in range(len(smale)):
if k[i]==smale[kl]:
k[i]=bige[kl]
break
return k
def pr(sma,b,sm,bi):
for i in range(len(str)):
k.append(str[i])
if str[i] in sm:
sma+=1
elif str[i] in bi:
b+=1
if sma>=b:
return smal(sm,bi,k)
else:
return big(sm,bi,k)
op=pr(0,0,sm,bi)
for i in range(len(op)):
print(op[i],end='')
```
| 3.977
|
472
|
A
|
Design Tutorial: Learn from Math
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
|
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
|
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
|
[
"12\n",
"15\n",
"23\n",
"1000000\n"
] |
[
"4 8\n",
"6 9\n",
"8 15\n",
"500000 500000\n"
] |
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
| 500
|
[
{
"input": "12",
"output": "4 8"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "23",
"output": "8 15"
},
{
"input": "1000000",
"output": "500000 500000"
},
{
"input": "63874",
"output": "4 63870"
},
{
"input": "14568",
"output": "4 14564"
},
{
"input": "192",
"output": "4 188"
},
{
"input": "86",
"output": "4 82"
},
{
"input": "46220",
"output": "4 46216"
},
{
"input": "57114",
"output": "4 57110"
},
{
"input": "869",
"output": "4 865"
},
{
"input": "738457",
"output": "4 738453"
},
{
"input": "58113",
"output": "6 58107"
},
{
"input": "4864",
"output": "4 4860"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "74752",
"output": "4 74748"
},
{
"input": "6073",
"output": "4 6069"
},
{
"input": "1289",
"output": "4 1285"
},
{
"input": "20",
"output": "4 16"
},
{
"input": "58134",
"output": "4 58130"
},
{
"input": "57756",
"output": "4 57752"
},
{
"input": "765",
"output": "6 759"
},
{
"input": "59",
"output": "4 55"
},
{
"input": "991666",
"output": "4 991662"
},
{
"input": "70761",
"output": "4 70757"
},
{
"input": "13",
"output": "4 9"
},
{
"input": "999999",
"output": "4 999995"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "21",
"output": "6 15"
},
{
"input": "19",
"output": "4 15"
},
{
"input": "100007",
"output": "6 100001"
},
{
"input": "999987",
"output": "6 999981"
},
{
"input": "22",
"output": "4 18"
}
] | 1,683,786,080
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
a=input()
b=[]
for i in a:
if i!= 'a' and i!='A' and i!= 'e' and i!='E' and i!= 'i' and i!='I' and i!= 'o' and i!='O' and i!= 'u'and i!='U' and i!= 'y'and i!='Y':
b.append(i.lower())
c=".".join(b)
c="."+c
print(c)
|
Title: Design Tutorial: Learn from Math
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
Input Specification:
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output Specification:
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
Demo Input:
['12\n', '15\n', '23\n', '1000000\n']
Demo Output:
['4 8\n', '6 9\n', '8 15\n', '500000 500000\n']
Note:
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
|
```python
a=input()
b=[]
for i in a:
if i!= 'a' and i!='A' and i!= 'e' and i!='E' and i!= 'i' and i!='I' and i!= 'o' and i!='O' and i!= 'u'and i!='U' and i!= 'y'and i!='Y':
b.append(i.lower())
c=".".join(b)
c="."+c
print(c)
```
| 0
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,677,965,659
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
s=input()
if("ll" in s):
if(s.index("h")<s.index("e")<s.index("ll")<s.index("o")):
print("YES")
else:
print("NO")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s=input()
if("ll" in s):
if(s.index("h")<s.index("e")<s.index("ll")<s.index("o")):
print("YES")
else:
print("NO")
else:
print("NO")
```
| 0
|
523
|
D
|
Statistics of Recompressing Videos
|
PROGRAMMING
| 1,600
|
[
"*special",
"data structures",
"implementation"
] | null | null |
A social network for dogs called DH (DogHouse) has *k* special servers to recompress uploaded videos of cute cats. After each video is uploaded, it should be recompressed on one (any) of the servers, and only after that it can be saved in the social network.
We know that each server takes one second to recompress a one minute fragment. Thus, any server takes *m* seconds to recompress a *m* minute video.
We know the time when each of the *n* videos were uploaded to the network (in seconds starting from the moment all servers started working). All videos appear at different moments of time and they are recompressed in the order they appear. If some video appeared at time *s*, then its recompressing can start at that very moment, immediately. Some videos can await recompressing when all the servers are busy. In this case, as soon as a server is available, it immediately starts recompressing another video. The videos that await recompressing go in a queue. If by the moment the videos started being recompressed some servers are available, then any of them starts recompressing the video.
For each video find the moment it stops being recompressed.
|
The first line of the input contains integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=5·105) — the number of videos and servers, respectively.
Next *n* lines contain the descriptions of the videos as pairs of integers *s**i*,<=*m**i* (1<=≤<=*s**i*,<=*m**i*<=≤<=109), where *s**i* is the time in seconds when the *i*-th video appeared and *m**i* is its duration in minutes. It is guaranteed that all the *s**i*'s are distinct and the videos are given in the chronological order of upload, that is in the order of increasing *s**i*.
|
Print *n* numbers *e*1,<=*e*2,<=...,<=*e**n*, where *e**i* is the time in seconds after the servers start working, when the *i*-th video will be recompressed.
|
[
"3 2\n1 5\n2 5\n3 5\n",
"6 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 3\n"
] |
[
"6\n7\n11\n",
"1000000001\n2000000001\n3000000001\n4000000001\n5000000001\n5000000004\n"
] |
none
| 2,000
|
[
{
"input": "3 2\n1 5\n2 5\n3 5",
"output": "6\n7\n11"
},
{
"input": "6 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 3",
"output": "1000000001\n2000000001\n3000000001\n4000000001\n5000000001\n5000000004"
},
{
"input": "1 1\n1 1",
"output": "2"
},
{
"input": "1 1\n1000000000 10000",
"output": "1000010000"
},
{
"input": "10 6\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n8 1\n9 1\n10 1",
"output": "2\n3\n4\n5\n6\n7\n8\n9\n10\n11"
},
{
"input": "10 4\n1 1\n2 2\n3 1\n4 1\n5 1\n6 1\n7 1\n8 2\n9 1\n10 1",
"output": "2\n4\n4\n5\n6\n7\n8\n10\n10\n11"
},
{
"input": "10 2\n1 5650\n2 4753\n3 7632\n4 688\n5 8853\n6 284\n7 4659\n8 5650\n9 9768\n10 3905",
"output": "5651\n4755\n12387\n6339\n15192\n12671\n17330\n20842\n27098\n24747"
},
{
"input": "10 8\n1 5036\n7 9294\n8 6011\n10 8273\n11 9203\n12 7037\n14 383\n16 4568\n18 8136\n19 8288",
"output": "5037\n9301\n6019\n8283\n9214\n7049\n397\n4584\n8533\n12872"
},
{
"input": "10 2\n4 2\n7 2\n8 2\n9 1\n10 2\n12 2\n14 1\n15 2\n17 2\n19 1",
"output": "6\n9\n10\n10\n12\n14\n15\n17\n19\n20"
},
{
"input": "10 7\n195901104 7859\n265432683 5489\n290824505 5754\n346976046 4969\n406206484 8390\n522669517 6810\n800443397 4979\n839536223 1825\n918231479 8117\n941210310 1322",
"output": "195908963\n265438172\n290830259\n346981015\n406214874\n522676327\n800448376\n839538048\n918239596\n941211632"
},
{
"input": "10 4\n126995987 385321200\n195616854 752754110\n197489309 899442094\n285439286 247570387\n308620877 957032819\n428385669 227675453\n673115425 94614781\n766412355 105231165\n943783548 855684033\n994356572 699602107",
"output": "512317187\n948370964\n1096931403\n533009673\n1469350006\n760685126\n855299907\n960531072\n1804054997\n1693958679"
},
{
"input": "10 10\n999999991 1000000000\n999999992 1000000000\n999999993 1000000000\n999999994 1000000000\n999999995 1000000000\n999999996 1000000000\n999999997 1000000000\n999999998 1000000000\n999999999 1000000000\n1000000000 1000000000",
"output": "1999999991\n1999999992\n1999999993\n1999999994\n1999999995\n1999999996\n1999999997\n1999999998\n1999999999\n2000000000"
}
] | 1,426,427,644
| 82,444
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 12
| 3,000
| 3,174,400
|
def add(x):
global h
h.append(x)
i = len(h) - 1
while h[i] < h[(i - 1) // 2] and i > 0:
h[i], h[(i - 1) // 2] = h[(i - 1) // 2], h[i]
i = (i - 1) // 2
def delete_min():
global h
x = h[0]
h[0] = h[- 1]
h.pop()
i = 0
while 2 * i + 1 < len(h):
j = i
if h[2 * i + 1] < h[j]:
j = 2 * i + 1
if 2 * i + 2 < len(h) and h[2 * i + 2] < h[j]:
j = 2 * i + 2
if i == j:
break
h[i], h[j] = h[j], h[i]
i = j
return(x)
n, k = map(int, input().rstrip().split())
h = [0] * k
for i in range(n):
s, m = map(int, input().rstrip().split())
x = delete_min()
print(max(s, x) + m)
add(max(s, x) + m)
|
Title: Statistics of Recompressing Videos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A social network for dogs called DH (DogHouse) has *k* special servers to recompress uploaded videos of cute cats. After each video is uploaded, it should be recompressed on one (any) of the servers, and only after that it can be saved in the social network.
We know that each server takes one second to recompress a one minute fragment. Thus, any server takes *m* seconds to recompress a *m* minute video.
We know the time when each of the *n* videos were uploaded to the network (in seconds starting from the moment all servers started working). All videos appear at different moments of time and they are recompressed in the order they appear. If some video appeared at time *s*, then its recompressing can start at that very moment, immediately. Some videos can await recompressing when all the servers are busy. In this case, as soon as a server is available, it immediately starts recompressing another video. The videos that await recompressing go in a queue. If by the moment the videos started being recompressed some servers are available, then any of them starts recompressing the video.
For each video find the moment it stops being recompressed.
Input Specification:
The first line of the input contains integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=5·105) — the number of videos and servers, respectively.
Next *n* lines contain the descriptions of the videos as pairs of integers *s**i*,<=*m**i* (1<=≤<=*s**i*,<=*m**i*<=≤<=109), where *s**i* is the time in seconds when the *i*-th video appeared and *m**i* is its duration in minutes. It is guaranteed that all the *s**i*'s are distinct and the videos are given in the chronological order of upload, that is in the order of increasing *s**i*.
Output Specification:
Print *n* numbers *e*1,<=*e*2,<=...,<=*e**n*, where *e**i* is the time in seconds after the servers start working, when the *i*-th video will be recompressed.
Demo Input:
['3 2\n1 5\n2 5\n3 5\n', '6 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 3\n']
Demo Output:
['6\n7\n11\n', '1000000001\n2000000001\n3000000001\n4000000001\n5000000001\n5000000004\n']
Note:
none
|
```python
def add(x):
global h
h.append(x)
i = len(h) - 1
while h[i] < h[(i - 1) // 2] and i > 0:
h[i], h[(i - 1) // 2] = h[(i - 1) // 2], h[i]
i = (i - 1) // 2
def delete_min():
global h
x = h[0]
h[0] = h[- 1]
h.pop()
i = 0
while 2 * i + 1 < len(h):
j = i
if h[2 * i + 1] < h[j]:
j = 2 * i + 1
if 2 * i + 2 < len(h) and h[2 * i + 2] < h[j]:
j = 2 * i + 2
if i == j:
break
h[i], h[j] = h[j], h[i]
i = j
return(x)
n, k = map(int, input().rstrip().split())
h = [0] * k
for i in range(n):
s, m = map(int, input().rstrip().split())
x = delete_min()
print(max(s, x) + m)
add(max(s, x) + m)
```
| 0
|
|
14
|
A
|
Letter
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Letter
|
1
|
64
|
A boy Bob likes to draw. Not long ago he bought a rectangular graph (checked) sheet with *n* rows and *m* columns. Bob shaded some of the squares on the sheet. Having seen his masterpiece, he decided to share it with his elder brother, who lives in Flatland. Now Bob has to send his picture by post, but because of the world economic crisis and high oil prices, he wants to send his creation, but to spend as little money as possible. For each sent square of paper (no matter whether it is shaded or not) Bob has to pay 3.14 burles. Please, help Bob cut out of his masterpiece a rectangle of the minimum cost, that will contain all the shaded squares. The rectangle's sides should be parallel to the sheet's sides.
|
The first line of the input data contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50), *n* — amount of lines, and *m* — amount of columns on Bob's sheet. The following *n* lines contain *m* characters each. Character «.» stands for a non-shaded square on the sheet, and «*» — for a shaded square. It is guaranteed that Bob has shaded at least one square.
|
Output the required rectangle of the minimum cost. Study the output data in the sample tests to understand the output format better.
|
[
"6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..\n",
"3 3\n***\n*.*\n***\n"
] |
[
"***\n*..\n***\n*..\n***\n",
"***\n*.*\n***\n"
] |
none
| 0
|
[
{
"input": "6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..",
"output": "***\n*..\n***\n*..\n***"
},
{
"input": "3 3\n***\n*.*\n***",
"output": "***\n*.*\n***"
},
{
"input": "1 1\n*",
"output": "*"
},
{
"input": "2 1\n*\n*",
"output": "*\n*"
},
{
"input": "5 1\n.\n*\n.\n.\n.",
"output": "*"
},
{
"input": "1 6\n*****.",
"output": "*****"
},
{
"input": "2 2\n..\n*.",
"output": "*"
},
{
"input": "8 2\n..\n..\n..\n..\n..\n*.\n..\n..",
"output": "*"
},
{
"input": "50 1\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "*\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*"
},
{
"input": "2 1\n*\n.",
"output": "*"
},
{
"input": "5 1\n*\n*\n*\n*\n*",
"output": "*\n*\n*\n*\n*"
},
{
"input": "2 2\n*.\n..",
"output": "*"
},
{
"input": "3 4\n...*\n*...\n..*.",
"output": "...*\n*...\n..*."
},
{
"input": "8 2\n**\n**\n**\n**\n**\n**\n**\n**",
"output": "**\n**\n**\n**\n**\n**\n**\n**"
},
{
"input": "50 1\n.\n*\n*\n*\n.\n.\n*\n.\n*\n*\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n.\n.\n*\n*\n.\n*\n*\n.\n.\n.\n.\n*\n*\n.\n.\n.\n.\n.\n.",
"output": "*\n*\n*\n.\n.\n*\n.\n*\n*\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n.\n.\n*\n*\n.\n*\n*\n.\n.\n.\n.\n*\n*"
}
] | 1,680,779,475
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 62
| 0
|
a,b = map(int,input().split())
c1 = []
d = 0
d1 = 0
c2 = 0
c = []
for i in range(a):
e = input()
c1.append(e)
for i in range(a):
if '*' in c1[i]:
c.append(c1[i])
for i in range(len(c)):
if c[i].find('*') > d:
d = c[i].find('*')
if c[i].rfind('*') > d1:
d1 = c[i].rfind('*')
for i in range(len(c)):
print(c[i][d:d1+1])
|
Title: Letter
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
A boy Bob likes to draw. Not long ago he bought a rectangular graph (checked) sheet with *n* rows and *m* columns. Bob shaded some of the squares on the sheet. Having seen his masterpiece, he decided to share it with his elder brother, who lives in Flatland. Now Bob has to send his picture by post, but because of the world economic crisis and high oil prices, he wants to send his creation, but to spend as little money as possible. For each sent square of paper (no matter whether it is shaded or not) Bob has to pay 3.14 burles. Please, help Bob cut out of his masterpiece a rectangle of the minimum cost, that will contain all the shaded squares. The rectangle's sides should be parallel to the sheet's sides.
Input Specification:
The first line of the input data contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50), *n* — amount of lines, and *m* — amount of columns on Bob's sheet. The following *n* lines contain *m* characters each. Character «.» stands for a non-shaded square on the sheet, and «*» — for a shaded square. It is guaranteed that Bob has shaded at least one square.
Output Specification:
Output the required rectangle of the minimum cost. Study the output data in the sample tests to understand the output format better.
Demo Input:
['6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..\n', '3 3\n***\n*.*\n***\n']
Demo Output:
['***\n*..\n***\n*..\n***\n', '***\n*.*\n***\n']
Note:
none
|
```python
a,b = map(int,input().split())
c1 = []
d = 0
d1 = 0
c2 = 0
c = []
for i in range(a):
e = input()
c1.append(e)
for i in range(a):
if '*' in c1[i]:
c.append(c1[i])
for i in range(len(c)):
if c[i].find('*') > d:
d = c[i].find('*')
if c[i].rfind('*') > d1:
d1 = c[i].rfind('*')
for i in range(len(c)):
print(c[i][d:d1+1])
```
| 0
|
586
|
A
|
Alena's Schedule
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying.
One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes).
The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks).
The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not.
Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university.
Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home.
Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
|
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university.
The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
|
Print a single number — the number of pairs during which Alena stays at the university.
|
[
"5\n0 1 0 1 1\n",
"7\n1 0 1 0 0 1 0\n",
"1\n0\n"
] |
[
"4\n",
"4\n",
"0\n"
] |
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair.
In the last sample Alena doesn't have a single pair, so she spends all the time at home.
| 500
|
[
{
"input": "5\n0 1 0 1 1",
"output": "4"
},
{
"input": "7\n1 0 1 0 0 1 0",
"output": "4"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "11\n0 0 0 0 0 0 0 0 0 0 1",
"output": "1"
},
{
"input": "12\n1 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0",
"output": "16"
},
{
"input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1",
"output": "28"
},
{
"input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0",
"output": "39"
},
{
"input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1",
"output": "52"
},
{
"input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1",
"output": "72"
},
{
"input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0",
"output": "65"
},
{
"input": "11\n0 1 1 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "11\n0 1 0 1 0 0 1 1 0 1 1",
"output": "8"
},
{
"input": "11\n1 0 1 0 1 1 0 1 1 1 0",
"output": "10"
},
{
"input": "11\n1 0 0 0 0 0 1 0 1 1 1",
"output": "6"
},
{
"input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0",
"output": "7"
},
{
"input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1",
"output": "16"
},
{
"input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1",
"output": "14"
},
{
"input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0",
"output": "26"
},
{
"input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1",
"output": "27"
},
{
"input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0",
"output": "25"
},
{
"input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1",
"output": "24"
},
{
"input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0",
"output": "19"
},
{
"input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1",
"output": "32"
},
{
"input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0",
"output": "23"
},
{
"input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1",
"output": "32"
},
{
"input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0",
"output": "23"
},
{
"input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1",
"output": "39"
},
{
"input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0",
"output": "32"
},
{
"input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1",
"output": "36"
},
{
"input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0",
"output": "41"
},
{
"input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1",
"output": "42"
},
{
"input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0",
"output": "46"
},
{
"input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1",
"output": "46"
},
{
"input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0",
"output": "47"
},
{
"input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1",
"output": "44"
},
{
"input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0",
"output": "45"
},
{
"input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1",
"output": "51"
},
{
"input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0",
"output": "44"
},
{
"input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0",
"output": "53"
},
{
"input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1",
"output": "63"
},
{
"input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0",
"output": "56"
},
{
"input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "58"
},
{
"input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0",
"output": "65"
},
{
"input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1",
"output": "77"
},
{
"input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "90"
},
{
"input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "95"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
}
] | 1,447,480,053
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 16
| 61
| 0
|
def main():
input()
s = input()
s = s[s.find("1"): s.rfind("1") + 1:2]
print(len(s) - s.replace("010", "0110").replace("101", "").count("0"))
if __name__ == '__main__':
main()
|
Title: Alena's Schedule
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying.
One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes).
The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks).
The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not.
Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university.
Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home.
Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university.
The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Output Specification:
Print a single number — the number of pairs during which Alena stays at the university.
Demo Input:
['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n']
Demo Output:
['4\n', '4\n', '0\n']
Note:
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair.
In the last sample Alena doesn't have a single pair, so she spends all the time at home.
|
```python
def main():
input()
s = input()
s = s[s.find("1"): s.rfind("1") + 1:2]
print(len(s) - s.replace("010", "0110").replace("101", "").count("0"))
if __name__ == '__main__':
main()
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,673,275,408
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 0
|
x= input('')
l = 0
u = 0
for i in x :
if i.isupper() :
u += 1
elif i.islower():
l += 1
if u > l :
print(x.upper())
elif l > u or l == u :
print(x.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
x= input('')
l = 0
u = 0
for i in x :
if i.isupper() :
u += 1
elif i.islower():
l += 1
if u > l :
print(x.upper())
elif l > u or l == u :
print(x.lower())
```
| 3.969
|
716
|
A
|
Crazy Computer
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
|
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
|
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
|
[
"6 5\n1 3 8 14 19 20\n",
"6 1\n1 3 5 7 9 10\n"
] |
[
"3",
"2"
] |
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
| 500
|
[
{
"input": "6 5\n1 3 8 14 19 20",
"output": "3"
},
{
"input": "6 1\n1 3 5 7 9 10",
"output": "2"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 7 12 13 14",
"output": "4"
},
{
"input": "2 1000000000\n1 1000000000",
"output": "2"
},
{
"input": "3 5\n1 10 20",
"output": "1"
},
{
"input": "3 10\n1 2 3",
"output": "3"
},
{
"input": "2 1\n1 100",
"output": "1"
},
{
"input": "3 1\n1 2 10",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
}
] | 1,560,767,311
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 186
| 8,499,200
|
n,c=map(int,input().split(' '))
l=list(map(int,input().split(' ')))
s=1
for i in range(1,len(l)):
if (l[i]-l[i-1])<=c:
s=s+1
else:
s=1
print(s)
|
Title: Crazy Computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Output Specification:
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
Demo Input:
['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n']
Demo Output:
['3', '2']
Note:
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
|
```python
n,c=map(int,input().split(' '))
l=list(map(int,input().split(' ')))
s=1
for i in range(1,len(l)):
if (l[i]-l[i-1])<=c:
s=s+1
else:
s=1
print(s)
```
| 3
|
|
768
|
B
|
Code For 1
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"dfs and similar",
"divide and conquer"
] | null | null |
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
|
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
|
Output the total number of 1s in the range *l* to *r* in the final sequence.
|
[
"7 2 5\n",
"10 3 10\n"
] |
[
"4\n",
"5\n"
] |
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
| 1,000
|
[
{
"input": "7 2 5",
"output": "4"
},
{
"input": "10 3 10",
"output": "5"
},
{
"input": "56 18 40",
"output": "20"
},
{
"input": "203 40 124",
"output": "67"
},
{
"input": "903316762502 354723010040 354723105411",
"output": "78355"
},
{
"input": "33534354842198 32529564319236 32529564342569",
"output": "22239"
},
{
"input": "62518534961045 50734311240112 50734311287877",
"output": "42439"
},
{
"input": "95173251245550 106288351347530 106288351372022",
"output": "16565"
},
{
"input": "542 321 956",
"output": "336"
},
{
"input": "3621 237 2637",
"output": "2124"
},
{
"input": "9056 336 896",
"output": "311"
},
{
"input": "36007 368 24490",
"output": "13253"
},
{
"input": "244269 149154 244246",
"output": "88609"
},
{
"input": "880234 669493 757150",
"output": "73585"
},
{
"input": "3740160 1031384 1104236",
"output": "64965"
},
{
"input": "11586121 15337246 15397874",
"output": "41868"
},
{
"input": "38658997 35923164 35985664",
"output": "36004"
},
{
"input": "192308932 207804787 207866400",
"output": "44142"
},
{
"input": "950099012 175922161 176000556",
"output": "69369"
},
{
"input": "2787326787 3799676481 3799680514",
"output": "2618"
},
{
"input": "14417262581 8527979363 8528075536",
"output": "80707"
},
{
"input": "39889373539 7747197212 7747278363",
"output": "47105"
},
{
"input": "251772781087 70597428577 70597479816",
"output": "46933"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "3 2 3",
"output": "2"
},
{
"input": "14 7 12",
"output": "5"
},
{
"input": "1125899906842623 1 100001",
"output": "100001"
},
{
"input": "1125899906842623 1125899906742623 1125899906842623",
"output": "100001"
},
{
"input": "1000 1 1023",
"output": "1000"
},
{
"input": "281474976710656 17179869184 17179869186",
"output": "1"
},
{
"input": "2 2 2",
"output": "0"
},
{
"input": "3 2 2",
"output": "1"
}
] | 1,697,730,867
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 62
| 0
|
def func(n, len, pos):
if r < pos - len// 2 or pos + len // 2 < l:
return 0
if len== 1:
return n % 2
dis = (len + 1) // 4
if l <= pos <= r:
return func(n // 2, len // 2, pos - dis) + n % 2 + func(n // 2, len // 2, pos + dis)
if r < pos:
return func(n // 2, len // 2, pos - dis)
if pos < l:
return func(n // 2, len // 2, pos + dis)
def main(n,l,r):
length = 0
i = 0
while 2 ** i <= n:
length += 2 ** i
i += 1
print(func(n, length, (1 + length) // 2))
if __name__=="__main__":
n, l, r = map(int, input().split())
main(n,l,r)
|
Title: Code For 1
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
Input Specification:
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
Output Specification:
Output the total number of 1s in the range *l* to *r* in the final sequence.
Demo Input:
['7 2 5\n', '10 3 10\n']
Demo Output:
['4\n', '5\n']
Note:
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
|
```python
def func(n, len, pos):
if r < pos - len// 2 or pos + len // 2 < l:
return 0
if len== 1:
return n % 2
dis = (len + 1) // 4
if l <= pos <= r:
return func(n // 2, len // 2, pos - dis) + n % 2 + func(n // 2, len // 2, pos + dis)
if r < pos:
return func(n // 2, len // 2, pos - dis)
if pos < l:
return func(n // 2, len // 2, pos + dis)
def main(n,l,r):
length = 0
i = 0
while 2 ** i <= n:
length += 2 ** i
i += 1
print(func(n, length, (1 + length) // 2))
if __name__=="__main__":
n, l, r = map(int, input().split())
main(n,l,r)
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,525,448,326
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 80
| 186
| 7,065,600
|
n = int(input())
i = 0
sum = 0
while i < n:
x, y, z = [int(i) for i in input().split()]
sum += x + y + z
i += 1
if sum == 0:
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n = int(input())
i = 0
sum = 0
while i < n:
x, y, z = [int(i) for i in input().split()]
sum += x + y + z
i += 1
if sum == 0:
print("YES")
else:
print("NO")
```
| 0
|
898
|
A
|
Rounding
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
|
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
|
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
|
[
"5\n",
"113\n",
"1000000000\n",
"5432359\n"
] |
[
"0\n",
"110\n",
"1000000000\n",
"5432360\n"
] |
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
| 500
|
[
{
"input": "5",
"output": "0"
},
{
"input": "113",
"output": "110"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "5432359",
"output": "5432360"
},
{
"input": "999999994",
"output": "999999990"
},
{
"input": "10",
"output": "10"
},
{
"input": "9",
"output": "10"
},
{
"input": "1",
"output": "0"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "6",
"output": "10"
},
{
"input": "7",
"output": "10"
},
{
"input": "8",
"output": "10"
},
{
"input": "19",
"output": "20"
},
{
"input": "100",
"output": "100"
},
{
"input": "997",
"output": "1000"
},
{
"input": "9994",
"output": "9990"
},
{
"input": "10002",
"output": "10000"
},
{
"input": "100000",
"output": "100000"
},
{
"input": "99999",
"output": "100000"
},
{
"input": "999999999",
"output": "1000000000"
},
{
"input": "999999998",
"output": "1000000000"
},
{
"input": "999999995",
"output": "999999990"
},
{
"input": "999999990",
"output": "999999990"
},
{
"input": "1000000",
"output": "1000000"
},
{
"input": "1000010",
"output": "1000010"
},
{
"input": "10000010",
"output": "10000010"
},
{
"input": "100000011",
"output": "100000010"
},
{
"input": "400000003",
"output": "400000000"
},
{
"input": "234234",
"output": "234230"
},
{
"input": "675621",
"output": "675620"
},
{
"input": "43532",
"output": "43530"
},
{
"input": "4576453",
"output": "4576450"
},
{
"input": "65754674",
"output": "65754670"
},
{
"input": "3245526",
"output": "3245530"
},
{
"input": "123445",
"output": "123440"
},
{
"input": "234217",
"output": "234220"
},
{
"input": "23451218",
"output": "23451220"
},
{
"input": "1231239",
"output": "1231240"
},
{
"input": "1923140",
"output": "1923140"
},
{
"input": "307910310",
"output": "307910310"
},
{
"input": "780961030",
"output": "780961030"
},
{
"input": "103509421",
"output": "103509420"
},
{
"input": "576560141",
"output": "576560140"
},
{
"input": "48851642",
"output": "48851640"
},
{
"input": "226935072",
"output": "226935070"
},
{
"input": "844450763",
"output": "844450760"
},
{
"input": "22534183",
"output": "22534180"
},
{
"input": "640049874",
"output": "640049870"
},
{
"input": "818133304",
"output": "818133300"
},
{
"input": "730616285",
"output": "730616280"
},
{
"input": "613732415",
"output": "613732410"
},
{
"input": "380991216",
"output": "380991220"
},
{
"input": "559074636",
"output": "559074640"
},
{
"input": "176590327",
"output": "176590330"
},
{
"input": "354673757",
"output": "354673760"
},
{
"input": "267156738",
"output": "267156740"
},
{
"input": "150272868",
"output": "150272870"
},
{
"input": "62755859",
"output": "62755860"
},
{
"input": "945871979",
"output": "945871980"
},
{
"input": "46",
"output": "50"
},
{
"input": "999",
"output": "1000"
},
{
"input": "1397",
"output": "1400"
}
] | 1,656,312,482
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 64
| 46
| 4,300,800
|
n=int(input())
a=n%10
if a>5:
b=10-a
x=n+b
print(x)
else:
x=n-a
print(x)
|
Title: Rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
Input Specification:
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
Output Specification:
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
Demo Input:
['5\n', '113\n', '1000000000\n', '5432359\n']
Demo Output:
['0\n', '110\n', '1000000000\n', '5432360\n']
Note:
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10.
|
```python
n=int(input())
a=n%10
if a>5:
b=10-a
x=n+b
print(x)
else:
x=n-a
print(x)
```
| 3
|
|
407
|
B
|
Long Path
|
PROGRAMMING
| 1,600
|
[
"dp",
"implementation"
] | null | null |
One day, little Vasya found himself in a maze consisting of (*n*<=+<=1) rooms, numbered from 1 to (*n*<=+<=1). Initially, Vasya is at the first room and to get out of the maze, he needs to get to the (*n*<=+<=1)-th one.
The maze is organized as follows. Each room of the maze has two one-way portals. Let's consider room number *i* (1<=≤<=*i*<=≤<=*n*), someone can use the first portal to move from it to room number (*i*<=+<=1), also someone can use the second portal to move from it to room number *p**i*, where 1<=≤<=*p**i*<=≤<=*i*.
In order not to get lost, Vasya decided to act as follows.
- Each time Vasya enters some room, he paints a cross on its ceiling. Initially, Vasya paints a cross at the ceiling of room 1. - Let's assume that Vasya is in room *i* and has already painted a cross on its ceiling. Then, if the ceiling now contains an odd number of crosses, Vasya uses the second portal (it leads to room *p**i*), otherwise Vasya uses the first portal.
Help Vasya determine the number of times he needs to use portals to get to room (*n*<=+<=1) in the end.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=103) — the number of rooms. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*i*). Each *p**i* denotes the number of the room, that someone can reach, if he will use the second portal in the *i*-th room.
|
Print a single number — the number of portal moves the boy needs to go out of the maze. As the number can be rather large, print it modulo 1000000007 (109<=+<=7).
|
[
"2\n1 2\n",
"4\n1 1 2 3\n",
"5\n1 1 1 1 1\n"
] |
[
"4\n",
"20\n",
"62\n"
] |
none
| 1,000
|
[
{
"input": "2\n1 2",
"output": "4"
},
{
"input": "4\n1 1 2 3",
"output": "20"
},
{
"input": "5\n1 1 1 1 1",
"output": "62"
},
{
"input": "7\n1 2 1 3 1 2 1",
"output": "154"
},
{
"input": "1\n1",
"output": "2"
},
{
"input": "3\n1 1 3",
"output": "8"
},
{
"input": "10\n1 1 3 2 2 1 3 4 7 5",
"output": "858"
},
{
"input": "20\n1 2 2 2 2 1 4 7 8 6 5 3 5 3 8 11 5 10 16 10",
"output": "433410"
},
{
"input": "32\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "589934534"
},
{
"input": "10\n1 1 3 2 2 1 3 4 7 5",
"output": "858"
},
{
"input": "30\n1 1 2 2 5 6 4 3 4 7 3 5 12 12 2 15 3 8 3 10 12 3 14 1 10 4 22 11 22 27",
"output": "132632316"
},
{
"input": "70\n1 1 2 3 4 3 5 2 2 4 8 6 13 6 13 3 5 4 5 10 11 9 11 8 12 24 21 6 9 29 25 31 17 27 3 17 35 5 21 11 27 14 33 7 33 44 22 33 21 11 38 46 53 46 3 22 5 27 55 22 41 25 56 61 27 28 11 66 68 13",
"output": "707517223"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "2046"
},
{
"input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "2097150"
},
{
"input": "102\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "810970229"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "20"
},
{
"input": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20",
"output": "40"
},
{
"input": "107\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107",
"output": "214"
},
{
"input": "129\n1 1 3 3 1 4 7 4 3 5 8 11 3 9 15 4 11 17 1 6 18 9 11 13 17 22 8 18 26 13 16 20 3 16 35 26 23 28 27 30 39 29 43 8 14 6 17 32 26 31 2 18 3 47 52 21 57 1 35 35 53 47 16 26 30 65 48 2 32 11 10 5 4 1 4 53 71 21 53 8 58 49 17 6 19 80 1 49 43 60 12 60 35 25 86 45 47 97 52 74 10 91 93 31 69 41 80 90 67 4 94 92 82 36 27 18 65 8 45 90 42 115 34 61 16 97 20 43 104",
"output": "931883285"
},
{
"input": "100\n1 1 3 1 5 1 1 1 8 9 7 3 11 11 15 14 4 10 11 12 1 10 13 11 7 23 8 12 18 23 27 17 14 29 1 33 5 24 26 29 25 14 40 8 43 29 43 40 34 18 21 31 3 8 20 14 28 29 3 54 14 3 59 1 45 9 13 11 50 48 26 57 17 33 9 52 21 46 24 20 16 58 69 77 52 36 80 2 31 3 44 36 64 90 84 8 21 25 65 67",
"output": "264413610"
},
{
"input": "31\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 29",
"output": "758096363"
},
{
"input": "104\n1 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102",
"output": "740446116"
}
] | 1,632,633,206
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 93
| 20,172,800
|
def f(s):
return int(s)-1
n = int(input())
mod = 10**9+7
arr = list(map(f,input().split()))
dp=[0]*(n+1)
for i in range(n):
dp[i+1] = dp[i]+2+dp[i]-dp[arr[i]]
dp[i+1]%=mod
print(dp[-1])
|
Title: Long Path
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, little Vasya found himself in a maze consisting of (*n*<=+<=1) rooms, numbered from 1 to (*n*<=+<=1). Initially, Vasya is at the first room and to get out of the maze, he needs to get to the (*n*<=+<=1)-th one.
The maze is organized as follows. Each room of the maze has two one-way portals. Let's consider room number *i* (1<=≤<=*i*<=≤<=*n*), someone can use the first portal to move from it to room number (*i*<=+<=1), also someone can use the second portal to move from it to room number *p**i*, where 1<=≤<=*p**i*<=≤<=*i*.
In order not to get lost, Vasya decided to act as follows.
- Each time Vasya enters some room, he paints a cross on its ceiling. Initially, Vasya paints a cross at the ceiling of room 1. - Let's assume that Vasya is in room *i* and has already painted a cross on its ceiling. Then, if the ceiling now contains an odd number of crosses, Vasya uses the second portal (it leads to room *p**i*), otherwise Vasya uses the first portal.
Help Vasya determine the number of times he needs to use portals to get to room (*n*<=+<=1) in the end.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=103) — the number of rooms. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*i*). Each *p**i* denotes the number of the room, that someone can reach, if he will use the second portal in the *i*-th room.
Output Specification:
Print a single number — the number of portal moves the boy needs to go out of the maze. As the number can be rather large, print it modulo 1000000007 (109<=+<=7).
Demo Input:
['2\n1 2\n', '4\n1 1 2 3\n', '5\n1 1 1 1 1\n']
Demo Output:
['4\n', '20\n', '62\n']
Note:
none
|
```python
def f(s):
return int(s)-1
n = int(input())
mod = 10**9+7
arr = list(map(f,input().split()))
dp=[0]*(n+1)
for i in range(n):
dp[i+1] = dp[i]+2+dp[i]-dp[arr[i]]
dp[i+1]%=mod
print(dp[-1])
```
| 3
|
|
1
|
B
|
Spreadsheet
|
PROGRAMMING
| 1,600
|
[
"implementation",
"math"
] |
B. Spreadsheets
|
10
|
64
|
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second — number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 — AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc.
The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23.
Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example.
Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
|
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
|
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
|
[
"2\nR23C55\nBC23\n"
] |
[
"BC23\nR23C55\n"
] |
none
| 0
|
[
{
"input": "2\nR23C55\nBC23",
"output": "BC23\nR23C55"
},
{
"input": "1\nA1",
"output": "R1C1"
},
{
"input": "5\nR8C3\nD1\nR7C2\nR8C9\nR8C9",
"output": "C8\nR1C4\nB7\nI8\nI8"
},
{
"input": "4\nR4C25\nR90C35\nAP55\nX83",
"output": "Y4\nAI90\nR55C42\nR83C24"
},
{
"input": "10\nR50C12\nR23C47\nY96\nR44C13\nR19C21\nR95C73\nBK12\nR51C74\nAY34\nR63C25",
"output": "L50\nAU23\nR96C25\nM44\nU19\nBU95\nR12C63\nBV51\nR34C51\nY63"
}
] | 1,692,679,118
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 102,400
|
resultados = []
alfabeto = 'ABCDEFGHIJKLMNOPQRSTUVWXYZ'
n = int(input())
for x in range(n):
posi = input()
resposta = []
a = True
if posi[0] == 'R'and posi.find('C') != -1:
for y in range(1, posi.find('C')):
if not int(posi[y]) >= 0 :
a = False
break
else:
a = False
if a == True:
valorf = int(posi[posi.find('C')+1:])
valori = int(posi[1:posi.find('C')])
quant = int(valori**(1/26))
i = 0
while len(resposta) < quant +1:
resposta.append(valorf//(26**(quant-i)))
valorf = valorf%(26**quant-i)
i += 1
for y in range(len(resposta)):
resposta[y] = alfabeto[resposta[y]-1]
resposta.append(str(valori))
resultados.append(''.join(resposta))
else:
resposta.append('R')
for y in range(len(posi)):
if posi[y] not in alfabeto:
resposta.append(posi[y:])
del(posi[y:])
break
resposta.append('C')
valor = 0
for y in range(len(posi)):
valor += (26**(len(posi)-y-1))*(alfabeto.find(posi[y])+1)
resposta.append(str(valor))
resultados.append(''.join(resposta))
for x in resultados:
print(x)
|
Title: Spreadsheet
Time Limit: 10 seconds
Memory Limit: 64 megabytes
Problem Description:
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second — number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 — AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc.
The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23.
Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example.
Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
Input Specification:
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
Output Specification:
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
Demo Input:
['2\nR23C55\nBC23\n']
Demo Output:
['BC23\nR23C55\n']
Note:
none
|
```python
resultados = []
alfabeto = 'ABCDEFGHIJKLMNOPQRSTUVWXYZ'
n = int(input())
for x in range(n):
posi = input()
resposta = []
a = True
if posi[0] == 'R'and posi.find('C') != -1:
for y in range(1, posi.find('C')):
if not int(posi[y]) >= 0 :
a = False
break
else:
a = False
if a == True:
valorf = int(posi[posi.find('C')+1:])
valori = int(posi[1:posi.find('C')])
quant = int(valori**(1/26))
i = 0
while len(resposta) < quant +1:
resposta.append(valorf//(26**(quant-i)))
valorf = valorf%(26**quant-i)
i += 1
for y in range(len(resposta)):
resposta[y] = alfabeto[resposta[y]-1]
resposta.append(str(valori))
resultados.append(''.join(resposta))
else:
resposta.append('R')
for y in range(len(posi)):
if posi[y] not in alfabeto:
resposta.append(posi[y:])
del(posi[y:])
break
resposta.append('C')
valor = 0
for y in range(len(posi)):
valor += (26**(len(posi)-y-1))*(alfabeto.find(posi[y])+1)
resposta.append(str(valor))
resultados.append(''.join(resposta))
for x in resultados:
print(x)
```
| -1
|
122
|
A
|
Lucky Division
|
PROGRAMMING
| 1,000
|
[
"brute force",
"number theory"
] | null | null |
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
|
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
|
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
|
[
"47\n",
"16\n",
"78\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
| 500
|
[
{
"input": "47",
"output": "YES"
},
{
"input": "16",
"output": "YES"
},
{
"input": "78",
"output": "NO"
},
{
"input": "48",
"output": "YES"
},
{
"input": "100",
"output": "YES"
},
{
"input": "107",
"output": "NO"
},
{
"input": "77",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "480",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "49",
"output": "YES"
},
{
"input": "56",
"output": "YES"
},
{
"input": "124",
"output": "YES"
},
{
"input": "1000",
"output": "YES"
},
{
"input": "999",
"output": "NO"
},
{
"input": "298",
"output": "NO"
},
{
"input": "274",
"output": "NO"
},
{
"input": "998",
"output": "NO"
},
{
"input": "42",
"output": "YES"
},
{
"input": "788",
"output": "YES"
},
{
"input": "70",
"output": "YES"
},
{
"input": "444",
"output": "YES"
},
{
"input": "777",
"output": "YES"
},
{
"input": "799",
"output": "YES"
},
{
"input": "25",
"output": "NO"
},
{
"input": "882",
"output": "YES"
},
{
"input": "88",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "7",
"output": "YES"
},
{
"input": "8",
"output": "YES"
},
{
"input": "94",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "141",
"output": "YES"
}
] | 1,692,814,867
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 92
| 0
|
def check_lucky(val):
check = False
if len(str(val)) < 2:
if val == 4 or val == 7:
check = True
else:
val = list(set(str(val)))
if len(val) != 2:
check = False
else:
if (val[0] == "4" or val[0] == "7") and (val[1] == "4" or val[1] == "7"):
check = True
else:
check = False
return check
n = int(input())
set_check = False
for i in range(1,n+1):
check_num = check_lucky(i)
if check_num:
if n % i == 0:
print("YES")
set_check = True
break
if not set_check:
print("NO")
|
Title: Lucky Division
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
Output Specification:
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
Demo Input:
['47\n', '16\n', '78\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
|
```python
def check_lucky(val):
check = False
if len(str(val)) < 2:
if val == 4 or val == 7:
check = True
else:
val = list(set(str(val)))
if len(val) != 2:
check = False
else:
if (val[0] == "4" or val[0] == "7") and (val[1] == "4" or val[1] == "7"):
check = True
else:
check = False
return check
n = int(input())
set_check = False
for i in range(1,n+1):
check_num = check_lucky(i)
if check_num:
if n % i == 0:
print("YES")
set_check = True
break
if not set_check:
print("NO")
```
| 3
|
|
82
|
A
|
Double Cola
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] |
A. Double Cola
|
1
|
256
|
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
|
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
|
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
|
[
"1\n",
"6\n",
"1802\n"
] |
[
"Sheldon\n",
"Sheldon\n",
"Penny\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "Sheldon"
},
{
"input": "6",
"output": "Sheldon"
},
{
"input": "1802",
"output": "Penny"
},
{
"input": "1",
"output": "Sheldon"
},
{
"input": "2",
"output": "Leonard"
},
{
"input": "3",
"output": "Penny"
},
{
"input": "4",
"output": "Rajesh"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "10",
"output": "Penny"
},
{
"input": "534",
"output": "Rajesh"
},
{
"input": "5033",
"output": "Howard"
},
{
"input": "10010",
"output": "Howard"
},
{
"input": "500000000",
"output": "Penny"
},
{
"input": "63",
"output": "Rajesh"
},
{
"input": "841",
"output": "Leonard"
},
{
"input": "3667",
"output": "Penny"
},
{
"input": "38614",
"output": "Howard"
},
{
"input": "282798",
"output": "Rajesh"
},
{
"input": "9266286",
"output": "Rajesh"
},
{
"input": "27385966",
"output": "Leonard"
},
{
"input": "121580142",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "300",
"output": "Howard"
},
{
"input": "1745",
"output": "Leonard"
},
{
"input": "8302",
"output": "Rajesh"
},
{
"input": "184518",
"output": "Sheldon"
},
{
"input": "1154414",
"output": "Rajesh"
},
{
"input": "28643950",
"output": "Leonard"
},
{
"input": "159222638",
"output": "Howard"
},
{
"input": "24",
"output": "Penny"
},
{
"input": "505",
"output": "Penny"
},
{
"input": "4425",
"output": "Rajesh"
},
{
"input": "12079",
"output": "Sheldon"
},
{
"input": "469726",
"output": "Penny"
},
{
"input": "3961838",
"output": "Penny"
},
{
"input": "57710446",
"output": "Leonard"
},
{
"input": "80719470",
"output": "Howard"
},
{
"input": "1000000000",
"output": "Penny"
},
{
"input": "999999999",
"output": "Penny"
},
{
"input": "999999998",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
}
] | 1,518,450,941
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 46
| 5,632,000
|
n = int(input())
m = 5
while n>m:
n-=m
m=m*2
l=['Sheldon','Leonard','Penny','Rajesh','Howard']
print(l[(5*n-1)//5])
|
Title: Double Cola
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
Input Specification:
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Output Specification:
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
Demo Input:
['1\n', '6\n', '1802\n']
Demo Output:
['Sheldon\n', 'Sheldon\n', 'Penny\n']
Note:
none
|
```python
n = int(input())
m = 5
while n>m:
n-=m
m=m*2
l=['Sheldon','Leonard','Penny','Rajesh','Howard']
print(l[(5*n-1)//5])
```
| -1
|
696
|
A
|
Lorenzo Von Matterhorn
|
PROGRAMMING
| 1,500
|
[
"brute force",
"data structures",
"implementation",
"trees"
] | null | null |
Barney lives in NYC. NYC has infinite number of intersections numbered with positive integers starting from 1. There exists a bidirectional road between intersections *i* and 2*i* and another road between *i* and 2*i*<=+<=1 for every positive integer *i*. You can clearly see that there exists a unique shortest path between any two intersections.
Initially anyone can pass any road for free. But since SlapsGiving is ahead of us, there will *q* consecutive events happen soon. There are two types of events:
1. Government makes a new rule. A rule can be denoted by integers *v*, *u* and *w*. As the result of this action, the passing fee of all roads on the shortest path from *u* to *v* increases by *w* dollars.
2. Barney starts moving from some intersection *v* and goes to intersection *u* where there's a girl he wants to cuddle (using his fake name Lorenzo Von Matterhorn). He always uses the shortest path (visiting minimum number of intersections or roads) between two intersections.
Government needs your calculations. For each time Barney goes to cuddle a girl, you need to tell the government how much money he should pay (sum of passing fee of all roads he passes).
|
The first line of input contains a single integer *q* (1<=≤<=*q*<=≤<=1<=000).
The next *q* lines contain the information about the events in chronological order. Each event is described in form 1 *v* *u* *w* if it's an event when government makes a new rule about increasing the passing fee of all roads on the shortest path from *u* to *v* by *w* dollars, or in form 2 *v* *u* if it's an event when Barnie goes to cuddle from the intersection *v* to the intersection *u*.
1<=≤<=*v*,<=*u*<=≤<=1018,<=*v*<=≠<=*u*,<=1<=≤<=*w*<=≤<=109 states for every description line.
|
For each event of second type print the sum of passing fee of all roads Barney passes in this event, in one line. Print the answers in chronological order of corresponding events.
|
[
"7\n1 3 4 30\n1 4 1 2\n1 3 6 8\n2 4 3\n1 6 1 40\n2 3 7\n2 2 4\n"
] |
[
"94\n0\n32\n"
] |
In the example testcase:
Here are the intersections used:
1. Intersections on the path are 3, 1, 2 and 4. 1. Intersections on the path are 4, 2 and 1. 1. Intersections on the path are only 3 and 6. 1. Intersections on the path are 4, 2, 1 and 3. Passing fee of roads on the path are 32, 32 and 30 in order. So answer equals to 32 + 32 + 30 = 94. 1. Intersections on the path are 6, 3 and 1. 1. Intersections on the path are 3 and 7. Passing fee of the road between them is 0. 1. Intersections on the path are 2 and 4. Passing fee of the road between them is 32 (increased by 30 in the first event and by 2 in the second).
| 500
|
[
{
"input": "7\n1 3 4 30\n1 4 1 2\n1 3 6 8\n2 4 3\n1 6 1 40\n2 3 7\n2 2 4",
"output": "94\n0\n32"
},
{
"input": "1\n2 666077344481199252 881371880336470888",
"output": "0"
},
{
"input": "10\n1 1 63669439577744021 396980128\n1 2582240553355225 63669439577744021 997926286\n1 2582240553355225 1 619026011\n1 1 4 231881718\n2 63669439577744021 3886074192977\n2 4 63669439577744021\n2 124354374175272 10328962213420903\n1 10328962213420903 3886074192977 188186816\n1 124354374175272 31088593543820 705639304\n2 2582240553355225 254677758310976084",
"output": "19528689796\n80417520800\n140119493557\n179078288337"
},
{
"input": "10\n1 1 399719082491 159376944\n1 186 1 699740230\n2 410731850987390 1\n1 410731850987390 399719082491 699271234\n1 1 186 255736462\n1 1 186 544477714\n1 399719082491 410731850987390 366708275\n2 1 186\n2 410731850987390 1\n2 399719082491 186",
"output": "6013820218\n11615319450\n55320479319\n37986050043"
},
{
"input": "10\n2 37526406560905229 37526426361107171\n2 37526424114740747 18763396439955441\n2 300485276957081578 301492476099962199\n1 75035386466351570 441803674395985082 642312512\n2 300197522144700185 220954108245114486\n1 150105696341181576 559187296 100113944\n1 300197522135707767 150242638470761995 170574370\n2 150105691058036871 220954108245108400\n2 37560659619635168 150070774425697078\n2 18780329809814344 300222324900057526",
"output": "0\n0\n0\n13488562752\n14270974176\n13899046930\n5418394872"
},
{
"input": "1\n2 1 343417335313797025",
"output": "0"
},
{
"input": "2\n1 562949953421312 562949953421311 1\n2 562949953421312 562949953421311",
"output": "97"
},
{
"input": "2\n1 100 50 1\n2 4294967396 1",
"output": "0"
},
{
"input": "2\n1 4294967298 4294967299 10\n2 2 3",
"output": "0"
},
{
"input": "2\n1 500000000000 250000000000 1\n2 1783793664 891896832",
"output": "0"
},
{
"input": "2\n1 100000000000000 200000000000000 1\n2 276447232 552894464",
"output": "0"
},
{
"input": "2\n1 2147540141 4295080282 1\n2 1 112986",
"output": "0"
},
{
"input": "2\n1 239841676148963 1 20\n2 2112405731 1",
"output": "20"
}
] | 1,551,600,740
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 187
| 8,601,600
|
n=int(input())
d={}
def lca(u,v,w) :
res=0
while u!=v :
if u<v :
v,u=u,v
d[u]=d.get(u,0)+w
res+=d[u]
u=u//2
return res
for i in range(n) :
l=list(map(int,input().split()))
if l[0]==1 :
lca(l[1],l[2],l[3])
else :
print(lca(l[1],l[2],0))
|
Title: Lorenzo Von Matterhorn
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Barney lives in NYC. NYC has infinite number of intersections numbered with positive integers starting from 1. There exists a bidirectional road between intersections *i* and 2*i* and another road between *i* and 2*i*<=+<=1 for every positive integer *i*. You can clearly see that there exists a unique shortest path between any two intersections.
Initially anyone can pass any road for free. But since SlapsGiving is ahead of us, there will *q* consecutive events happen soon. There are two types of events:
1. Government makes a new rule. A rule can be denoted by integers *v*, *u* and *w*. As the result of this action, the passing fee of all roads on the shortest path from *u* to *v* increases by *w* dollars.
2. Barney starts moving from some intersection *v* and goes to intersection *u* where there's a girl he wants to cuddle (using his fake name Lorenzo Von Matterhorn). He always uses the shortest path (visiting minimum number of intersections or roads) between two intersections.
Government needs your calculations. For each time Barney goes to cuddle a girl, you need to tell the government how much money he should pay (sum of passing fee of all roads he passes).
Input Specification:
The first line of input contains a single integer *q* (1<=≤<=*q*<=≤<=1<=000).
The next *q* lines contain the information about the events in chronological order. Each event is described in form 1 *v* *u* *w* if it's an event when government makes a new rule about increasing the passing fee of all roads on the shortest path from *u* to *v* by *w* dollars, or in form 2 *v* *u* if it's an event when Barnie goes to cuddle from the intersection *v* to the intersection *u*.
1<=≤<=*v*,<=*u*<=≤<=1018,<=*v*<=≠<=*u*,<=1<=≤<=*w*<=≤<=109 states for every description line.
Output Specification:
For each event of second type print the sum of passing fee of all roads Barney passes in this event, in one line. Print the answers in chronological order of corresponding events.
Demo Input:
['7\n1 3 4 30\n1 4 1 2\n1 3 6 8\n2 4 3\n1 6 1 40\n2 3 7\n2 2 4\n']
Demo Output:
['94\n0\n32\n']
Note:
In the example testcase:
Here are the intersections used:
1. Intersections on the path are 3, 1, 2 and 4. 1. Intersections on the path are 4, 2 and 1. 1. Intersections on the path are only 3 and 6. 1. Intersections on the path are 4, 2, 1 and 3. Passing fee of roads on the path are 32, 32 and 30 in order. So answer equals to 32 + 32 + 30 = 94. 1. Intersections on the path are 6, 3 and 1. 1. Intersections on the path are 3 and 7. Passing fee of the road between them is 0. 1. Intersections on the path are 2 and 4. Passing fee of the road between them is 32 (increased by 30 in the first event and by 2 in the second).
|
```python
n=int(input())
d={}
def lca(u,v,w) :
res=0
while u!=v :
if u<v :
v,u=u,v
d[u]=d.get(u,0)+w
res+=d[u]
u=u//2
return res
for i in range(n) :
l=list(map(int,input().split()))
if l[0]==1 :
lca(l[1],l[2],l[3])
else :
print(lca(l[1],l[2],0))
```
| 3
|
|
80
|
A
|
Panoramix's Prediction
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Panoramix's Prediction
|
2
|
256
|
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
|
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
|
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
|
[
"3 5\n",
"7 11\n",
"7 9\n"
] |
[
"YES",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,640,268,895
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 124
| 0
|
x,y= map(int,input().split())
def isPrime(n):
for i in range(2,n):
if(n%i==0):
return False
return True
n=x+1
while(True):
if(isPrime(n)):
break
n+=1
if(y==n):
print("YES")
else:
print("NO")
|
Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none
|
```python
x,y= map(int,input().split())
def isPrime(n):
for i in range(2,n):
if(n%i==0):
return False
return True
n=x+1
while(True):
if(isPrime(n)):
break
n+=1
if(y==n):
print("YES")
else:
print("NO")
```
| 3.969
|
215
|
B
|
Olympic Medal
|
PROGRAMMING
| 1,300
|
[
"greedy",
"math"
] | null | null |
The World Programming Olympics Medal is a metal disk, consisting of two parts: the first part is a ring with outer radius of *r*1 cm, inner radius of *r*2 cm, (0<=<<=*r*2<=<<=*r*1) made of metal with density *p*1 g/cm3. The second part is an inner disk with radius *r*2 cm, it is made of metal with density *p*2 g/cm3. The disk is nested inside the ring.
The Olympic jury decided that *r*1 will take one of possible values of *x*1,<=*x*2,<=...,<=*x**n*. It is up to jury to decide which particular value *r*1 will take. Similarly, the Olympic jury decided that *p*1 will take one of possible value of *y*1,<=*y*2,<=...,<=*y**m*, and *p*2 will take a value from list *z*1,<=*z*2,<=...,<=*z**k*.
According to most ancient traditions the ratio between the outer ring mass *m**out* and the inner disk mass *m**in* must equal , where *A*,<=*B* are constants taken from ancient books. Now, to start making medals, the jury needs to take values for *r*1, *p*1, *p*2 and calculate the suitable value of *r*2.
The jury wants to choose the value that would maximize radius *r*2. Help the jury find the sought value of *r*2. Value *r*2 doesn't have to be an integer.
Medal has a uniform thickness throughout the area, the thickness of the inner disk is the same as the thickness of the outer ring.
|
The first input line contains an integer *n* and a sequence of integers *x*1,<=*x*2,<=...,<=*x**n*. The second input line contains an integer *m* and a sequence of integers *y*1,<=*y*2,<=...,<=*y**m*. The third input line contains an integer *k* and a sequence of integers *z*1,<=*z*2,<=...,<=*z**k*. The last line contains two integers *A* and *B*.
All numbers given in the input are positive and do not exceed 5000. Each of the three sequences contains distinct numbers. The numbers in the lines are separated by spaces.
|
Print a single real number — the sought value *r*2 with absolute or relative error of at most 10<=-<=6. It is guaranteed that the solution that meets the problem requirements exists.
|
[
"3 1 2 3\n1 2\n3 3 2 1\n1 2\n",
"4 2 3 6 4\n2 1 2\n3 10 6 8\n2 1\n"
] |
[
"2.683281573000\n",
"2.267786838055\n"
] |
In the first sample the jury should choose the following values: *r*<sub class="lower-index">1</sub> = 3, *p*<sub class="lower-index">1</sub> = 2, *p*<sub class="lower-index">2</sub> = 1.
| 500
|
[
{
"input": "3 1 2 3\n1 2\n3 3 2 1\n1 2",
"output": "2.683281573000"
},
{
"input": "4 2 3 6 4\n2 1 2\n3 10 6 8\n2 1",
"output": "2.267786838055"
},
{
"input": "1 5\n1 3\n1 7\n515 892",
"output": "3.263613058533"
},
{
"input": "2 3 2\n3 2 3 1\n2 2 1\n733 883",
"output": "2.655066678191"
},
{
"input": "2 4 2\n3 1 2 3\n2 2 3\n676 769",
"output": "3.176161549164"
},
{
"input": "2 4 2\n3 2 3 1\n2 3 1\n772 833",
"output": "3.496252962144"
},
{
"input": "2 1 2\n3 2 3 1\n2 1 3\n452 219",
"output": "1.539383784060"
},
{
"input": "2 3 2\n3 3 2 1\n2 3 2\n417 202",
"output": "1.946150045603"
},
{
"input": "2 1 2\n3 1 2 3\n2 3 2\n596 206",
"output": "1.168651298016"
},
{
"input": "2 1 2\n3 3 1 2\n2 2 3\n306 406",
"output": "1.631654093847"
},
{
"input": "2 3 2\n3 3 1 2\n2 2 1\n881 165",
"output": "1.799345811354"
},
{
"input": "2 2 4\n3 1 2 3\n2 2 1\n618 401",
"output": "3.251156175034"
},
{
"input": "10 24 2621 2533 3148 3544 4273 4921 2950 3780 4483\n10 1687 4906 4246 2814 1874 3020 3039 3971 102 492\n10 3458 2699 2463 4395 3607 550 1608 958 3970 3077\n4 891",
"output": "4919.762124668494"
},
{
"input": "1 5000\n1 5000\n1 1\n1 5000",
"output": "4999.999900000003"
},
{
"input": "1 1\n1 1\n1 5000\n5000 1",
"output": "0.000199999996"
},
{
"input": "3 5000 4999 4998\n3 5000 4999 4998\n4 1 2 3 4\n1 5000",
"output": "4999.999900000003"
},
{
"input": "3 1 2 3\n3 1 2 3\n3 5000 4999 4998\n5000 1",
"output": "0.001039438331"
},
{
"input": "3 1 2 3\n1 2\n3 3 2 1\n54 58",
"output": "2.478139719747"
},
{
"input": "3 1 2 3\n1 2\n3 3 2 1\n52 56",
"output": "2.479181611624"
},
{
"input": "3 1 2 3\n1 2\n3 3 2 1\n51 55",
"output": "2.479731502196"
},
{
"input": "3 1 2 3\n1 2\n3 3 2 1\n55 59",
"output": "2.477645721991"
},
{
"input": "3 1 2 3\n1 2\n3 1 2 3\n53 57",
"output": "2.478651362102"
},
{
"input": "13 1 2 3 4 5 6 7 8 9 10 11 12 13\n1 14\n2 15 16\n17 18",
"output": "9.165151389912"
}
] | 1,657,217,304
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 1
| 186
| 0
|
r1 = max(map(int,input().split()))
p1 = max(map(int,input().split()))
p2 = min(map(int,input().split()))
a,b = map(int,input().split())
r2 = 0
the_root = ((b*p1)/(b*p1+a*p2))**0.5
r2 = r1*the_root
print('%.7f' %r2)
|
Title: Olympic Medal
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The World Programming Olympics Medal is a metal disk, consisting of two parts: the first part is a ring with outer radius of *r*1 cm, inner radius of *r*2 cm, (0<=<<=*r*2<=<<=*r*1) made of metal with density *p*1 g/cm3. The second part is an inner disk with radius *r*2 cm, it is made of metal with density *p*2 g/cm3. The disk is nested inside the ring.
The Olympic jury decided that *r*1 will take one of possible values of *x*1,<=*x*2,<=...,<=*x**n*. It is up to jury to decide which particular value *r*1 will take. Similarly, the Olympic jury decided that *p*1 will take one of possible value of *y*1,<=*y*2,<=...,<=*y**m*, and *p*2 will take a value from list *z*1,<=*z*2,<=...,<=*z**k*.
According to most ancient traditions the ratio between the outer ring mass *m**out* and the inner disk mass *m**in* must equal , where *A*,<=*B* are constants taken from ancient books. Now, to start making medals, the jury needs to take values for *r*1, *p*1, *p*2 and calculate the suitable value of *r*2.
The jury wants to choose the value that would maximize radius *r*2. Help the jury find the sought value of *r*2. Value *r*2 doesn't have to be an integer.
Medal has a uniform thickness throughout the area, the thickness of the inner disk is the same as the thickness of the outer ring.
Input Specification:
The first input line contains an integer *n* and a sequence of integers *x*1,<=*x*2,<=...,<=*x**n*. The second input line contains an integer *m* and a sequence of integers *y*1,<=*y*2,<=...,<=*y**m*. The third input line contains an integer *k* and a sequence of integers *z*1,<=*z*2,<=...,<=*z**k*. The last line contains two integers *A* and *B*.
All numbers given in the input are positive and do not exceed 5000. Each of the three sequences contains distinct numbers. The numbers in the lines are separated by spaces.
Output Specification:
Print a single real number — the sought value *r*2 with absolute or relative error of at most 10<=-<=6. It is guaranteed that the solution that meets the problem requirements exists.
Demo Input:
['3 1 2 3\n1 2\n3 3 2 1\n1 2\n', '4 2 3 6 4\n2 1 2\n3 10 6 8\n2 1\n']
Demo Output:
['2.683281573000\n', '2.267786838055\n']
Note:
In the first sample the jury should choose the following values: *r*<sub class="lower-index">1</sub> = 3, *p*<sub class="lower-index">1</sub> = 2, *p*<sub class="lower-index">2</sub> = 1.
|
```python
r1 = max(map(int,input().split()))
p1 = max(map(int,input().split()))
p2 = min(map(int,input().split()))
a,b = map(int,input().split())
r2 = 0
the_root = ((b*p1)/(b*p1+a*p2))**0.5
r2 = r1*the_root
print('%.7f' %r2)
```
| 0
|
|
615
|
A
|
Bulbs
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs?
If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
|
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively.
Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
|
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
|
[
"3 4\n2 1 4\n3 1 3 1\n1 2\n",
"3 3\n1 1\n1 2\n1 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
| 500
|
[
{
"input": "3 4\n2 1 4\n3 1 3 1\n1 2",
"output": "YES"
},
{
"input": "3 3\n1 1\n1 2\n1 1",
"output": "NO"
},
{
"input": "3 4\n1 1\n1 2\n1 3",
"output": "NO"
},
{
"input": "1 5\n5 1 2 3 4 5",
"output": "YES"
},
{
"input": "1 5\n5 4 4 1 2 3",
"output": "NO"
},
{
"input": "1 5\n5 1 1 1 1 5",
"output": "NO"
},
{
"input": "2 5\n4 3 1 4 2\n4 2 3 4 5",
"output": "YES"
},
{
"input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1",
"output": "YES"
},
{
"input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6",
"output": "YES"
},
{
"input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "NO"
},
{
"input": "1 4\n3 1 2 3",
"output": "NO"
},
{
"input": "1 4\n3 2 3 4",
"output": "NO"
},
{
"input": "2 4\n3 2 3 4\n1 1",
"output": "YES"
},
{
"input": "2 4\n3 1 2 3\n1 4",
"output": "YES"
},
{
"input": "5 1\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "1 1\n0",
"output": "NO"
},
{
"input": "1 10\n10 1 2 3 4 5 6 7 8 9 10",
"output": "YES"
},
{
"input": "1 1\n1 1",
"output": "YES"
},
{
"input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99",
"output": "NO"
},
{
"input": "1 3\n3 1 2 1",
"output": "NO"
},
{
"input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "YES"
}
] | 1,665,477,833
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 8
| 46
| 0
|
n,m = map(int,input().split())
a = set()
for i in range(n):a.update(set(input()[1:]))
print(("NO","YES")[len(a)-1 == m])
|
Title: Bulbs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs?
If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
Input Specification:
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively.
Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
Output Specification:
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
Demo Input:
['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
|
```python
n,m = map(int,input().split())
a = set()
for i in range(n):a.update(set(input()[1:]))
print(("NO","YES")[len(a)-1 == m])
```
| 0
|
|
770
|
A
|
New Password
|
PROGRAMMING
| 800
|
[
"*special",
"implementation"
] | null | null |
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
|
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists.
|
Print any password which satisfies all conditions given by Innokentiy.
|
[
"4 3\n",
"6 6\n",
"5 2\n"
] |
[
"java\n",
"python\n",
"phphp\n"
] |
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
| 500
|
[
{
"input": "4 3",
"output": "abca"
},
{
"input": "6 6",
"output": "abcdef"
},
{
"input": "5 2",
"output": "ababa"
},
{
"input": "3 2",
"output": "aba"
},
{
"input": "10 2",
"output": "ababababab"
},
{
"input": "26 13",
"output": "abcdefghijklmabcdefghijklm"
},
{
"input": "100 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "100 10",
"output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij"
},
{
"input": "3 3",
"output": "abc"
},
{
"input": "6 3",
"output": "abcabc"
},
{
"input": "10 3",
"output": "abcabcabca"
},
{
"input": "50 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab"
},
{
"input": "90 2",
"output": "ababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "6 2",
"output": "ababab"
},
{
"input": "99 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc"
},
{
"input": "4 2",
"output": "abab"
},
{
"input": "100 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "40 22",
"output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr"
},
{
"input": "13 8",
"output": "abcdefghabcde"
},
{
"input": "16 15",
"output": "abcdefghijklmnoa"
},
{
"input": "17 17",
"output": "abcdefghijklmnopq"
},
{
"input": "19 4",
"output": "abcdabcdabcdabcdabc"
},
{
"input": "100 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv"
},
{
"input": "100 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy"
},
{
"input": "26 26",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "27 26",
"output": "abcdefghijklmnopqrstuvwxyza"
},
{
"input": "2 2",
"output": "ab"
},
{
"input": "26 25",
"output": "abcdefghijklmnopqrstuvwxya"
},
{
"input": "99 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababa"
},
{
"input": "99 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu"
},
{
"input": "4 4",
"output": "abcd"
},
{
"input": "5 3",
"output": "abcab"
},
{
"input": "5 4",
"output": "abcda"
},
{
"input": "5 5",
"output": "abcde"
},
{
"input": "24 22",
"output": "abcdefghijklmnopqrstuvab"
},
{
"input": "26 14",
"output": "abcdefghijklmnabcdefghijkl"
},
{
"input": "26 15",
"output": "abcdefghijklmnoabcdefghijk"
},
{
"input": "30 12",
"output": "abcdefghijklabcdefghijklabcdef"
},
{
"input": "35 4",
"output": "abcdabcdabcdabcdabcdabcdabcdabcdabc"
},
{
"input": "79 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "79 14",
"output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi"
},
{
"input": "85 13",
"output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg"
},
{
"input": "90 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno"
},
{
"input": "90 19",
"output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn"
},
{
"input": "26 24",
"output": "abcdefghijklmnopqrstuvwxab"
},
{
"input": "100 17",
"output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno"
},
{
"input": "26 2",
"output": "ababababababababababababab"
}
] | 1,657,263,813
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 46
| 0
|
def generatePassword(n, k):
password = []; idx = 0
for i in range(n):
password.append(chr(idx+ord('a')))
idx = (idx+1)%k
return ''.join(password)
n, k = list(map(int, input().split(' ')))
print(generatePassword(n, k))
|
Title: New Password
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
Input Specification:
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists.
Output Specification:
Print any password which satisfies all conditions given by Innokentiy.
Demo Input:
['4 3\n', '6 6\n', '5 2\n']
Demo Output:
['java\n', 'python\n', 'phphp\n']
Note:
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
|
```python
def generatePassword(n, k):
password = []; idx = 0
for i in range(n):
password.append(chr(idx+ord('a')))
idx = (idx+1)%k
return ''.join(password)
n, k = list(map(int, input().split(' ')))
print(generatePassword(n, k))
```
| 3
|
|
445
|
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500
|
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,678,746,128
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <stdio.h>
int main() {
int n, m;
scanf("%d %d", &n, &m);
char matriz[n][m];
for (int i = 0; n > i; i++) {
scanf("%s", matriz[i]);
}
for (int i = 0; n > i; i++) {
for (int j = 0; j < m; j++) {
if (matriz[i][j] == '.') {
if ((i + j) % 2 == 0) {
printf("B");
} else {
printf("W");
}
} else {
printf("-");
}
}
printf("\n");
}
return 0;
}
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
#include <stdio.h>
int main() {
int n, m;
scanf("%d %d", &n, &m);
char matriz[n][m];
for (int i = 0; n > i; i++) {
scanf("%s", matriz[i]);
}
for (int i = 0; n > i; i++) {
for (int j = 0; j < m; j++) {
if (matriz[i][j] == '.') {
if ((i + j) % 2 == 0) {
printf("B");
} else {
printf("W");
}
} else {
printf("-");
}
}
printf("\n");
}
return 0;
}
```
| -1
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,692,583,189
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
a = list(map(int,input().split(" ")))
b = a[0]
c = a[1]
d = b * c
print(d // 2)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
a = list(map(int,input().split(" ")))
b = a[0]
c = a[1]
d = b * c
print(d // 2)
```
| 3.977
|
330
|
A
|
Cakeminator
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
|
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
|
Output the maximum number of cake cells that the cakeminator can eat.
|
[
"3 4\nS...\n....\n..S.\n"
] |
[
"8\n"
] |
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
| 500
|
[
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,588,053,565
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 218
| 307,200
|
r,c=[int(z) for z in input().split()]
r1=list(range(0,r))
c1=list(range(0,c))
for i in range(0,r):
s=input()
for j in range(0,len(s)):
if s[j]=='S':
if i in r1:
r1.remove(i)
if j in c1:
c1.remove(j)
print(len(r1)*c+len(c1)*r-len(r1)*len(c1))
|
Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
|
```python
r,c=[int(z) for z in input().split()]
r1=list(range(0,r))
c1=list(range(0,c))
for i in range(0,r):
s=input()
for j in range(0,len(s)):
if s[j]=='S':
if i in r1:
r1.remove(i)
if j in c1:
c1.remove(j)
print(len(r1)*c+len(c1)*r-len(r1)*len(c1))
```
| 3
|
|
318
|
A
|
Even Odds
|
PROGRAMMING
| 900
|
[
"math"
] | null | null |
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
|
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
Print the number that will stand at the position number *k* after Volodya's manipulations.
|
[
"10 3\n",
"7 7\n"
] |
[
"5",
"6"
] |
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
| 500
|
[
{
"input": "10 3",
"output": "5"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "7 1",
"output": "1"
},
{
"input": "7 2",
"output": "3"
},
{
"input": "8 5",
"output": "2"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "7"
},
{
"input": "1000000000000 500000000001",
"output": "2"
},
{
"input": "999999999997 499999999999",
"output": "999999999997"
},
{
"input": "999999999999 999999999999",
"output": "999999999998"
},
{
"input": "1000000000000 1",
"output": "1"
},
{
"input": "999999999999 1",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000000 1000000000000",
"output": "1000000000000"
},
{
"input": "1000000000000 500000000000",
"output": "999999999999"
},
{
"input": "1000000000000 499999999999",
"output": "999999999997"
},
{
"input": "999999999997 499999999998",
"output": "999999999995"
},
{
"input": "619234238 556154835",
"output": "493075432"
},
{
"input": "38151981 36650624",
"output": "35149266"
},
{
"input": "680402465 442571217",
"output": "204739968"
},
{
"input": "109135284 9408714",
"output": "18817427"
},
{
"input": "603701841 56038951",
"output": "112077901"
},
{
"input": "356764822 321510177",
"output": "286255532"
},
{
"input": "284911189 142190783",
"output": "284381565"
},
{
"input": "91028405 61435545",
"output": "31842684"
}
] | 1,697,396,213
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 62
| 0
|
n, k = map(int, input().split())
print((k-(n+1)//2)*2 if k > (n+1)//2 else 2*k-1)
|
Title: Even Odds
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
Input Specification:
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print the number that will stand at the position number *k* after Volodya's manipulations.
Demo Input:
['10 3\n', '7 7\n']
Demo Output:
['5', '6']
Note:
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
|
```python
n, k = map(int, input().split())
print((k-(n+1)//2)*2 if k > (n+1)//2 else 2*k-1)
```
| 3
|
|
776
|
B
|
Sherlock and his girlfriend
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"number theory"
] | null | null |
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
|
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
|
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
|
[
"3\n",
"4\n"
] |
[
"2\n1 1 2 ",
"2\n2 1 1 2\n"
] |
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct.
| 1,000
|
[
{
"input": "3",
"output": "2\n1 1 2 "
},
{
"input": "4",
"output": "2\n1 1 2 1 "
},
{
"input": "17",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 "
},
{
"input": "25",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 "
},
{
"input": "85",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 "
},
{
"input": "105",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 "
},
{
"input": "123",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "452",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "641",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "293",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "733",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "10",
"output": "2\n1 1 2 1 2 1 2 2 2 1 "
},
{
"input": "287",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3202",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "728",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3509",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "5137",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2023",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "4890",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "8507",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1796",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3466",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1098",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11226",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11731",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11644",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "14553",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "17307",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "23189",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "6818",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1054",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "28163",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "30885",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "27673",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11656",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "36325",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "31205",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29958",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1696",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "44907",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "13736",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29594",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "19283",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "15346",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "41794",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99998",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99971",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
}
] | 1,604,948,873
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 0
| 1,000
| 307,200
|
'''
Time complexity: O(N)
Space complexity: O(N)
where N is the input given
'''
def solve(n) :
isPrime = [True for i in range(n + 2)]
for i in range(2, n + 2) :
if(isPrime[i] == True) :
j = 2
while(i * j <= n + 2) :
isPrime[i * j] = False
if(n <= 1) :
print(1)
else :
print(2)
for i in range(2, n + 2) :
if(isPrime[i] == True) :
print(1, end = " ")
else :
print(2, end = " ")
#main
n = int(input().strip())
solve(n)
|
Title: Sherlock and his girlfriend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
Input Specification:
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
Output Specification:
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
Demo Input:
['3\n', '4\n']
Demo Output:
['2\n1 1 2 ', '2\n2 1 1 2\n']
Note:
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct.
|
```python
'''
Time complexity: O(N)
Space complexity: O(N)
where N is the input given
'''
def solve(n) :
isPrime = [True for i in range(n + 2)]
for i in range(2, n + 2) :
if(isPrime[i] == True) :
j = 2
while(i * j <= n + 2) :
isPrime[i * j] = False
if(n <= 1) :
print(1)
else :
print(2)
for i in range(2, n + 2) :
if(isPrime[i] == True) :
print(1, end = " ")
else :
print(2, end = " ")
#main
n = int(input().strip())
solve(n)
```
| 0
|
|
505
|
A
|
Mr. Kitayuta's Gift
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Mr. Kitayuta has kindly given you a string *s* consisting of lowercase English letters. You are asked to insert exactly one lowercase English letter into *s* to make it a palindrome. A palindrome is a string that reads the same forward and backward. For example, "noon", "testset" and "a" are all palindromes, while "test" and "kitayuta" are not.
You can choose any lowercase English letter, and insert it to any position of *s*, possibly to the beginning or the end of *s*. You have to insert a letter even if the given string is already a palindrome.
If it is possible to insert one lowercase English letter into *s* so that the resulting string will be a palindrome, print the string after the insertion. Otherwise, print "NA" (without quotes, case-sensitive). In case there is more than one palindrome that can be obtained, you are allowed to print any of them.
|
The only line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=10). Each character in *s* is a lowercase English letter.
|
If it is possible to turn *s* into a palindrome by inserting one lowercase English letter, print the resulting string in a single line. Otherwise, print "NA" (without quotes, case-sensitive). In case there is more than one solution, any of them will be accepted.
|
[
"revive\n",
"ee\n",
"kitayuta\n"
] |
[
"reviver\n",
"eye",
"NA\n"
] |
For the first sample, insert 'r' to the end of "revive" to obtain a palindrome "reviver".
For the second sample, there is more than one solution. For example, "eve" will also be accepted.
For the third sample, it is not possible to turn "kitayuta" into a palindrome by just inserting one letter.
| 500
|
[
{
"input": "revive",
"output": "reviver"
},
{
"input": "ee",
"output": "eee"
},
{
"input": "kitayuta",
"output": "NA"
},
{
"input": "evima",
"output": "NA"
},
{
"input": "a",
"output": "aa"
},
{
"input": "yutampo",
"output": "NA"
},
{
"input": "fft",
"output": "tfft"
},
{
"input": "shuseki",
"output": "NA"
},
{
"input": "lsdijfjisl",
"output": "lsdijfjidsl"
},
{
"input": "ewcdcwerp",
"output": "NA"
},
{
"input": "noon",
"output": "nooon"
},
{
"input": "add",
"output": "adda"
},
{
"input": "iq",
"output": "qiq"
},
{
"input": "hogloid",
"output": "NA"
},
{
"input": "yosupo",
"output": "NA"
},
{
"input": "stat",
"output": "stats"
},
{
"input": "level",
"output": "levvel"
},
{
"input": "iwiwi",
"output": "iwiiwi"
},
{
"input": "racecar",
"output": "raceecar"
},
{
"input": "dog",
"output": "NA"
},
{
"input": "squirrel",
"output": "NA"
},
{
"input": "slime",
"output": "NA"
},
{
"input": "palindrome",
"output": "NA"
},
{
"input": "nqwcvcwqn",
"output": "nqwcvvcwqn"
},
{
"input": "lsdijfjisl",
"output": "lsdijfjidsl"
},
{
"input": "jewiiwefj",
"output": "jfewiiwefj"
},
{
"input": "vnwmvvmonv",
"output": "NA"
},
{
"input": "zennyuu",
"output": "NA"
},
{
"input": "mrtoudai",
"output": "NA"
},
{
"input": "z",
"output": "zz"
},
{
"input": "babccba",
"output": "babccbab"
},
{
"input": "battaba",
"output": "abattaba"
},
{
"input": "bbb",
"output": "bbbb"
},
{
"input": "zaa",
"output": "zaaz"
},
{
"input": "abbabab",
"output": "NA"
},
{
"input": "racecar",
"output": "raceecar"
},
{
"input": "zzz",
"output": "zzzz"
},
{
"input": "eviver",
"output": "reviver"
},
{
"input": "aaaaa",
"output": "aaaaaa"
},
{
"input": "eee",
"output": "eeee"
}
] | 1,426,240,934
| 554
|
Python 3
|
OK
|
TESTS
| 40
| 62
| 0
|
def isPal(s):
return s == s[::-1]
def allway(s):
flag = 0
for i in range(len(s) + 1):
for j in alf:
new = s[:i] + j + s[i:]
if isPal(new):
flag = 1
return new
if flag == 0:
return 'NA'
alf = 'abcdefghijklmnopqrstuvwxyz'
s = input()
print(allway(s))
|
Title: Mr. Kitayuta's Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Kitayuta has kindly given you a string *s* consisting of lowercase English letters. You are asked to insert exactly one lowercase English letter into *s* to make it a palindrome. A palindrome is a string that reads the same forward and backward. For example, "noon", "testset" and "a" are all palindromes, while "test" and "kitayuta" are not.
You can choose any lowercase English letter, and insert it to any position of *s*, possibly to the beginning or the end of *s*. You have to insert a letter even if the given string is already a palindrome.
If it is possible to insert one lowercase English letter into *s* so that the resulting string will be a palindrome, print the string after the insertion. Otherwise, print "NA" (without quotes, case-sensitive). In case there is more than one palindrome that can be obtained, you are allowed to print any of them.
Input Specification:
The only line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=10). Each character in *s* is a lowercase English letter.
Output Specification:
If it is possible to turn *s* into a palindrome by inserting one lowercase English letter, print the resulting string in a single line. Otherwise, print "NA" (without quotes, case-sensitive). In case there is more than one solution, any of them will be accepted.
Demo Input:
['revive\n', 'ee\n', 'kitayuta\n']
Demo Output:
['reviver\n', 'eye', 'NA\n']
Note:
For the first sample, insert 'r' to the end of "revive" to obtain a palindrome "reviver".
For the second sample, there is more than one solution. For example, "eve" will also be accepted.
For the third sample, it is not possible to turn "kitayuta" into a palindrome by just inserting one letter.
|
```python
def isPal(s):
return s == s[::-1]
def allway(s):
flag = 0
for i in range(len(s) + 1):
for j in alf:
new = s[:i] + j + s[i:]
if isPal(new):
flag = 1
return new
if flag == 0:
return 'NA'
alf = 'abcdefghijklmnopqrstuvwxyz'
s = input()
print(allway(s))
```
| 3
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,672,828,936
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 52
| 156
| 0
|
n = input()
s = [int(x) for x in input().split()]
if sum(s)%2 !=0:
for i in range(0,len(s)): s[i] += 1
p = 0
for x in s:
if x%2 == 0: p+=1
print(p)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n = input()
s = [int(x) for x in input().split()]
if sum(s)%2 !=0:
for i in range(0,len(s)): s[i] += 1
p = 0
for x in s:
if x%2 == 0: p+=1
print(p)
```
| 3
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.