contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,608,384,532
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 109
| 0
|
n=input()
k=int(input())
l=list(map(int,input().split()))
s=0
for i in range(len(n)):
s=s+(i+1)*l[(ord(n[i])-97)]
m=max(l)
for j in range(i+i,k+i+2):
s=s+(j)*m
print(s)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
n=input()
k=int(input())
l=list(map(int,input().split()))
s=0
for i in range(len(n)):
s=s+(i+1)*l[(ord(n[i])-97)]
m=max(l)
for j in range(i+i,k+i+2):
s=s+(j)*m
print(s)
```
| 0
|
|
915
|
C
|
Permute Digits
|
PROGRAMMING
| 1,700
|
[
"dp",
"greedy"
] | null | null |
You are given two positive integer numbers *a* and *b*. Permute (change order) of the digits of *a* to construct maximal number not exceeding *b*. No number in input and/or output can start with the digit 0.
It is allowed to leave *a* as it is.
|
The first line contains integer *a* (1<=≤<=*a*<=≤<=1018). The second line contains integer *b* (1<=≤<=*b*<=≤<=1018). Numbers don't have leading zeroes. It is guaranteed that answer exists.
|
Print the maximum possible number that is a permutation of digits of *a* and is not greater than *b*. The answer can't have any leading zeroes. It is guaranteed that the answer exists.
The number in the output should have exactly the same length as number *a*. It should be a permutation of digits of *a*.
|
[
"123\n222\n",
"3921\n10000\n",
"4940\n5000\n"
] |
[
"213\n",
"9321\n",
"4940\n"
] |
none
| 0
|
[
{
"input": "123\n222",
"output": "213"
},
{
"input": "3921\n10000",
"output": "9321"
},
{
"input": "4940\n5000",
"output": "4940"
},
{
"input": "23923472834\n23589234723",
"output": "23498743322"
},
{
"input": "102391019\n491010301",
"output": "399211100"
},
{
"input": "123456789123456789\n276193619183618162",
"output": "276193618987554432"
},
{
"input": "1000000000000000000\n1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "1\n1000000000000000000",
"output": "1"
},
{
"input": "999999999999999999\n1000000000000000000",
"output": "999999999999999999"
},
{
"input": "2475345634895\n3455834583479",
"output": "3455834579642"
},
{
"input": "15778899\n98715689",
"output": "98598771"
},
{
"input": "4555\n5454",
"output": "4555"
},
{
"input": "122112\n221112",
"output": "221112"
},
{
"input": "199999999999991\n191000000000000",
"output": "119999999999999"
},
{
"input": "13\n31",
"output": "31"
},
{
"input": "212\n211",
"output": "122"
},
{
"input": "222234\n322223",
"output": "243222"
},
{
"input": "123456789\n987654311",
"output": "987654231"
},
{
"input": "20123\n21022",
"output": "20321"
},
{
"input": "10101\n11000",
"output": "10110"
},
{
"input": "592\n924",
"output": "592"
},
{
"input": "5654456\n5634565",
"output": "5566544"
},
{
"input": "655432\n421631",
"output": "365542"
},
{
"input": "200\n200",
"output": "200"
},
{
"input": "123456789987654321\n121111111111111111",
"output": "119988776655443322"
},
{
"input": "12345\n21344",
"output": "15432"
},
{
"input": "120\n200",
"output": "120"
},
{
"input": "123\n212",
"output": "132"
},
{
"input": "2184645\n5213118",
"output": "5186442"
},
{
"input": "9912346\n9912345",
"output": "9694321"
},
{
"input": "5003\n5000",
"output": "3500"
},
{
"input": "12345\n31234",
"output": "25431"
},
{
"input": "5001\n5000",
"output": "1500"
},
{
"input": "53436\n53425",
"output": "53364"
},
{
"input": "9329\n3268",
"output": "2993"
},
{
"input": "1234567890\n9000000001",
"output": "8976543210"
},
{
"input": "321\n212",
"output": "132"
},
{
"input": "109823464\n901234467",
"output": "896443210"
},
{
"input": "6543\n6542",
"output": "6534"
},
{
"input": "555441\n555100",
"output": "554541"
},
{
"input": "472389479\n327489423",
"output": "327487994"
},
{
"input": "45645643756464352\n53465475637456247",
"output": "53465475636654442"
},
{
"input": "254\n599",
"output": "542"
},
{
"input": "5232222345652321\n5000000000000000",
"output": "4655533322222221"
},
{
"input": "201\n200",
"output": "120"
},
{
"input": "14362799391220361\n45160821596433661",
"output": "43999766332221110"
},
{
"input": "3453\n5304",
"output": "4533"
},
{
"input": "989\n998",
"output": "998"
},
{
"input": "5200000000234\n5200000000311",
"output": "5200000000243"
},
{
"input": "5555132\n1325442",
"output": "1255553"
},
{
"input": "123\n211",
"output": "132"
},
{
"input": "65689\n66123",
"output": "65986"
},
{
"input": "123451234567890\n123456789012345",
"output": "123456789012345"
},
{
"input": "22115\n22015",
"output": "21521"
},
{
"input": "123\n311",
"output": "231"
},
{
"input": "12222\n21111",
"output": "12222"
},
{
"input": "765\n567",
"output": "567"
},
{
"input": "9087645\n9087640",
"output": "9087564"
},
{
"input": "1111111122222333\n2220000000000000",
"output": "2213332221111111"
},
{
"input": "7901\n7108",
"output": "7091"
},
{
"input": "215489\n215488",
"output": "214985"
},
{
"input": "102\n200",
"output": "120"
},
{
"input": "19260817\n20011213",
"output": "19876210"
},
{
"input": "12345\n53200",
"output": "53142"
},
{
"input": "1040003001\n1040003000",
"output": "1040001300"
},
{
"input": "295\n924",
"output": "592"
},
{
"input": "20000000000000001\n20000000000000000",
"output": "12000000000000000"
},
{
"input": "99988877\n99887766",
"output": "99879887"
},
{
"input": "12\n12",
"output": "12"
},
{
"input": "199999999999999999\n900000000000000000",
"output": "199999999999999999"
},
{
"input": "1234\n4310",
"output": "4231"
},
{
"input": "100011\n100100",
"output": "100011"
},
{
"input": "328899\n328811",
"output": "299883"
},
{
"input": "646722972346\n397619201220",
"output": "397476664222"
},
{
"input": "1203\n1200",
"output": "1032"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1112\n2110",
"output": "1211"
},
{
"input": "4545\n5540",
"output": "5454"
},
{
"input": "3053\n5004",
"output": "3530"
},
{
"input": "3503\n5004",
"output": "3530"
},
{
"input": "351731653766064847\n501550303749042658",
"output": "501548777666643331"
},
{
"input": "10123456789013451\n26666666666666666",
"output": "26598754433111100"
},
{
"input": "1110111\n1100000",
"output": "1011111"
},
{
"input": "30478\n32265",
"output": "30874"
},
{
"input": "456546546549874615\n441554543131214545",
"output": "441554498766665554"
},
{
"input": "214\n213",
"output": "142"
},
{
"input": "415335582799619283\n133117803602859310",
"output": "132999887655543321"
},
{
"input": "787\n887",
"output": "877"
},
{
"input": "3333222288889999\n3333222288881111",
"output": "3332999988883222"
},
{
"input": "495779862481416791\n836241745208800994",
"output": "829998777665444111"
},
{
"input": "139\n193",
"output": "193"
},
{
"input": "9568\n6500",
"output": "5986"
},
{
"input": "3208899\n3228811",
"output": "3209988"
},
{
"input": "27778\n28710",
"output": "27877"
},
{
"input": "62345\n46415",
"output": "46352"
},
{
"input": "405739873179209\n596793907108871",
"output": "594998777332100"
},
{
"input": "365\n690",
"output": "653"
},
{
"input": "8388731334391\n4710766672578",
"output": "4398887333311"
},
{
"input": "1230\n1200",
"output": "1032"
},
{
"input": "1025\n5000",
"output": "2510"
},
{
"input": "4207799\n4027711",
"output": "2997740"
},
{
"input": "4444222277779999\n4444222277771111",
"output": "4442999977774222"
},
{
"input": "7430\n3047",
"output": "3047"
},
{
"input": "649675735\n540577056",
"output": "539776654"
},
{
"input": "26\n82",
"output": "62"
},
{
"input": "241285\n207420",
"output": "185422"
},
{
"input": "3\n3",
"output": "3"
},
{
"input": "12\n21",
"output": "21"
},
{
"input": "481287\n826607",
"output": "824871"
},
{
"input": "40572351\n59676984",
"output": "57543210"
},
{
"input": "268135787269\n561193454469",
"output": "539887766221"
},
{
"input": "4\n9",
"output": "4"
},
{
"input": "5\n6",
"output": "5"
},
{
"input": "60579839\n33370073",
"output": "30998765"
},
{
"input": "49939\n39200",
"output": "34999"
},
{
"input": "2224\n4220",
"output": "2422"
},
{
"input": "427799\n427711",
"output": "299774"
},
{
"input": "49\n90",
"output": "49"
},
{
"input": "93875\n82210",
"output": "79853"
},
{
"input": "78831\n7319682",
"output": "88731"
},
{
"input": "937177\n7143444",
"output": "977731"
},
{
"input": "499380628\n391990337",
"output": "390988642"
},
{
"input": "2090909\n2900000",
"output": "2099900"
},
{
"input": "112233445566778890\n987654321987654320",
"output": "987654321876543210"
},
{
"input": "48257086\n80903384",
"output": "80876542"
},
{
"input": "112233445566778890\n900654321987654320",
"output": "898776655443322110"
},
{
"input": "112233445566778890\n123456789123456788",
"output": "123456789123456780"
},
{
"input": "5207799\n5027711",
"output": "2997750"
},
{
"input": "200000000000000001\n200000000000000000",
"output": "120000000000000000"
},
{
"input": "597402457\n797455420",
"output": "797455420"
},
{
"input": "90\n94",
"output": "90"
},
{
"input": "86888\n88683",
"output": "86888"
},
{
"input": "419155888\n588151913",
"output": "588151894"
},
{
"input": "408919130\n191830070",
"output": "191830049"
},
{
"input": "524975\n554924",
"output": "554792"
},
{
"input": "53029\n30524",
"output": "30295"
},
{
"input": "5549\n5542",
"output": "5495"
},
{
"input": "6\n9",
"output": "6"
},
{
"input": "87\n810",
"output": "87"
},
{
"input": "920491855\n281495062",
"output": "281495059"
},
{
"input": "6691\n6910",
"output": "6691"
},
{
"input": "533\n335",
"output": "335"
},
{
"input": "999999999999999998\n999999999999999997",
"output": "999999999999999989"
},
{
"input": "21111111111111111\n21111111111111110",
"output": "12111111111111111"
},
{
"input": "2\n12",
"output": "2"
},
{
"input": "76544\n45744",
"output": "45674"
},
{
"input": "2000000000000001\n2000000000000000",
"output": "1200000000000000"
},
{
"input": "740867\n467701",
"output": "467087"
},
{
"input": "2\n6",
"output": "2"
},
{
"input": "103\n130",
"output": "130"
},
{
"input": "2423712\n8466235",
"output": "7432221"
},
{
"input": "84\n48",
"output": "48"
},
{
"input": "1210\n12113",
"output": "2110"
},
{
"input": "2430\n20786",
"output": "4320"
},
{
"input": "100\n999",
"output": "100"
},
{
"input": "19325\n21903",
"output": "21593"
},
{
"input": "1969\n23251",
"output": "9961"
}
] | 1,517,074,222
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 157
| 62
| 5,632,000
|
a=input()
b=input()
o=0
t=[]
i=0
h=0
c=0
w=0
j=0
l=[int(d) for d in a]
k=[int(i) for i in b]
l.sort()
l.reverse()
if(len(l)<len(k)):
print(''.join(map(str,l)))
if(len(l)==len(k)):
for i in range(0,len(k)):
o=k[i]
if(o in l):
t.append(o)
l.remove(o)
l.sort()
l.reverse()
h=len(t)
else:
while(o not in l and o>=0):
o=o-1
if(o in l):
t.append(o)
l.remove(o)
l.sort()
l.reverse()
break
else:
while(c!=1):
for j in range(0,len(l)):
if(t[h-1]>l[j]):
c=c+1
w=l[j]
break
l.append(t[h-1])
l.sort()
l.reverse()
del(t[h-1])
h=len(t)
t.append(w)
l.remove(w)
l.sort()
l.reverse()
break
print(''.join(map(str,t+l)))
|
Title: Permute Digits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two positive integer numbers *a* and *b*. Permute (change order) of the digits of *a* to construct maximal number not exceeding *b*. No number in input and/or output can start with the digit 0.
It is allowed to leave *a* as it is.
Input Specification:
The first line contains integer *a* (1<=≤<=*a*<=≤<=1018). The second line contains integer *b* (1<=≤<=*b*<=≤<=1018). Numbers don't have leading zeroes. It is guaranteed that answer exists.
Output Specification:
Print the maximum possible number that is a permutation of digits of *a* and is not greater than *b*. The answer can't have any leading zeroes. It is guaranteed that the answer exists.
The number in the output should have exactly the same length as number *a*. It should be a permutation of digits of *a*.
Demo Input:
['123\n222\n', '3921\n10000\n', '4940\n5000\n']
Demo Output:
['213\n', '9321\n', '4940\n']
Note:
none
|
```python
a=input()
b=input()
o=0
t=[]
i=0
h=0
c=0
w=0
j=0
l=[int(d) for d in a]
k=[int(i) for i in b]
l.sort()
l.reverse()
if(len(l)<len(k)):
print(''.join(map(str,l)))
if(len(l)==len(k)):
for i in range(0,len(k)):
o=k[i]
if(o in l):
t.append(o)
l.remove(o)
l.sort()
l.reverse()
h=len(t)
else:
while(o not in l and o>=0):
o=o-1
if(o in l):
t.append(o)
l.remove(o)
l.sort()
l.reverse()
break
else:
while(c!=1):
for j in range(0,len(l)):
if(t[h-1]>l[j]):
c=c+1
w=l[j]
break
l.append(t[h-1])
l.sort()
l.reverse()
del(t[h-1])
h=len(t)
t.append(w)
l.remove(w)
l.sort()
l.reverse()
break
print(''.join(map(str,t+l)))
```
| 3
|
|
535
|
B
|
Tavas and SaDDas
|
PROGRAMMING
| 1,100
|
[
"bitmasks",
"brute force",
"combinatorics",
"implementation"
] | null | null |
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
|
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
|
Print the index of *n* among all lucky numbers.
|
[
"4\n",
"7\n",
"77\n"
] |
[
"1\n",
"2\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "4",
"output": "1"
},
{
"input": "7",
"output": "2"
},
{
"input": "77",
"output": "6"
},
{
"input": "4",
"output": "1"
},
{
"input": "474744",
"output": "83"
},
{
"input": "777774",
"output": "125"
},
{
"input": "447",
"output": "8"
},
{
"input": "774",
"output": "13"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447747",
"output": "140"
},
{
"input": "7747474",
"output": "233"
},
{
"input": "4444",
"output": "15"
},
{
"input": "4447",
"output": "16"
},
{
"input": "7",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447744",
"output": "139"
},
{
"input": "77474",
"output": "57"
},
{
"input": "7747",
"output": "28"
},
{
"input": "444",
"output": "7"
},
{
"input": "7",
"output": "2"
},
{
"input": "7774477",
"output": "242"
},
{
"input": "4477774",
"output": "157"
},
{
"input": "7444",
"output": "23"
},
{
"input": "7474747",
"output": "212"
},
{
"input": "77",
"output": "6"
},
{
"input": "774477",
"output": "114"
},
{
"input": "7",
"output": "2"
},
{
"input": "47",
"output": "4"
},
{
"input": "747777",
"output": "110"
},
{
"input": "444444444",
"output": "511"
},
{
"input": "777777777",
"output": "1022"
},
{
"input": "477477447",
"output": "728"
},
{
"input": "777744747",
"output": "996"
}
] | 1,582,293,945
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 33
| 156
| 0
|
n = input()
s = ""
for i in n:
if i == "4":
s += "0"
else:
s += "1"
need = len(s)
tot = 0
for i in range(1, need):
tot += 2**i
print(int(s, 2)+1+tot)
|
Title: Tavas and SaDDas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
Input Specification:
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
Print the index of *n* among all lucky numbers.
Demo Input:
['4\n', '7\n', '77\n']
Demo Output:
['1\n', '2\n', '6\n']
Note:
none
|
```python
n = input()
s = ""
for i in n:
if i == "4":
s += "0"
else:
s += "1"
need = len(s)
tot = 0
for i in range(1, need):
tot += 2**i
print(int(s, 2)+1+tot)
```
| 3
|
|
496
|
A
|
Minimum Difficulty
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Mike is trying rock climbing but he is awful at it.
There are *n* holds on the wall, *i*-th hold is at height *a**i* off the ground. Besides, let the sequence *a**i* increase, that is, *a**i*<=<<=*a**i*<=+<=1 for all *i* from 1 to *n*<=-<=1; we will call such sequence a track. Mike thinks that the track *a*1, ..., *a**n* has difficulty . In other words, difficulty equals the maximum distance between two holds that are adjacent in height.
Today Mike decided to cover the track with holds hanging on heights *a*1, ..., *a**n*. To make the problem harder, Mike decided to remove one hold, that is, remove one element of the sequence (for example, if we take the sequence (1,<=2,<=3,<=4,<=5) and remove the third element from it, we obtain the sequence (1,<=2,<=4,<=5)). However, as Mike is awful at climbing, he wants the final difficulty (i.e. the maximum difference of heights between adjacent holds after removing the hold) to be as small as possible among all possible options of removing a hold. The first and last holds must stay at their positions.
Help Mike determine the minimum difficulty of the track after removing one hold.
|
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=100) — the number of holds.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the height where the hold number *i* hangs. The sequence *a**i* is increasing (i.e. each element except for the first one is strictly larger than the previous one).
|
Print a single number — the minimum difficulty of the track after removing a single hold.
|
[
"3\n1 4 6\n",
"5\n1 2 3 4 5\n",
"5\n1 2 3 7 8\n"
] |
[
"5\n",
"2\n",
"4\n"
] |
In the first sample you can remove only the second hold, then the sequence looks like (1, 6), the maximum difference of the neighboring elements equals 5.
In the second test after removing every hold the difficulty equals 2.
In the third test you can obtain sequences (1, 3, 7, 8), (1, 2, 7, 8), (1, 2, 3, 8), for which the difficulty is 4, 5 and 5, respectively. Thus, after removing the second element we obtain the optimal answer — 4.
| 500
|
[
{
"input": "3\n1 4 6",
"output": "5"
},
{
"input": "5\n1 2 3 4 5",
"output": "2"
},
{
"input": "5\n1 2 3 7 8",
"output": "4"
},
{
"input": "3\n1 500 1000",
"output": "999"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "2"
},
{
"input": "10\n1 4 9 16 25 36 49 64 81 100",
"output": "19"
},
{
"input": "10\n300 315 325 338 350 365 379 391 404 416",
"output": "23"
},
{
"input": "15\n87 89 91 92 93 95 97 99 101 103 105 107 109 111 112",
"output": "2"
},
{
"input": "60\n3 5 7 8 15 16 18 21 24 26 40 41 43 47 48 49 50 51 52 54 55 60 62 71 74 84 85 89 91 96 406 407 409 412 417 420 423 424 428 431 432 433 436 441 445 446 447 455 458 467 469 471 472 475 480 485 492 493 497 500",
"output": "310"
},
{
"input": "3\n159 282 405",
"output": "246"
},
{
"input": "81\n6 7 22 23 27 38 40 56 59 71 72 78 80 83 86 92 95 96 101 122 125 127 130 134 154 169 170 171 172 174 177 182 184 187 195 197 210 211 217 223 241 249 252 253 256 261 265 269 274 277 291 292 297 298 299 300 302 318 338 348 351 353 381 386 387 397 409 410 419 420 428 430 453 460 461 473 478 493 494 500 741",
"output": "241"
},
{
"input": "10\n218 300 388 448 535 629 680 740 836 925",
"output": "111"
},
{
"input": "100\n6 16 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166 176 186 196 206 216 226 236 246 256 266 276 286 296 306 316 326 336 346 356 366 376 386 396 406 416 426 436 446 456 466 476 486 496 506 516 526 536 546 556 566 576 586 596 606 616 626 636 646 656 666 676 686 696 706 716 726 736 746 756 766 776 786 796 806 816 826 836 846 856 866 876 886 896 906 916 926 936 946 956 966 976 986 996",
"output": "20"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "901"
},
{
"input": "100\n1 9 15 17 28 29 30 31 32 46 48 49 52 56 62 77 82 85 90 91 94 101 102 109 111 113 116 118 124 125 131 132 136 138 139 143 145 158 161 162 165 167 171 173 175 177 179 183 189 196 801 802 804 806 817 819 827 830 837 840 842 846 850 855 858 862 863 866 869 870 878 881 883 884 896 898 899 901 904 906 908 909 910 911 912 917 923 924 925 935 939 943 945 956 963 964 965 972 976 978",
"output": "605"
},
{
"input": "100\n2 43 47 49 50 57 59 67 74 98 901 903 904 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 938 939 940 942 943 944 945 946 947 948 949 950 952 953 954 956 957 958 959 960 961 962 963 965 966 967 968 969 970 971 972 973 974 975 976 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 998 999",
"output": "803"
},
{
"input": "72\n178 186 196 209 217 226 236 248 260 273 281 291 300 309 322 331 343 357 366 377 389 399 409 419 429 442 450 459 469 477 491 501 512 524 534 548 557 568 582 593 602 616 630 643 652 660 670 679 693 707 715 728 737 750 759 768 776 789 797 807 815 827 837 849 863 873 881 890 901 910 920 932",
"output": "17"
},
{
"input": "38\n1 28 55 82 109 136 163 190 217 244 271 298 325 352 379 406 433 460 487 514 541 568 595 622 649 676 703 730 757 784 811 838 865 892 919 946 973 1000",
"output": "54"
},
{
"input": "28\n1 38 75 112 149 186 223 260 297 334 371 408 445 482 519 556 593 630 667 704 741 778 815 852 889 926 963 1000",
"output": "74"
}
] | 1,575,658,388
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 6
| 139
| 0
|
n=int(input())
x=input().split()
k=[]
l=[]
for i in range(1,n-1):
x.pop(i)
for j in range(n-2):
k.append((int(x[j+1])-int(x[j])))
l.append(max(k))
x.insert(i,x[i])
print(min(l))
|
Title: Minimum Difficulty
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mike is trying rock climbing but he is awful at it.
There are *n* holds on the wall, *i*-th hold is at height *a**i* off the ground. Besides, let the sequence *a**i* increase, that is, *a**i*<=<<=*a**i*<=+<=1 for all *i* from 1 to *n*<=-<=1; we will call such sequence a track. Mike thinks that the track *a*1, ..., *a**n* has difficulty . In other words, difficulty equals the maximum distance between two holds that are adjacent in height.
Today Mike decided to cover the track with holds hanging on heights *a*1, ..., *a**n*. To make the problem harder, Mike decided to remove one hold, that is, remove one element of the sequence (for example, if we take the sequence (1,<=2,<=3,<=4,<=5) and remove the third element from it, we obtain the sequence (1,<=2,<=4,<=5)). However, as Mike is awful at climbing, he wants the final difficulty (i.e. the maximum difference of heights between adjacent holds after removing the hold) to be as small as possible among all possible options of removing a hold. The first and last holds must stay at their positions.
Help Mike determine the minimum difficulty of the track after removing one hold.
Input Specification:
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=100) — the number of holds.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the height where the hold number *i* hangs. The sequence *a**i* is increasing (i.e. each element except for the first one is strictly larger than the previous one).
Output Specification:
Print a single number — the minimum difficulty of the track after removing a single hold.
Demo Input:
['3\n1 4 6\n', '5\n1 2 3 4 5\n', '5\n1 2 3 7 8\n']
Demo Output:
['5\n', '2\n', '4\n']
Note:
In the first sample you can remove only the second hold, then the sequence looks like (1, 6), the maximum difference of the neighboring elements equals 5.
In the second test after removing every hold the difficulty equals 2.
In the third test you can obtain sequences (1, 3, 7, 8), (1, 2, 7, 8), (1, 2, 3, 8), for which the difficulty is 4, 5 and 5, respectively. Thus, after removing the second element we obtain the optimal answer — 4.
|
```python
n=int(input())
x=input().split()
k=[]
l=[]
for i in range(1,n-1):
x.pop(i)
for j in range(n-2):
k.append((int(x[j+1])-int(x[j])))
l.append(max(k))
x.insert(i,x[i])
print(min(l))
```
| 0
|
|
442
|
B
|
Andrey and Problem
|
PROGRAMMING
| 1,800
|
[
"greedy",
"math",
"probabilities"
] | null | null |
Andrey needs one more problem to conduct a programming contest. He has *n* friends who are always willing to help. He can ask some of them to come up with a contest problem. Andrey knows one value for each of his fiends — the probability that this friend will come up with a problem if Andrey asks him.
Help Andrey choose people to ask. As he needs only one problem, Andrey is going to be really upset if no one comes up with a problem or if he gets more than one problem from his friends. You need to choose such a set of people that maximizes the chances of Andrey not getting upset.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of Andrey's friends. The second line contains *n* real numbers *p**i* (0.0<=≤<=*p**i*<=≤<=1.0) — the probability that the *i*-th friend can come up with a problem. The probabilities are given with at most 6 digits after decimal point.
|
Print a single real number — the probability that Andrey won't get upset at the optimal choice of friends. The answer will be considered valid if it differs from the correct one by at most 10<=-<=9.
|
[
"4\n0.1 0.2 0.3 0.8\n",
"2\n0.1 0.2\n"
] |
[
"0.800000000000\n",
"0.260000000000\n"
] |
In the first sample the best strategy for Andrey is to ask only one of his friends, the most reliable one.
In the second sample the best strategy for Andrey is to ask all of his friends to come up with a problem. Then the probability that he will get exactly one problem is 0.1·0.8 + 0.9·0.2 = 0.26.
| 1,500
|
[
{
"input": "4\n0.1 0.2 0.3 0.8",
"output": "0.800000000000"
},
{
"input": "2\n0.1 0.2",
"output": "0.260000000000"
},
{
"input": "1\n0.217266",
"output": "0.217266000000"
},
{
"input": "2\n0.608183 0.375030",
"output": "0.608183000000"
},
{
"input": "3\n0.388818 0.399762 0.393874",
"output": "0.478724284024"
},
{
"input": "4\n0.801024 0.610878 0.808545 0.732504",
"output": "0.808545000000"
},
{
"input": "5\n0.239482 0.686259 0.543226 0.764939 0.401318",
"output": "0.764939000000"
},
{
"input": "6\n0.462434 0.775020 0.479749 0.373861 0.492031 0.746333",
"output": "0.775020000000"
},
{
"input": "7\n0.745337 0.892271 0.792853 0.892917 0.768246 0.901623 0.815793",
"output": "0.901623000000"
},
{
"input": "1\n0.057695",
"output": "0.057695000000"
},
{
"input": "2\n0.057750 0.013591",
"output": "0.069771239500"
},
{
"input": "3\n0.087234 0.075148 0.033833",
"output": "0.172781711023"
},
{
"input": "4\n0.016717 0.061051 0.036222 0.096258",
"output": "0.181832937456"
},
{
"input": "5\n0.057095 0.046954 0.054676 0.025927 0.080810",
"output": "0.214634688963"
},
{
"input": "6\n0.010924 0.032857 0.021824 0.020356 0.007107 0.082489",
"output": "0.154629381329"
},
{
"input": "7\n0.016061 0.043107 0.088973 0.014785 0.044298 0.028315 0.086014",
"output": "0.246482855791"
},
{
"input": "100\n0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01",
"output": "0.369729637650"
},
{
"input": "1\n1.0",
"output": "1.000000000000"
},
{
"input": "3\n0.1 0.1 0.1",
"output": "0.243000000000"
},
{
"input": "3\n0.2 0.2 0.2",
"output": "0.384000000000"
},
{
"input": "5\n0.01 0.01 0.01 0.01 0.01",
"output": "0.048029800500"
},
{
"input": "3\n1.0 1.0 0",
"output": "1.000000000000"
},
{
"input": "3\n0.1 0.2 0.3",
"output": "0.398000000000"
},
{
"input": "7\n0.1 0.1 0.1 0.1 0.1 0.1 0.1",
"output": "0.372008700000"
},
{
"input": "5\n0.5 0.5 0.5 1 0.5",
"output": "1.000000000000"
},
{
"input": "3\n0.4 0.2 0.4",
"output": "0.480000000000"
},
{
"input": "10\n0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1",
"output": "0.387420489000"
},
{
"input": "2\n1.0 1.0",
"output": "1.000000000000"
},
{
"input": "10\n0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01",
"output": "0.091351724748"
},
{
"input": "5\n1.0 1.0 1.0 0.1 0",
"output": "1.000000000000"
},
{
"input": "5\n0.0001 0.0001 0.0001 0.0001 0.0001",
"output": "0.000499800030"
},
{
"input": "20\n0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1",
"output": "0.387420489000"
},
{
"input": "2\n0.0 1.0",
"output": "1.000000000000"
},
{
"input": "5\n0.00001 0.00001 0.00001 0.00001 0.00001",
"output": "0.000049998000"
},
{
"input": "3\n0.2 0.8 1",
"output": "1.000000000000"
},
{
"input": "4\n0.1 0.1 0.1 0.1",
"output": "0.291600000000"
},
{
"input": "5\n0.31 0.21 0.05 0.37 0.18",
"output": "0.450600000000"
},
{
"input": "5\n1 1 1 1 1",
"output": "1.000000000000"
},
{
"input": "4\n1 1 1 1",
"output": "1.000000000000"
},
{
"input": "7\n0.14 0.28 0.13 0.31 0.15 0.17 0.27",
"output": "0.438108000000"
},
{
"input": "20\n0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001",
"output": "0.019623400697"
},
{
"input": "100\n0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1",
"output": "0.387420489000"
}
] | 1,566,749,823
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 60
| 155
| 0
|
# Contest: 20 - 2100 <= Codeforces Rating <= 2199 (https://a2oj.com/ladder?ID=20)
# Problem: (16) Andrey and Problem (Difficulty: 4) (http://codeforces.com/problemset/problem/442/B)
def rint():
return int(input())
def rints():
return list(map(int, input().split()))
n = rint()
p = sorted((float(s) for s in input().split()), reverse=True)
pr = 0
inv = 1
for pi in p:
npr = pr * (1 - pi) + inv * pi
if npr < pr:
break
pr = npr
inv *= (1 - pi)
print(pr)
|
Title: Andrey and Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andrey needs one more problem to conduct a programming contest. He has *n* friends who are always willing to help. He can ask some of them to come up with a contest problem. Andrey knows one value for each of his fiends — the probability that this friend will come up with a problem if Andrey asks him.
Help Andrey choose people to ask. As he needs only one problem, Andrey is going to be really upset if no one comes up with a problem or if he gets more than one problem from his friends. You need to choose such a set of people that maximizes the chances of Andrey not getting upset.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of Andrey's friends. The second line contains *n* real numbers *p**i* (0.0<=≤<=*p**i*<=≤<=1.0) — the probability that the *i*-th friend can come up with a problem. The probabilities are given with at most 6 digits after decimal point.
Output Specification:
Print a single real number — the probability that Andrey won't get upset at the optimal choice of friends. The answer will be considered valid if it differs from the correct one by at most 10<=-<=9.
Demo Input:
['4\n0.1 0.2 0.3 0.8\n', '2\n0.1 0.2\n']
Demo Output:
['0.800000000000\n', '0.260000000000\n']
Note:
In the first sample the best strategy for Andrey is to ask only one of his friends, the most reliable one.
In the second sample the best strategy for Andrey is to ask all of his friends to come up with a problem. Then the probability that he will get exactly one problem is 0.1·0.8 + 0.9·0.2 = 0.26.
|
```python
# Contest: 20 - 2100 <= Codeforces Rating <= 2199 (https://a2oj.com/ladder?ID=20)
# Problem: (16) Andrey and Problem (Difficulty: 4) (http://codeforces.com/problemset/problem/442/B)
def rint():
return int(input())
def rints():
return list(map(int, input().split()))
n = rint()
p = sorted((float(s) for s in input().split()), reverse=True)
pr = 0
inv = 1
for pi in p:
npr = pr * (1 - pi) + inv * pi
if npr < pr:
break
pr = npr
inv *= (1 - pi)
print(pr)
```
| 3
|
|
205
|
A
|
Little Elephant and Rozdil
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
|
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
|
[
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] |
[
"2\n",
"Still Rozdil\n"
] |
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
| 500
|
[
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,569,952,587
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 2,000
| 7,065,600
|
n = int(input())
x = list(map(int, input().split()))
c = 0
for i in range(len(x)):
if x[i] == min(x):
c = c + 1
if c == 1:
print(i + 1)
else:
print("Still Rozdil")
|
Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
|
```python
n = int(input())
x = list(map(int, input().split()))
c = 0
for i in range(len(x)):
if x[i] == min(x):
c = c + 1
if c == 1:
print(i + 1)
else:
print("Still Rozdil")
```
| 0
|
|
337
|
A
|
Puzzles
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
|
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
|
Print a single integer — the least possible difference the teacher can obtain.
|
[
"4 6\n10 12 10 7 5 22\n"
] |
[
"5\n"
] |
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
| 500
|
[
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,695,142,780
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 92
| 0
|
n,m = map(int,input().split())
l1 = list(map(int,input().split()))
l1.sort()
a = 0
sumf = 9999
b = n - 1
while b < m:
if l1[b] - l1[a] < sumf:
sumf = min(l1[b] - l1[a] , sumf)
a += 1
b += 1
print(sumf)
|
Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
|
```python
n,m = map(int,input().split())
l1 = list(map(int,input().split()))
l1.sort()
a = 0
sumf = 9999
b = n - 1
while b < m:
if l1[b] - l1[a] < sumf:
sumf = min(l1[b] - l1[a] , sumf)
a += 1
b += 1
print(sumf)
```
| 3
|
|
281
|
A
|
Word Capitalization
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500
|
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,698,903,264
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 25
| 154
| 0
|
s=input()
str=s[0].upper()+s[1:]
print(str)#jkdfsdfghmn
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
s=input()
str=s[0].upper()+s[1:]
print(str)#jkdfsdfghmn
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,657,112,908
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 80
| 218
| 512,000
|
a=[]
b=[0,0,0]
for i in range(int(input())):
a=[int(i) for i in input().split()]
b=[b[1]+a[1],b[2]+a[2],b[0]+a[0]]
if(sum(b)==0):
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
a=[]
b=[0,0,0]
for i in range(int(input())):
a=[int(i) for i in input().split()]
b=[b[1]+a[1],b[2]+a[2],b[0]+a[0]]
if(sum(b)==0):
print("YES")
else:
print("NO")
```
| 0
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,665,076,835
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
from itertools import takewhile
n, m = [int(i) for i in input().split(" ")]
arr = [int(i) for i in input().split(" ")]
iter = takewhile(lambda x: x[0] < m and x[1] < 0, enumerate(arr))
print(sum(abs(i[1]) for i in iter))
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
from itertools import takewhile
n, m = [int(i) for i in input().split(" ")]
arr = [int(i) for i in input().split(" ")]
iter = takewhile(lambda x: x[0] < m and x[1] < 0, enumerate(arr))
print(sum(abs(i[1]) for i in iter))
```
| 0
|
1,009
|
A
|
Game Shopping
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
|
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
|
Print a single integer — the number of games Maxim will buy.
|
[
"5 4\n2 4 5 2 4\n5 3 4 6\n",
"5 2\n20 40 50 20 40\n19 20\n",
"6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n"
] |
[
"3\n",
"0\n",
"4\n"
] |
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
| 0
|
[
{
"input": "5 4\n2 4 5 2 4\n5 3 4 6",
"output": "3"
},
{
"input": "5 2\n20 40 50 20 40\n19 20",
"output": "0"
},
{
"input": "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000",
"output": "4"
},
{
"input": "5 1\n1 1 1 1 1\n5",
"output": "1"
},
{
"input": "5 1\n10 1 1 1 1\n1000",
"output": "1"
},
{
"input": "5 1\n100 100 100 100 100\n100",
"output": "1"
},
{
"input": "2 1\n2 1\n1",
"output": "1"
},
{
"input": "2 3\n3 1\n2 4 2",
"output": "1"
},
{
"input": "1 5\n4\n1 4 3 3 2",
"output": "0"
},
{
"input": "5 3\n4 2 3 1 1\n2 1 3",
"output": "3"
},
{
"input": "3 5\n5 2 5\n1 4 1 4 2",
"output": "0"
},
{
"input": "7 3\n9 7 10 2 1 1 1\n8 9 6",
"output": "3"
},
{
"input": "5 3\n2 5 3 3 2\n2 5 3",
"output": "3"
}
] | 1,531,850,462
| 362
|
Python 3
|
OK
|
TESTS
| 19
| 124
| 102,400
|
n, m = [int(i) for i in input().split()]
a = [int(i) for i in input().split()]
b = [int(i) for i in input().split()]
i = 0
j = 0
ans = 0
while i < n and j < m:
if a[i] <= b[j]:
i += 1
j += 1
ans += 1
else:
i += 1
print(j)
|
Title: Game Shopping
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
Input Specification:
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
Output Specification:
Print a single integer — the number of games Maxim will buy.
Demo Input:
['5 4\n2 4 5 2 4\n5 3 4 6\n', '5 2\n20 40 50 20 40\n19 20\n', '6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n']
Demo Output:
['3\n', '0\n', '4\n']
Note:
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
|
```python
n, m = [int(i) for i in input().split()]
a = [int(i) for i in input().split()]
b = [int(i) for i in input().split()]
i = 0
j = 0
ans = 0
while i < n and j < m:
if a[i] <= b[j]:
i += 1
j += 1
ans += 1
else:
i += 1
print(j)
```
| 3
|
|
863
|
B
|
Kayaking
|
PROGRAMMING
| 1,500
|
[
"brute force",
"greedy",
"sortings"
] | null | null |
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
|
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
|
Print minimum possible total instability.
|
[
"2\n1 2 3 4\n",
"4\n1 3 4 6 3 4 100 200\n"
] |
[
"1\n",
"5\n"
] |
none
| 0
|
[
{
"input": "2\n1 2 3 4",
"output": "1"
},
{
"input": "4\n1 3 4 6 3 4 100 200",
"output": "5"
},
{
"input": "3\n305 139 205 406 530 206",
"output": "102"
},
{
"input": "3\n610 750 778 6 361 407",
"output": "74"
},
{
"input": "5\n97 166 126 164 154 98 221 7 51 47",
"output": "35"
},
{
"input": "50\n1 1 2 2 1 3 2 2 1 1 1 1 2 3 3 1 2 1 3 3 2 1 2 3 1 1 2 1 3 1 3 1 3 3 3 1 1 1 3 3 2 2 2 2 3 2 2 2 2 3 1 3 3 3 3 1 3 3 1 3 3 3 3 2 3 1 3 3 1 1 1 3 1 2 2 2 1 1 1 3 1 2 3 2 1 3 3 2 2 1 3 1 3 1 2 2 1 2 3 2",
"output": "0"
},
{
"input": "50\n5 5 5 5 4 2 2 3 2 2 4 1 5 5 1 2 4 2 4 2 5 2 2 2 2 3 2 4 2 5 5 4 3 1 2 3 3 5 4 2 2 5 2 4 5 5 4 4 1 5 5 3 2 2 5 1 3 3 2 4 4 5 1 2 3 4 4 1 3 3 3 5 1 2 4 4 4 4 2 5 2 5 3 2 4 5 5 2 1 1 2 4 5 3 2 1 2 4 4 4",
"output": "1"
},
{
"input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319 382 651 594 411 845 746 18 232 6 289 889 81 174 175 805 1000 799 950 475 713 951 685 729 925 262 447 139 217 788 514 658 572 784 185 112 636 10 251 621 218 210 89 597 553 430 532 264 11 160 476",
"output": "368"
},
{
"input": "50\n873 838 288 87 889 364 720 410 565 651 577 356 740 99 549 592 994 385 777 435 486 118 887 440 749 533 356 790 413 681 267 496 475 317 88 660 374 186 61 437 729 860 880 538 277 301 667 180 60 393 955 540 896 241 362 146 74 680 734 767 851 337 751 860 542 735 444 793 340 259 495 903 743 961 964 966 87 275 22 776 368 701 835 732 810 735 267 988 352 647 924 183 1 924 217 944 322 252 758 597",
"output": "393"
},
{
"input": "50\n297 787 34 268 439 629 600 398 425 833 721 908 830 636 64 509 420 647 499 675 427 599 396 119 798 742 577 355 22 847 389 574 766 453 196 772 808 261 106 844 726 975 173 992 874 89 775 616 678 52 69 591 181 573 258 381 665 301 589 379 362 146 790 842 765 100 229 916 938 97 340 793 758 177 736 396 247 562 571 92 923 861 165 748 345 703 431 930 101 761 862 595 505 393 126 846 431 103 596 21",
"output": "387"
},
{
"input": "50\n721 631 587 746 692 406 583 90 388 16 161 948 921 70 387 426 39 398 517 724 879 377 906 502 359 950 798 408 846 718 911 845 57 886 9 668 537 632 344 762 19 193 658 447 870 173 98 156 592 519 183 539 274 393 962 615 551 626 148 183 769 763 829 120 796 761 14 744 537 231 696 284 581 688 611 826 703 145 224 600 965 613 791 275 984 375 402 281 851 580 992 8 816 454 35 532 347 250 242 637",
"output": "376"
},
{
"input": "50\n849 475 37 120 754 183 758 374 543 198 896 691 11 607 198 343 761 660 239 669 628 259 223 182 216 158 20 565 454 884 137 923 156 22 310 77 267 707 582 169 120 308 439 309 59 152 206 696 210 177 296 887 559 22 154 553 142 247 491 692 473 572 461 206 532 319 503 164 328 365 541 366 300 392 486 257 863 432 877 404 520 69 418 99 519 239 374 927 601 103 226 316 423 219 240 26 455 101 184 61",
"output": "351"
},
{
"input": "3\n1 2 10 11 100 100",
"output": "1"
},
{
"input": "17\n814 744 145 886 751 1000 272 914 270 529 467 164 410 369 123 424 991 12 702 582 561 858 746 950 598 393 606 498 648 686 455 873 728 858",
"output": "318"
},
{
"input": "45\n476 103 187 696 463 457 588 632 763 77 391 721 95 124 378 812 980 193 694 898 859 572 721 274 605 264 929 615 257 918 42 493 1 3 697 349 990 800 82 535 382 816 943 735 11 272 562 323 653 370 766 332 666 130 704 604 645 717 267 255 37 470 925 941 376 611 332 758 504 40 477 263 708 434 38 596 650 990 714 662 572 467 949 799 648 581 545 828 508 636",
"output": "355"
},
{
"input": "2\n55 5 25 51",
"output": "4"
},
{
"input": "25\n89 50 640 463 858 301 522 241 923 378 892 822 550 17 42 66 706 779 657 840 273 222 444 459 94 925 437 159 182 727 92 851 742 215 653 891 782 533 29 128 133 883 317 475 165 994 802 434 744 973",
"output": "348"
},
{
"input": "4\n35 48 71 44 78 79 57 48",
"output": "10"
},
{
"input": "3\n58 89 73 15 5 47",
"output": "21"
},
{
"input": "2\n1 20 99 100",
"output": "1"
}
] | 1,601,191,993
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
#include <cstdio>
#include <cstring>
#include <algorithm>
using namespace std;
const int maxn=1000;
const int inf=0x3f3f3f3f;
int a[maxn];
int b[maxn];
int main()
{
int n;
int ans;
while(cin>>n)
{
ans=inf;
n=n<<1;
for(int i=0;i<n;i++) cin>>a[i];
for(int i=0;i<n;i++)
for(int j=0;j<n;j++)
{
if(i==j) continue;
memset(b,0,sizeof(b));
int num=0;
for(int k=0;k<n;k++)
{
if(k!=i && k!=j) b[num++]=a[k];
}
sort(b,b+num);
int sum=0;
for(int k=0;k<num;k+=2)
sum+=b[k+1]-b[k];
ans=min(ans,sum);
}
cout<<ans<<endl;
}
return 0;
}
|
Title: Kayaking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
Input Specification:
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
Output Specification:
Print minimum possible total instability.
Demo Input:
['2\n1 2 3 4\n', '4\n1 3 4 6 3 4 100 200\n']
Demo Output:
['1\n', '5\n']
Note:
none
|
```python
#include <iostream>
#include <cstdio>
#include <cstring>
#include <algorithm>
using namespace std;
const int maxn=1000;
const int inf=0x3f3f3f3f;
int a[maxn];
int b[maxn];
int main()
{
int n;
int ans;
while(cin>>n)
{
ans=inf;
n=n<<1;
for(int i=0;i<n;i++) cin>>a[i];
for(int i=0;i<n;i++)
for(int j=0;j<n;j++)
{
if(i==j) continue;
memset(b,0,sizeof(b));
int num=0;
for(int k=0;k<n;k++)
{
if(k!=i && k!=j) b[num++]=a[k];
}
sort(b,b+num);
int sum=0;
for(int k=0;k<num;k+=2)
sum+=b[k+1]-b[k];
ans=min(ans,sum);
}
cout<<ans<<endl;
}
return 0;
}
```
| -1
|
|
225
|
B
|
Well-known Numbers
|
PROGRAMMING
| 1,600
|
[
"binary search",
"greedy",
"number theory"
] | null | null |
Numbers *k*-bonacci (*k* is integer, *k*<=><=1) are a generalization of Fibonacci numbers and are determined as follows:
- *F*(*k*,<=*n*)<==<=0, for integer *n*, 1<=≤<=*n*<=<<=*k*; - *F*(*k*,<=*k*)<==<=1; - *F*(*k*,<=*n*)<==<=*F*(*k*,<=*n*<=-<=1)<=+<=*F*(*k*,<=*n*<=-<=2)<=+<=...<=+<=*F*(*k*,<=*n*<=-<=*k*), for integer *n*, *n*<=><=*k*.
Note that we determine the *k*-bonacci numbers, *F*(*k*,<=*n*), only for integer values of *n* and *k*.
You've got a number *s*, represent it as a sum of several (at least two) distinct *k*-bonacci numbers.
|
The first line contains two integers *s* and *k* (1<=≤<=*s*,<=*k*<=≤<=109; *k*<=><=1).
|
In the first line print an integer *m* (*m*<=≥<=2) that shows how many numbers are in the found representation. In the second line print *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m*. Each printed integer should be a *k*-bonacci number. The sum of printed integers must equal *s*.
It is guaranteed that the answer exists. If there are several possible answers, print any of them.
|
[
"5 2\n",
"21 5\n"
] |
[
"3\n0 2 3\n",
"3\n4 1 16\n"
] |
none
| 1,000
|
[
{
"input": "5 2",
"output": "3\n0 2 3"
},
{
"input": "21 5",
"output": "3\n4 1 16"
},
{
"input": "1 1000",
"output": "2\n1 0 "
},
{
"input": "1000000000 1000000000",
"output": "14\n536870912 268435456 134217728 33554432 16777216 8388608 1048576 524288 131072 32768 16384 2048 512 0 "
},
{
"input": "122 7",
"output": "6\n64 32 16 8 2 0 "
},
{
"input": "4 3",
"output": "2\n4 0 "
},
{
"input": "321123 3211232",
"output": "11\n262144 32768 16384 8192 1024 512 64 32 2 1 0 "
},
{
"input": "1 2",
"output": "2\n1 0 "
},
{
"input": "2 2",
"output": "2\n2 0 "
},
{
"input": "3 2",
"output": "2\n3 0 "
},
{
"input": "8 2",
"output": "2\n8 0 "
},
{
"input": "17 2",
"output": "4\n13 3 1 0 "
},
{
"input": "137 2",
"output": "5\n89 34 13 1 0 "
},
{
"input": "7298 2",
"output": "7\n6765 377 144 8 3 1 0 "
},
{
"input": "76754 2",
"output": "7\n75025 1597 89 34 8 1 0 "
},
{
"input": "12345678 2",
"output": "8\n9227465 2178309 832040 75025 28657 4181 1 0 "
},
{
"input": "987654321 2",
"output": "16\n701408733 267914296 14930352 2178309 832040 317811 46368 17711 6765 1597 233 89 13 3 1 0 "
},
{
"input": "1000000000 2",
"output": "15\n701408733 267914296 24157817 5702887 514229 196418 75025 28657 1597 233 89 13 5 1 0 "
},
{
"input": "701408733 2",
"output": "2\n701408733 0 "
},
{
"input": "1 3",
"output": "2\n1 0 "
},
{
"input": "2 3",
"output": "2\n2 0 "
},
{
"input": "3 3",
"output": "3\n2 1 0 "
},
{
"input": "100 3",
"output": "5\n81 13 4 2 0 "
},
{
"input": "87783 3",
"output": "8\n66012 19513 1705 504 44 4 1 0 "
},
{
"input": "615693473 3",
"output": "23\n334745777 181997601 53798080 29249425 8646064 4700770 1389537 755476 223317 121415 35890 19513 5768 3136 927 504 149 81 24 13 4 2 0 "
},
{
"input": "615693474 3",
"output": "2\n615693474 0 "
},
{
"input": "1000000000 3",
"output": "15\n615693474 334745777 29249425 15902591 2555757 1389537 410744 35890 10609 5768 274 149 4 1 0 "
},
{
"input": "1 4",
"output": "2\n1 0 "
},
{
"input": "2 4",
"output": "2\n2 0 "
},
{
"input": "17 4",
"output": "3\n15 2 0 "
},
{
"input": "234 4",
"output": "6\n208 15 8 2 1 0 "
},
{
"input": "23435345 4",
"output": "13\n14564533 7555935 1055026 147312 76424 20569 10671 2872 1490 401 108 4 0 "
},
{
"input": "989464701 4",
"output": "18\n747044834 201061985 28074040 7555935 3919944 1055026 547337 147312 39648 10671 5536 1490 773 108 56 4 2 0 "
},
{
"input": "464 5",
"output": "2\n464 0 "
},
{
"input": "7647474 5",
"output": "8\n5976577 1546352 103519 13624 6930 464 8 0 "
},
{
"input": "457787655 5",
"output": "14\n345052351 89277256 23099186 203513 103519 26784 13624 6930 3525 912 31 16 8 0 "
},
{
"input": "764747 6",
"output": "13\n463968 233904 59448 3840 1936 976 492 125 32 16 8 2 0 "
},
{
"input": "980765665 7",
"output": "16\n971364608 7805695 987568 495776 62725 31489 15808 1004 504 253 127 64 32 8 4 0 "
},
{
"input": "877655444 8",
"output": "17\n512966536 256993248 64504063 32316160 8111200 2035872 510994 128257 64256 16128 8080 509 128 8 4 1 0 "
},
{
"input": "567886500 9",
"output": "11\n525375999 32965728 8257696 1035269 129792 64960 32512 16272 8144 128 0 "
},
{
"input": "656777660 10",
"output": "13\n531372800 66519472 33276064 16646200 8327186 521472 65280 32656 16336 128 64 2 0 "
},
{
"input": "197445609 11",
"output": "18\n133628064 33423378 16715781 8359937 4180992 1045760 65424 16364 8184 1024 512 128 32 16 8 4 1 0 "
},
{
"input": "647474474 12",
"output": "18\n535625888 66977797 33492993 8375296 2094336 523712 261888 65488 32748 16376 4095 2048 1024 512 256 16 1 0 "
},
{
"input": "856644446 14",
"output": "16\n536592385 268304384 33541120 16771072 1048320 262096 65528 32765 16383 8192 2048 128 16 8 1 0 "
},
{
"input": "980345678 19",
"output": "18\n536864768 268432640 134216448 33554176 4194284 2097144 524287 262144 131072 65536 2048 1024 64 32 8 2 1 0 "
},
{
"input": "561854567 23",
"output": "17\n536870656 16777213 4194304 2097152 1048576 524288 262144 65536 8192 4096 2048 256 64 32 8 2 0 "
},
{
"input": "987654321 27",
"output": "20\n536870904 268435453 134217727 33554432 8388608 4194304 1048576 524288 262144 131072 16384 8192 2048 128 32 16 8 4 1 0 "
},
{
"input": "780787655 29",
"output": "18\n536870911 134217728 67108864 33554432 8388608 524288 65536 32768 16384 4096 2048 1024 512 256 128 64 8 0 "
},
{
"input": "999999999 30",
"output": "22\n536870912 268435456 134217728 33554432 16777216 8388608 1048576 524288 131072 32768 16384 2048 256 128 64 32 16 8 4 2 1 0 "
},
{
"input": "1 50",
"output": "2\n1 0 "
},
{
"input": "5 54",
"output": "3\n4 1 0 "
},
{
"input": "378 83",
"output": "7\n256 64 32 16 8 2 0 "
},
{
"input": "283847 111",
"output": "10\n262144 16384 4096 1024 128 64 4 2 1 0 "
},
{
"input": "38746466 2847",
"output": "14\n33554432 4194304 524288 262144 131072 65536 8192 4096 2048 256 64 32 2 0 "
},
{
"input": "83768466 12345",
"output": "15\n67108864 8388608 4194304 2097152 1048576 524288 262144 131072 8192 4096 1024 128 16 2 0 "
},
{
"input": "987654321 7475657",
"output": "18\n536870912 268435456 134217728 33554432 8388608 4194304 1048576 524288 262144 131072 16384 8192 2048 128 32 16 1 0 "
},
{
"input": "10 174764570",
"output": "3\n8 2 0 "
},
{
"input": "967755664 974301345",
"output": "17\n536870912 268435456 134217728 16777216 8388608 2097152 524288 262144 131072 32768 16384 1024 512 256 128 16 0 "
},
{
"input": "76 758866446",
"output": "4\n64 8 4 0 "
},
{
"input": "1 1000000000",
"output": "2\n1 0 "
},
{
"input": "469766205 719342208",
"output": "10\n268435456 134217728 67108864 4096 32 16 8 4 1 0 "
},
{
"input": "918938066 77",
"output": "17\n536870912 268435456 67108864 33554432 8388608 4194304 262144 65536 32768 16384 8192 256 128 64 16 2 0 "
},
{
"input": "856089381 19",
"output": "15\n536864768 268432640 33554176 16777104 262144 131072 65536 1024 512 256 128 16 4 1 0 "
},
{
"input": "152235195 16",
"output": "16\n134204416 16775936 1048528 131069 65535 8192 1024 256 128 64 32 8 4 2 1 0 "
},
{
"input": "429960894 3101",
"output": "17\n268435456 134217728 16777216 8388608 2097152 32768 8192 2048 1024 512 128 32 16 8 4 2 0 "
},
{
"input": "450695564 7",
"output": "18\n244804400 122895984 61695880 15548665 3918592 987568 495776 248888 62725 31489 3984 1004 504 64 32 8 1 0 "
},
{
"input": "154517270 24",
"output": "18\n134217708 16777215 2097152 1048576 262144 65536 32768 8192 4096 2048 1024 512 256 32 8 2 1 0 "
},
{
"input": "300919980 24",
"output": "20\n268435408 16777215 8388608 4194304 2097152 524288 262144 131072 65536 32768 8192 2048 1024 128 64 16 8 4 1 0 "
},
{
"input": "900077555 2",
"output": "16\n701408733 165580141 24157817 5702887 2178309 832040 196418 17711 2584 610 233 55 13 3 1 0 "
},
{
"input": "172285923 26",
"output": "17\n134217725 33554432 4194304 262144 32768 16384 4096 2048 1024 512 256 128 64 32 4 2 0 "
}
] | 1,614,577,597
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
"""
⣿⣿⣿⣿⣿⣿⡷⣯⢿⣿⣷⣻⢯⣿⡽⣻⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣇⠸⣿⣿⣆⠹⣿⣿⢾⣟⣯⣿⣿⣿⣿⣿⣿⣽⣻⣿⣿⣿⣿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣻⣽⡿⣿⣎⠙⣿⣞⣷⡌⢻⣟⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣷⣿⣿⣿⣿⣿⣿⡄⠹⣿⣿⡆⠻⣿⣟⣯⡿⣽⡿⣿⣿⣿⣿⣽⡷⣯⣿⣿⣿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣟⣷⣿⣿⣿⡀⠹⣟⣾⣟⣆⠹⣯⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡇⢠⡘⣿⣿⡄⠉⢿⣿⣽⡷⣿⣻⣿⣿⣿⣿⡝⣷⣯⢿⣿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣯⢿⣾⢿⣿⡄⢄⠘⢿⣞⡿⣧⡈⢷⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡇⢸⣧⠘⣿⣷⠈⣦⠙⢿⣽⣷⣻⣽⣿⣿⣿⣿⣌⢿⣯⢿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣟⣯⣿⢿⣿⡆⢸⡷⡈⢻⡽⣷⡷⡄⠻⣽⣿⣿⡿⣿⣿⣿⣿⣿⣿⣷⣿⣿⣿⣿⣏⢰⣯⢷⠈⣿⡆⢹⢷⡌⠻⡾⢋⣱⣯⣿⣿⣿⣿⡆⢻⡿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⡎⣿⢾⡿⣿⡆⢸⣽⢻⣄⠹⣷⣟⣿⣄⠹⣟⣿⣿⣟⣿⣿⣿⣿⣿⣿⣽⣿⣿⣿⡇⢸⣯⣟⣧⠘⣷⠈⡯⠛⢀⡐⢾⣟⣷⣻⣿⣿⣿⡿⡌⢿⣻⣿⣿
⣿⣿⣿⣿⣿⣿⣧⢸⡿⣟⣿⡇⢸⣯⣟⣮⢧⡈⢿⣞⡿⣦⠘⠏⣹⣿⣽⢿⣿⣿⣿⣿⣯⣿⣿⣿⡇⢸⣿⣿⣾⡆⠹⢀⣠⣾⣟⣷⡈⢿⣞⣯⢿⣿⣿⣿⢷⠘⣯⣿⣿
⣿⣿⣿⣿⣿⣿⣿⡈⣿⢿⣽⡇⠘⠛⠛⠛⠓⠓⠈⠛⠛⠟⠇⢀⢿⣻⣿⣯⢿⣿⣿⣿⣷⢿⣿⣿⠁⣾⣿⣿⣿⣧⡄⠇⣹⣿⣾⣯⣿⡄⠻⣽⣯⢿⣻⣿⣿⡇⢹⣾⣿
⣿⣿⣿⣿⣿⣿⣿⡇⢹⣿⡽⡇⢸⣿⣿⣿⣿⣿⣞⣆⠰⣶⣶⡄⢀⢻⡿⣯⣿⡽⣿⣿⣿⢯⣟⡿⢀⣿⣿⣿⣿⣿⣧⠐⣸⣿⣿⣷⣿⣿⣆⠹⣯⣿⣻⣿⣿⣿⢀⣿⢿
⣿⣿⣿⣿⣿⣿⣿⣿⠘⣯⡿⡇⢸⣿⣿⣿⣿⣿⣿⣿⣧⡈⢿⣳⠘⡄⠻⣿⢾⣽⣟⡿⣿⢯⣿⡇⢸⣿⣿⣿⣿⣿⣿⡀⢾⣿⣿⣿⣿⣿⣿⣆⠹⣾⣷⣻⣿⡿⡇⢸⣿
⣿⣿⣿⣿⣿⣿⣿⣿⡇⢹⣿⠇⢸⣿⣿⣿⣿⣿⣿⣿⣿⣷⣄⠻⡇⢹⣆⠹⣟⣾⣽⣻⣟⣿⣽⠁⣾⣿⣿⣿⣿⣿⣿⣇⣿⣿⠿⠛⠛⠉⠙⠋⢀⠁⢘⣯⣿⣿⣧⠘⣿
⣿⣿⣿⣿⣿⣿⣿⣿⣿⡈⣿⡃⢼⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣦⡙⠌⣿⣆⠘⣿⣞⡿⣞⡿⡞⢠⣿⣿⣿⣿⣿⡿⠛⠉⠁⢀⣀⣠⣤⣤⣶⣶⣶⡆⢻⣽⣞⡿⣷⠈⣿
⣿⣿⣿⣿⣿⣿⣿⣿⡿⠃⠘⠁⠉⠉⠉⠉⠉⠉⠉⠉⠉⠙⠛⠛⢿⣄⢻⣿⣧⠘⢯⣟⡿⣽⠁⣾⣿⣿⣿⣿⣿⡃⢀⢀⠘⠛⠿⢿⣻⣟⣯⣽⣻⣵⡀⢿⣯⣟⣿⢀⣿
⣿⣿⣿⣟⣿⣿⣿⣿⣶⣶⡆⢀⣿⣾⣿⣾⣷⣿⣶⠿⠚⠉⢀⢀⣤⣿⣷⣿⣿⣷⡈⢿⣻⢃⣼⣿⣿⣿⣿⣻⣿⣿⣿⡶⣦⣤⣄⣀⡀⠉⠛⠛⠷⣯⣳⠈⣾⡽⣾⢀⣿
⣿⢿⣿⣿⣻⣿⣿⣿⣿⣿⡿⠐⣿⣿⣿⣿⠿⠋⠁⢀⢀⣤⣾⣿⣿⣿⣿⣿⣿⣿⣿⣌⣥⣾⡿⣿⣿⣷⣿⣿⢿⣷⣿⣿⣟⣾⣽⣳⢯⣟⣶⣦⣤⡾⣟⣦⠘⣿⢾⡁⢺
⣿⣻⣿⣿⡷⣿⣿⣿⣿⣿⡗⣦⠸⡿⠋⠁⢀⢀⣠⣴⢿⣿⣽⣻⢽⣾⣟⣷⣿⣟⣿⣿⣿⣳⠿⣵⣧⣼⣿⣿⣿⣿⣿⣾⣿⣿⣿⣿⣿⣽⣳⣯⣿⣿⣿⣽⢀⢷⣻⠄⠘
⣿⢷⣻⣿⣿⣷⣻⣿⣿⣿⡷⠛⣁⢀⣀⣤⣶⣿⣛⡿⣿⣮⣽⡻⣿⣮⣽⣻⢯⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣯⢀⢸⣿⢀⡆
⠸⣟⣯⣿⣿⣷⢿⣽⣿⣿⣷⣿⣷⣆⠹⣿⣶⣯⠿⣿⣶⣟⣻⢿⣷⣽⣻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⢀⣯⣟⢀⡇
⣇⠹⣟⣾⣻⣿⣿⢾⡽⣿⣿⣿⣿⣿⣆⢹⣶⣿⣻⣷⣯⣟⣿⣿⣽⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⢀⡿⡇⢸⡇
⣿⣆⠹⣷⡻⣽⣿⣯⢿⣽⣻⣿⣿⣿⣿⣆⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠛⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠇⢸⣿⠇⣼⡇
⡙⠾⣆⠹⣿⣦⠛⣿⢯⣷⢿⡽⣿⣿⣿⣿⣆⠻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠃⠎⢸⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠏⢀⣿⣾⣣⡿⡇
⣿⣷⡌⢦⠙⣿⣿⣌⠻⣽⢯⣿⣽⣻⣿⣿⣿⣧⠩⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡏⢰⢣⠘⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠃⢀⢀⢿⣞⣷⢿⡇
⣿⣽⣆⠹⣧⠘⣿⣿⡷⣌⠙⢷⣯⡷⣟⣿⣿⣿⣷⡀⡹⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣷⣈⠃⣸⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠟⢀⣴⡧⢀⠸⣿⡽⣿⢀
⢻⣽⣿⡄⢻⣷⡈⢿⣿⣿⢧⢀⠙⢿⣻⡾⣽⣻⣿⣿⣄⠌⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠛⢁⣰⣾⣟⡿⢀⡄⢿⣟⣿⢀
⡄⢿⣿⣷⢀⠹⣟⣆⠻⣿⣿⣆⢀⣀⠉⠻⣿⡽⣯⣿⣿⣷⣈⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠋⢀⣠⠘⣯⣷⣿⡟⢀⢆⠸⣿⡟⢸
⣷⡈⢿⣿⣇⢱⡘⢿⣷⣬⣙⠿⣧⠘⣆⢀⠈⠻⣷⣟⣾⢿⣿⣆⠹⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠋⣠⡞⢡⣿⢀⣿⣿⣿⠇⡄⢸⡄⢻⡇⣼
⣿⣷⡈⢿⣿⡆⢣⡀⠙⢾⣟⣿⣿⣷⡈⠂⠘⣦⡈⠿⣯⣿⢾⣿⣆⠙⠻⠿⠿⠿⠿⡿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠿⠛⢋⣠⣾⡟⢠⣿⣿⢀⣿⣿⡟⢠⣿⢈⣧⠘⢠⣿
⣿⣿⣿⣄⠻⣿⡄⢳⡄⢆⡙⠾⣽⣿⣿⣆⡀⢹⡷⣄⠙⢿⣿⡾⣿⣆⢀⡀⢀⢀⢀⢀⢀⢀⢀⢀⢀⢀⢀⢀⣀⣠⣴⡿⣯⠏⣠⣿⣿⡏⢸⣿⡿⢁⣿⣿⢀⣿⠆⢸⣿
⣿⣿⣿⣿⣦⡙⣿⣆⢻⡌⢿⣶⢤⣉⣙⣿⣷⡀⠙⠽⠷⠄⠹⣿⣟⣿⣆⢙⣋⣤⣤⣤⣄⣀⢀⢀⢀⢀⣾⣿⣟⡷⣯⡿⢃⣼⣿⣿⣿⠇⣼⡟⣡⣿⣿⣿⢀⡿⢠⠈⣿
⣿⣿⣿⣿⣿⣷⣮⣿⣿⣿⡌⠁⢤⣤⣤⣤⣬⣭⣴⣶⣶⣶⣆⠈⢻⣿⣿⣆⢻⣿⣿⣿⣿⣿⣿⣷⣶⣤⣌⣉⡘⠛⠻⠶⣿⣿⣿⣿⡟⣰⣫⣴⣿⣿⣿⣿⠄⣷⣿⣿⣿
"""
s, k=map(int, input().split())
fib=[0, 1]
for i in range(80):
g=0
for x in range(k):
if len(fib)-x-1<0:break
g+=fib[len(fib)-x-1]
fib.append(g)
ans=[]
for x in fib[::-1]:
if x<=s:
s-=x
ans.append(x)
print(len(ans))
print(*ans)
|
Title: Well-known Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Numbers *k*-bonacci (*k* is integer, *k*<=><=1) are a generalization of Fibonacci numbers and are determined as follows:
- *F*(*k*,<=*n*)<==<=0, for integer *n*, 1<=≤<=*n*<=<<=*k*; - *F*(*k*,<=*k*)<==<=1; - *F*(*k*,<=*n*)<==<=*F*(*k*,<=*n*<=-<=1)<=+<=*F*(*k*,<=*n*<=-<=2)<=+<=...<=+<=*F*(*k*,<=*n*<=-<=*k*), for integer *n*, *n*<=><=*k*.
Note that we determine the *k*-bonacci numbers, *F*(*k*,<=*n*), only for integer values of *n* and *k*.
You've got a number *s*, represent it as a sum of several (at least two) distinct *k*-bonacci numbers.
Input Specification:
The first line contains two integers *s* and *k* (1<=≤<=*s*,<=*k*<=≤<=109; *k*<=><=1).
Output Specification:
In the first line print an integer *m* (*m*<=≥<=2) that shows how many numbers are in the found representation. In the second line print *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m*. Each printed integer should be a *k*-bonacci number. The sum of printed integers must equal *s*.
It is guaranteed that the answer exists. If there are several possible answers, print any of them.
Demo Input:
['5 2\n', '21 5\n']
Demo Output:
['3\n0 2 3\n', '3\n4 1 16\n']
Note:
none
|
```python
"""
⣿⣿⣿⣿⣿⣿⡷⣯⢿⣿⣷⣻⢯⣿⡽⣻⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣇⠸⣿⣿⣆⠹⣿⣿⢾⣟⣯⣿⣿⣿⣿⣿⣿⣽⣻⣿⣿⣿⣿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣻⣽⡿⣿⣎⠙⣿⣞⣷⡌⢻⣟⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣷⣿⣿⣿⣿⣿⣿⡄⠹⣿⣿⡆⠻⣿⣟⣯⡿⣽⡿⣿⣿⣿⣿⣽⡷⣯⣿⣿⣿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣟⣷⣿⣿⣿⡀⠹⣟⣾⣟⣆⠹⣯⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡇⢠⡘⣿⣿⡄⠉⢿⣿⣽⡷⣿⣻⣿⣿⣿⣿⡝⣷⣯⢿⣿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣯⢿⣾⢿⣿⡄⢄⠘⢿⣞⡿⣧⡈⢷⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡇⢸⣧⠘⣿⣷⠈⣦⠙⢿⣽⣷⣻⣽⣿⣿⣿⣿⣌⢿⣯⢿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⣟⣯⣿⢿⣿⡆⢸⡷⡈⢻⡽⣷⡷⡄⠻⣽⣿⣿⡿⣿⣿⣿⣿⣿⣿⣷⣿⣿⣿⣿⣏⢰⣯⢷⠈⣿⡆⢹⢷⡌⠻⡾⢋⣱⣯⣿⣿⣿⣿⡆⢻⡿⣿⣿⣿
⣿⣿⣿⣿⣿⣿⡎⣿⢾⡿⣿⡆⢸⣽⢻⣄⠹⣷⣟⣿⣄⠹⣟⣿⣿⣟⣿⣿⣿⣿⣿⣿⣽⣿⣿⣿⡇⢸⣯⣟⣧⠘⣷⠈⡯⠛⢀⡐⢾⣟⣷⣻⣿⣿⣿⡿⡌⢿⣻⣿⣿
⣿⣿⣿⣿⣿⣿⣧⢸⡿⣟⣿⡇⢸⣯⣟⣮⢧⡈⢿⣞⡿⣦⠘⠏⣹⣿⣽⢿⣿⣿⣿⣿⣯⣿⣿⣿⡇⢸⣿⣿⣾⡆⠹⢀⣠⣾⣟⣷⡈⢿⣞⣯⢿⣿⣿⣿⢷⠘⣯⣿⣿
⣿⣿⣿⣿⣿⣿⣿⡈⣿⢿⣽⡇⠘⠛⠛⠛⠓⠓⠈⠛⠛⠟⠇⢀⢿⣻⣿⣯⢿⣿⣿⣿⣷⢿⣿⣿⠁⣾⣿⣿⣿⣧⡄⠇⣹⣿⣾⣯⣿⡄⠻⣽⣯⢿⣻⣿⣿⡇⢹⣾⣿
⣿⣿⣿⣿⣿⣿⣿⡇⢹⣿⡽⡇⢸⣿⣿⣿⣿⣿⣞⣆⠰⣶⣶⡄⢀⢻⡿⣯⣿⡽⣿⣿⣿⢯⣟⡿⢀⣿⣿⣿⣿⣿⣧⠐⣸⣿⣿⣷⣿⣿⣆⠹⣯⣿⣻⣿⣿⣿⢀⣿⢿
⣿⣿⣿⣿⣿⣿⣿⣿⠘⣯⡿⡇⢸⣿⣿⣿⣿⣿⣿⣿⣧⡈⢿⣳⠘⡄⠻⣿⢾⣽⣟⡿⣿⢯⣿⡇⢸⣿⣿⣿⣿⣿⣿⡀⢾⣿⣿⣿⣿⣿⣿⣆⠹⣾⣷⣻⣿⡿⡇⢸⣿
⣿⣿⣿⣿⣿⣿⣿⣿⡇⢹⣿⠇⢸⣿⣿⣿⣿⣿⣿⣿⣿⣷⣄⠻⡇⢹⣆⠹⣟⣾⣽⣻⣟⣿⣽⠁⣾⣿⣿⣿⣿⣿⣿⣇⣿⣿⠿⠛⠛⠉⠙⠋⢀⠁⢘⣯⣿⣿⣧⠘⣿
⣿⣿⣿⣿⣿⣿⣿⣿⣿⡈⣿⡃⢼⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣦⡙⠌⣿⣆⠘⣿⣞⡿⣞⡿⡞⢠⣿⣿⣿⣿⣿⡿⠛⠉⠁⢀⣀⣠⣤⣤⣶⣶⣶⡆⢻⣽⣞⡿⣷⠈⣿
⣿⣿⣿⣿⣿⣿⣿⣿⡿⠃⠘⠁⠉⠉⠉⠉⠉⠉⠉⠉⠉⠙⠛⠛⢿⣄⢻⣿⣧⠘⢯⣟⡿⣽⠁⣾⣿⣿⣿⣿⣿⡃⢀⢀⠘⠛⠿⢿⣻⣟⣯⣽⣻⣵⡀⢿⣯⣟⣿⢀⣿
⣿⣿⣿⣟⣿⣿⣿⣿⣶⣶⡆⢀⣿⣾⣿⣾⣷⣿⣶⠿⠚⠉⢀⢀⣤⣿⣷⣿⣿⣷⡈⢿⣻⢃⣼⣿⣿⣿⣿⣻⣿⣿⣿⡶⣦⣤⣄⣀⡀⠉⠛⠛⠷⣯⣳⠈⣾⡽⣾⢀⣿
⣿⢿⣿⣿⣻⣿⣿⣿⣿⣿⡿⠐⣿⣿⣿⣿⠿⠋⠁⢀⢀⣤⣾⣿⣿⣿⣿⣿⣿⣿⣿⣌⣥⣾⡿⣿⣿⣷⣿⣿⢿⣷⣿⣿⣟⣾⣽⣳⢯⣟⣶⣦⣤⡾⣟⣦⠘⣿⢾⡁⢺
⣿⣻⣿⣿⡷⣿⣿⣿⣿⣿⡗⣦⠸⡿⠋⠁⢀⢀⣠⣴⢿⣿⣽⣻⢽⣾⣟⣷⣿⣟⣿⣿⣿⣳⠿⣵⣧⣼⣿⣿⣿⣿⣿⣾⣿⣿⣿⣿⣿⣽⣳⣯⣿⣿⣿⣽⢀⢷⣻⠄⠘
⣿⢷⣻⣿⣿⣷⣻⣿⣿⣿⡷⠛⣁⢀⣀⣤⣶⣿⣛⡿⣿⣮⣽⡻⣿⣮⣽⣻⢯⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣯⢀⢸⣿⢀⡆
⠸⣟⣯⣿⣿⣷⢿⣽⣿⣿⣷⣿⣷⣆⠹⣿⣶⣯⠿⣿⣶⣟⣻⢿⣷⣽⣻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⢀⣯⣟⢀⡇
⣇⠹⣟⣾⣻⣿⣿⢾⡽⣿⣿⣿⣿⣿⣆⢹⣶⣿⣻⣷⣯⣟⣿⣿⣽⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⢀⡿⡇⢸⡇
⣿⣆⠹⣷⡻⣽⣿⣯⢿⣽⣻⣿⣿⣿⣿⣆⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠛⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠇⢸⣿⠇⣼⡇
⡙⠾⣆⠹⣿⣦⠛⣿⢯⣷⢿⡽⣿⣿⣿⣿⣆⠻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠃⠎⢸⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠏⢀⣿⣾⣣⡿⡇
⣿⣷⡌⢦⠙⣿⣿⣌⠻⣽⢯⣿⣽⣻⣿⣿⣿⣧⠩⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡏⢰⢣⠘⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠃⢀⢀⢿⣞⣷⢿⡇
⣿⣽⣆⠹⣧⠘⣿⣿⡷⣌⠙⢷⣯⡷⣟⣿⣿⣿⣷⡀⡹⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣷⣈⠃⣸⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠟⢀⣴⡧⢀⠸⣿⡽⣿⢀
⢻⣽⣿⡄⢻⣷⡈⢿⣿⣿⢧⢀⠙⢿⣻⡾⣽⣻⣿⣿⣄⠌⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠛⢁⣰⣾⣟⡿⢀⡄⢿⣟⣿⢀
⡄⢿⣿⣷⢀⠹⣟⣆⠻⣿⣿⣆⢀⣀⠉⠻⣿⡽⣯⣿⣿⣷⣈⢻⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠋⢀⣠⠘⣯⣷⣿⡟⢀⢆⠸⣿⡟⢸
⣷⡈⢿⣿⣇⢱⡘⢿⣷⣬⣙⠿⣧⠘⣆⢀⠈⠻⣷⣟⣾⢿⣿⣆⠹⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠋⣠⡞⢡⣿⢀⣿⣿⣿⠇⡄⢸⡄⢻⡇⣼
⣿⣷⡈⢿⣿⡆⢣⡀⠙⢾⣟⣿⣿⣷⡈⠂⠘⣦⡈⠿⣯⣿⢾⣿⣆⠙⠻⠿⠿⠿⠿⡿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠿⠛⢋⣠⣾⡟⢠⣿⣿⢀⣿⣿⡟⢠⣿⢈⣧⠘⢠⣿
⣿⣿⣿⣄⠻⣿⡄⢳⡄⢆⡙⠾⣽⣿⣿⣆⡀⢹⡷⣄⠙⢿⣿⡾⣿⣆⢀⡀⢀⢀⢀⢀⢀⢀⢀⢀⢀⢀⢀⢀⣀⣠⣴⡿⣯⠏⣠⣿⣿⡏⢸⣿⡿⢁⣿⣿⢀⣿⠆⢸⣿
⣿⣿⣿⣿⣦⡙⣿⣆⢻⡌⢿⣶⢤⣉⣙⣿⣷⡀⠙⠽⠷⠄⠹⣿⣟⣿⣆⢙⣋⣤⣤⣤⣄⣀⢀⢀⢀⢀⣾⣿⣟⡷⣯⡿⢃⣼⣿⣿⣿⠇⣼⡟⣡⣿⣿⣿⢀⡿⢠⠈⣿
⣿⣿⣿⣿⣿⣷⣮⣿⣿⣿⡌⠁⢤⣤⣤⣤⣬⣭⣴⣶⣶⣶⣆⠈⢻⣿⣿⣆⢻⣿⣿⣿⣿⣿⣿⣷⣶⣤⣌⣉⡘⠛⠻⠶⣿⣿⣿⣿⡟⣰⣫⣴⣿⣿⣿⣿⠄⣷⣿⣿⣿
"""
s, k=map(int, input().split())
fib=[0, 1]
for i in range(80):
g=0
for x in range(k):
if len(fib)-x-1<0:break
g+=fib[len(fib)-x-1]
fib.append(g)
ans=[]
for x in fib[::-1]:
if x<=s:
s-=x
ans.append(x)
print(len(ans))
print(*ans)
```
| -1
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,545,062,000
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 218
| 0
|
"""
IIIIIIIIII OOOOOOOOOOO IIIIIIIIII
II OO OO II
II OO OO II
II OO OO II
II OO OO II
II OO OO II
II OO OO II
IIIIIIIIII OOOOOOOOOOO IIIIIIIIII
"""
a, b = map(int, input().split())
c = 6 - max(a, b) + 1
if c == 6:
print("%d/%d" %(1, 1))
elif c % 2 == 0 and 6 % 2 == 0:
print("%d/%d" %(c/2, 6/2))
elif c % 3 == 0 and 6 % 3 == 0:
print("%d/%d" %(c/3, 6/3))
else:
print("%d/%d" %(c, 6))
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
"""
IIIIIIIIII OOOOOOOOOOO IIIIIIIIII
II OO OO II
II OO OO II
II OO OO II
II OO OO II
II OO OO II
II OO OO II
IIIIIIIIII OOOOOOOOOOO IIIIIIIIII
"""
a, b = map(int, input().split())
c = 6 - max(a, b) + 1
if c == 6:
print("%d/%d" %(1, 1))
elif c % 2 == 0 and 6 % 2 == 0:
print("%d/%d" %(c/2, 6/2))
elif c % 3 == 0 and 6 % 3 == 0:
print("%d/%d" %(c/3, 6/3))
else:
print("%d/%d" %(c, 6))
```
| 3.891
|
877
|
A
|
Alex and broken contest
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
|
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
|
Print "YES", if problem is from this contest, and "NO" otherwise.
|
[
"Alex_and_broken_contest\n",
"NikitaAndString\n",
"Danil_and_Olya\n"
] |
[
"NO",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "Alex_and_broken_contest",
"output": "NO"
},
{
"input": "NikitaAndString",
"output": "YES"
},
{
"input": "Danil_and_Olya",
"output": "NO"
},
{
"input": "Slava____and_the_game",
"output": "YES"
},
{
"input": "Olya_and_energy_drinks",
"output": "YES"
},
{
"input": "Danil_and_part_time_job",
"output": "YES"
},
{
"input": "Ann_and_books",
"output": "YES"
},
{
"input": "Olya",
"output": "YES"
},
{
"input": "Nikita",
"output": "YES"
},
{
"input": "Slava",
"output": "YES"
},
{
"input": "Vanya",
"output": "NO"
},
{
"input": "I_dont_know_what_to_write_here",
"output": "NO"
},
{
"input": "danil_and_work",
"output": "NO"
},
{
"input": "Ann",
"output": "YES"
},
{
"input": "Batman_Nananananananan_Batman",
"output": "NO"
},
{
"input": "Olya_Nikita_Ann_Slava_Danil",
"output": "NO"
},
{
"input": "its_me_Mario",
"output": "NO"
},
{
"input": "A",
"output": "NO"
},
{
"input": "Wake_up_Neo",
"output": "NO"
},
{
"input": "Hardest_problem_ever",
"output": "NO"
},
{
"input": "Nikita_Nikita",
"output": "NO"
},
{
"input": "____________________________________________________________________________________________________",
"output": "NO"
},
{
"input": "Nikitb",
"output": "NO"
},
{
"input": "Unn",
"output": "NO"
},
{
"input": "oLya_adn_smth",
"output": "NO"
},
{
"input": "FloorISLava",
"output": "NO"
},
{
"input": "ann",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "AAnnnnn",
"output": "YES"
},
{
"input": "AnnAnn",
"output": "NO"
},
{
"input": "Annn",
"output": "YES"
},
{
"input": "Dilzhan",
"output": "NO"
},
{
"input": "Danilaaa",
"output": "YES"
},
{
"input": "AndAnn",
"output": "YES"
},
{
"input": "OlyaAnnAnn",
"output": "NO"
},
{
"input": "DanilDanilOlya",
"output": "NO"
},
{
"input": "DDanil",
"output": "YES"
},
{
"input": "AnnAnnDanil",
"output": "NO"
},
{
"input": "And_Danil",
"output": "YES"
},
{
"input": "abcddddDanil",
"output": "YES"
},
{
"input": "DanilOlyaOlya",
"output": "NO"
},
{
"input": "Nikitaaa",
"output": "YES"
},
{
"input": "aaabbba",
"output": "NO"
},
{
"input": "Ann_Ann_Danil",
"output": "NO"
},
{
"input": "Danil_Danil_Nikita",
"output": "NO"
},
{
"input": "AlexaaaaaaBBBBBOlyaDDDDD",
"output": "YES"
},
{
"input": "IloveDaniland",
"output": "YES"
},
{
"input": "AnAnn",
"output": "YES"
},
{
"input": "Danil_Danil_Olya",
"output": "NO"
},
{
"input": "DanilDanilSlava",
"output": "NO"
},
{
"input": "DanilDanil",
"output": "NO"
},
{
"input": "OlyOlya",
"output": "YES"
},
{
"input": "NikitaNikitb",
"output": "YES"
},
{
"input": "ababaca",
"output": "NO"
},
{
"input": "AnnNikitaNikitaNikitaNikita__good_luck",
"output": "NO"
}
] | 1,671,497,777
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 55
| 62
| 0
|
s = input()
x = 0
for e in ["Danil", "Olya", "Slava", "Ann" ,"Nikita"]:
x+=s.count(e)
if x == 1:
print("YES")
else:
print("NO")
|
Title: Alex and broken contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
Input Specification:
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
Output Specification:
Print "YES", if problem is from this contest, and "NO" otherwise.
Demo Input:
['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n']
Demo Output:
['NO', 'YES', 'NO']
Note:
none
|
```python
s = input()
x = 0
for e in ["Danil", "Olya", "Slava", "Ann" ,"Nikita"]:
x+=s.count(e)
if x == 1:
print("YES")
else:
print("NO")
```
| 3
|
|
33
|
A
|
What is for dinner?
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] |
A. What is for dinner?
|
2
|
256
|
In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one.
|
The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth.
|
In the first line output the maximum amount of crucians that Valerie can consume for dinner.
|
[
"4 3 18\n2 3\n1 2\n3 6\n2 3\n",
"2 2 13\n1 13\n2 12\n"
] |
[
"11\n",
"13\n"
] |
none
| 500
|
[
{
"input": "4 3 18\n2 3\n1 2\n3 6\n2 3",
"output": "11"
},
{
"input": "2 2 13\n1 13\n2 12",
"output": "13"
},
{
"input": "5 4 8\n4 6\n4 5\n1 3\n2 0\n3 3",
"output": "8"
},
{
"input": "1 1 0\n1 3",
"output": "0"
},
{
"input": "7 1 30\n1 8\n1 15\n1 5\n1 17\n1 9\n1 16\n1 16",
"output": "5"
},
{
"input": "4 2 8\n1 9\n1 10\n1 4\n2 6",
"output": "8"
},
{
"input": "10 4 14\n2 6\n1 5\n2 8\n2 6\n2 5\n4 1\n4 0\n2 4\n3 4\n1 0",
"output": "8"
},
{
"input": "54 22 1009\n15 7\n17 7\n11 9\n5 11\n12 9\n13 8\n13 12\n22 11\n20 9\n20 7\n16 11\n19 12\n3 12\n15 9\n1 12\n2 10\n16 10\n16 10\n14 10\n9 11\n9 9\n14 8\n10 10\n16 12\n1 8\n3 8\n21 11\n18 12\n2 6\n9 11\n11 7\n15 9\n20 11\n6 8\n8 8\n19 11\n15 7\n9 9\n22 7\n12 9\n17 9\n17 11\n12 7\n15 9\n5 11\n11 6\n18 8\n7 10\n4 10\n13 12\n4 8\n20 6\n15 12\n9 7",
"output": "180"
},
{
"input": "1 1 1000000\n1 1000000",
"output": "1000000"
},
{
"input": "4 3 181818\n3 1299\n1 1694\n3 1164\n2 1278",
"output": "4136"
},
{
"input": "50 50 0\n33 0\n26 0\n30 0\n41 0\n38 0\n36 0\n16 0\n7 0\n23 0\n5 0\n39 0\n29 0\n40 0\n47 0\n24 0\n43 0\n14 0\n10 0\n20 0\n3 0\n6 0\n34 0\n13 0\n18 0\n21 0\n9 0\n8 0\n22 0\n25 0\n4 0\n11 0\n17 0\n32 0\n44 0\n49 0\n50 0\n27 0\n28 0\n45 0\n12 0\n35 0\n15 0\n42 0\n31 0\n2 0\n1 0\n48 0\n19 0\n37 0\n46 0",
"output": "0"
},
{
"input": "19 12 199\n7 1\n8 6\n6 14\n1 7\n4 1\n6 6\n3 4\n1 5\n9 2\n5 3\n11 3\n9 4\n1 12\n4 7\n7 3\n12 14\n2 1\n10 8\n6 12",
"output": "54"
}
] | 1,553,377,049
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 186
| 0
|
inp=input().split(" ")
n=int(inp[0])
m=inp[1]
k=int(inp[2])
blich=[]
res=0
bitch=[]
for i in range(n):
blich.append(input().split(" "))
for i in range(len(blich)):
r=blich[i]
for j in range(len(blich)):
if blich[i]==blich[j]:
continue
elif blich[i][1]>blich[j][1] and blich[i][0]==blich[j][0]:
r=blich[j]
if r not in bitch:
bitch.append(r)
for x in bitch:
res += int(x[1])
print(k) if res>k else print(res)
|
Title: What is for dinner?
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth.
Output Specification:
In the first line output the maximum amount of crucians that Valerie can consume for dinner.
Demo Input:
['4 3 18\n2 3\n1 2\n3 6\n2 3\n', '2 2 13\n1 13\n2 12\n']
Demo Output:
['11\n', '13\n']
Note:
none
|
```python
inp=input().split(" ")
n=int(inp[0])
m=inp[1]
k=int(inp[2])
blich=[]
res=0
bitch=[]
for i in range(n):
blich.append(input().split(" "))
for i in range(len(blich)):
r=blich[i]
for j in range(len(blich)):
if blich[i]==blich[j]:
continue
elif blich[i][1]>blich[j][1] and blich[i][0]==blich[j][0]:
r=blich[j]
if r not in bitch:
bitch.append(r)
for x in bitch:
res += int(x[1])
print(k) if res>k else print(res)
```
| 0
|
350
|
A
|
TL
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it.
Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds).
Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds.
As a result, Valera decided to set *v* seconds TL, that the following conditions are met:
1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold.
Help Valera and find the most suitable TL or else state that such TL doesn't exist.
|
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds.
|
If there is a valid TL value, print it. Otherwise, print -1.
|
[
"3 6\n4 5 2\n8 9 6 10 7 11\n",
"3 1\n3 4 5\n6\n"
] |
[
"5",
"-1\n"
] |
none
| 500
|
[
{
"input": "3 6\n4 5 2\n8 9 6 10 7 11",
"output": "5"
},
{
"input": "3 1\n3 4 5\n6",
"output": "-1"
},
{
"input": "2 5\n45 99\n49 41 77 83 45",
"output": "-1"
},
{
"input": "50 50\n18 13 5 34 10 36 36 12 15 11 16 17 14 36 23 45 32 24 31 18 24 32 7 1 31 3 49 8 16 23 3 39 47 43 42 38 40 22 41 1 49 47 9 8 19 15 29 30 16 18\n91 58 86 51 94 94 73 84 98 69 74 56 52 80 88 61 53 99 88 50 55 95 65 84 87 79 51 52 69 60 74 73 93 61 73 59 64 56 95 78 86 72 79 70 93 78 54 61 71 50",
"output": "49"
},
{
"input": "55 44\n93 17 74 15 34 16 41 80 26 54 94 94 86 93 20 44 63 72 39 43 67 4 37 49 76 94 5 51 64 74 11 47 77 97 57 30 42 72 71 26 8 14 67 64 49 57 30 23 40 4 76 78 87 78 79\n38 55 17 65 26 7 36 65 48 28 49 93 18 98 31 90 26 57 1 26 88 56 48 56 23 13 8 67 80 2 51 3 21 33 20 54 2 45 21 36 3 98 62 2",
"output": "-1"
},
{
"input": "32 100\n30 8 4 35 18 41 18 12 33 39 39 18 39 19 33 46 45 33 34 27 14 39 40 21 38 9 42 35 27 10 14 14\n65 49 89 64 47 78 59 52 73 51 84 82 88 63 91 99 67 87 53 99 75 47 85 82 58 47 80 50 65 91 83 90 77 52 100 88 97 74 98 99 50 93 65 61 65 65 65 96 61 51 84 67 79 90 92 83 100 100 100 95 80 54 77 51 98 64 74 62 60 96 73 74 94 55 89 60 92 65 74 79 66 81 53 47 71 51 54 85 74 97 68 72 88 94 100 85 65 63 65 90",
"output": "46"
},
{
"input": "1 50\n7\n65 52 99 78 71 19 96 72 80 15 50 94 20 35 79 95 44 41 45 53 77 50 74 66 59 96 26 84 27 48 56 84 36 78 89 81 67 34 79 74 99 47 93 92 90 96 72 28 78 66",
"output": "14"
},
{
"input": "1 1\n4\n9",
"output": "8"
},
{
"input": "1 1\n2\n4",
"output": "-1"
},
{
"input": "22 56\n49 20 42 68 15 46 98 78 82 8 7 33 50 30 75 96 36 88 35 99 19 87\n15 18 81 24 35 89 25 32 23 3 48 24 52 69 18 32 23 61 48 98 50 38 5 17 70 20 38 32 49 54 68 11 51 81 46 22 19 59 29 38 45 83 18 13 91 17 84 62 25 60 97 32 23 13 83 58",
"output": "-1"
},
{
"input": "1 1\n50\n100",
"output": "-1"
},
{
"input": "1 1\n49\n100",
"output": "98"
},
{
"input": "1 1\n100\n100",
"output": "-1"
},
{
"input": "1 1\n99\n100",
"output": "-1"
},
{
"input": "8 4\n1 2 49 99 99 95 78 98\n100 100 100 100",
"output": "99"
},
{
"input": "68 85\n43 55 2 4 72 45 19 56 53 81 18 90 11 87 47 8 94 88 24 4 67 9 21 70 25 66 65 27 46 13 8 51 65 99 37 43 71 59 71 79 32 56 49 43 57 85 95 81 40 28 60 36 72 81 60 40 16 78 61 37 29 26 15 95 70 27 50 97\n6 6 48 72 54 31 1 50 29 64 93 9 29 93 66 63 25 90 52 1 66 13 70 30 24 87 32 90 84 72 44 13 25 45 31 16 92 60 87 40 62 7 20 63 86 78 73 88 5 36 74 100 64 34 9 5 62 29 58 48 81 46 84 56 27 1 60 14 54 88 31 93 62 7 9 69 27 48 10 5 33 10 53 66 2",
"output": "-1"
},
{
"input": "5 100\n1 1 1 1 1\n77 53 38 29 97 33 64 17 78 100 27 12 42 44 20 24 44 68 58 57 65 90 8 24 4 6 74 68 61 43 25 69 8 62 36 85 67 48 69 30 35 41 42 12 87 66 50 92 53 76 38 67 85 7 80 78 53 76 94 8 37 50 4 100 4 71 10 48 34 47 83 42 25 81 64 72 25 51 53 75 43 98 53 77 94 38 81 15 89 91 72 76 7 36 27 41 88 18 19 75",
"output": "2"
},
{
"input": "3 3\n2 3 4\n8 9 10",
"output": "4"
},
{
"input": "2 1\n2 3\n15",
"output": "4"
},
{
"input": "2 1\n2 4\n4",
"output": "-1"
},
{
"input": "2 3\n4 5\n10 11 12",
"output": "8"
},
{
"input": "3 1\n2 3 3\n5",
"output": "4"
},
{
"input": "2 1\n9 10\n100",
"output": "18"
},
{
"input": "3 3\n3 12 15\n7 8 9",
"output": "-1"
},
{
"input": "2 2\n3 5\n7 8",
"output": "6"
},
{
"input": "3 3\n4 5 6\n10 11 12",
"output": "8"
},
{
"input": "3 5\n2 3 3\n6 6 6 6 2",
"output": "-1"
},
{
"input": "3 6\n4 5 3\n8 9 7 10 7 11",
"output": "6"
},
{
"input": "3 6\n4 5 2\n8 9 6 10 7 4",
"output": "-1"
},
{
"input": "2 1\n4 6\n10",
"output": "8"
},
{
"input": "1 2\n1\n3 1",
"output": "-1"
},
{
"input": "2 1\n5 6\n20",
"output": "10"
},
{
"input": "2 1\n1 5\n5",
"output": "-1"
},
{
"input": "3 2\n10 20 30\n30 40",
"output": "-1"
},
{
"input": "2 2\n5 6\n7 100",
"output": "-1"
},
{
"input": "2 1\n2 5\n7",
"output": "5"
},
{
"input": "1 1\n5\n20",
"output": "10"
},
{
"input": "2 1\n10 11\n100",
"output": "20"
},
{
"input": "1 1\n1\n10",
"output": "2"
},
{
"input": "1 1\n10\n100",
"output": "20"
}
] | 1,691,039,984
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 13
| 154
| 0
|
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
ans = -1
if min(a)*2 <= min(b)-1 >= max(a):
ans = min(b)-1
print(ans)
|
Title: TL
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it.
Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds).
Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds.
As a result, Valera decided to set *v* seconds TL, that the following conditions are met:
1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold.
Help Valera and find the most suitable TL or else state that such TL doesn't exist.
Input Specification:
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds.
Output Specification:
If there is a valid TL value, print it. Otherwise, print -1.
Demo Input:
['3 6\n4 5 2\n8 9 6 10 7 11\n', '3 1\n3 4 5\n6\n']
Demo Output:
['5', '-1\n']
Note:
none
|
```python
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
ans = -1
if min(a)*2 <= min(b)-1 >= max(a):
ans = min(b)-1
print(ans)
```
| 0
|
|
26
|
A
|
Almost Prime
|
PROGRAMMING
| 900
|
[
"number theory"
] |
A. Almost Prime
|
2
|
256
|
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
|
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
|
Output the amount of almost prime numbers between 1 and *n*, inclusive.
|
[
"10\n",
"21\n"
] |
[
"2\n",
"8\n"
] |
none
| 500
|
[
{
"input": "10",
"output": "2"
},
{
"input": "21",
"output": "8"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "19",
"output": "6"
},
{
"input": "40",
"output": "19"
},
{
"input": "77",
"output": "41"
},
{
"input": "222",
"output": "125"
},
{
"input": "987",
"output": "501"
},
{
"input": "1000",
"output": "508"
},
{
"input": "2000",
"output": "958"
},
{
"input": "3000",
"output": "1375"
},
{
"input": "2999",
"output": "1375"
},
{
"input": "2998",
"output": "1375"
},
{
"input": "2997",
"output": "1374"
},
{
"input": "1429",
"output": "706"
},
{
"input": "1673",
"output": "808"
},
{
"input": "1500",
"output": "732"
},
{
"input": "500",
"output": "266"
},
{
"input": "856",
"output": "439"
}
] | 1,631,300,843
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 7,372,800
|
almost = [4, 6, 9, 10, 14, 15, 21, 22, 25, 26, 33, 34, 35, 38, 39, 46, 49, 51, 55, 57, 58, 62, 65, 69, 74, 77, 82, 85, 86, 87, 91, 93, 94, 95, 106, 111, 115, 118, 119, 121, 122, 123, 129, 133, 134, 141, 142, 143, 145, 146, 155, 158, 159, 161, 166, 169, 177, 178, 183, 185, 187, 194, 201, 202, 203, 205, 206, 209, 213, 214, 215, 217, 218, 219, 221, 226, 235, 237, 247, 249, 253, 254, 259, 262, 265, 267, 274, 278, 287, 289, 291, 295, 298, 299, 301, 302, 303, 305, 309, 314, 319, 321, 323, 326, 327, 329, 334, 335, 339, 341, 346, 355, 358, 361, 362, 365, 371, 377, 381, 382, 386, 391, 393, 394, 395, 398, 403, 407, 411, 413, 415, 417, 422, 427, 437, 445, 446, 447, 451, 453, 454, 458, 466, 469, 471, 473, 478, 481, 482, 485, 489, 493, 497, 501, 502, 505, 511, 514, 515, 517, 519, 526, 527, 529, 533, 535, 537, 538, 542, 543, 545, 551, 553, 554, 559, 562, 565, 566, 573, 579, 581, 583, 586, 589, 591, 597, 611, 614, 622, 623, 626, 629, 633, 634, 635, 649, 655, 662, 667, 669, 671, 674, 679, 681, 685, 687, 689, 694, 695, 697, 698, 699, 703, 706, 707, 713, 717, 718, 721, 723, 731, 734, 737, 745, 746, 749, 753, 755, 758, 763, 766, 767, 771, 778, 779, 781, 785, 789, 791, 793, 794, 799, 802, 803, 807, 813, 815, 817, 818, 831, 835, 838, 841, 842, 843, 849, 851, 862, 865, 866, 869, 871, 878, 879, 886, 889, 893, 895, 898, 899, 901, 905, 913, 914, 917, 921, 922, 923, 926, 933, 934, 939, 943, 949, 951, 955, 958, 959, 961, 965, 973, 974, 979, 982, 985, 989, 993, 995, 998, 1003, 1006, 1007, 1011, 1018, 1027, 1037, 1041, 1042, 1043, 1046, 1047, 1055, 1057, 1059, 1067, 1073, 1077, 1079, 1081, 1082, 1094, 1099, 1101, 1111, 1114, 1115, 1119, 1121, 1126, 1133, 1135, 1137, 1138, 1139, 1141, 1142, 1145, 1147, 1149, 1154, 1157, 1159, 1165, 1167, 1169, 1174, 1177, 1186, 1189, 1191, 1195, 1198, 1199, 1202, 1203, 1205, 1207, 1211, 1214, 1219, 1226, 1227, 1234, 1238, 1241, 1243, 1247, 1253, 1255, 1257, 1261, 1262, 1263, 1267, 1271, 1273, 1282, 1285, 1286, 1293, 1294, 1299, 1306, 1313, 1315, 1317, 1318, 1322, 1329, 1333, 1337, 1339, 1343, 1345, 1346, 1347, 1349, 1351, 1354, 1355, 1357, 1363, 1366, 1369, 1371, 1379, 1382, 1383, 1385, 1387, 1389, 1391, 1393, 1397, 1401, 1402, 1403, 1405, 1411, 1415, 1417, 1418, 1437, 1438, 1441, 1454, 1457, 1461, 1465, 1466, 1469, 1473, 1477, 1478, 1486, 1497, 1501, 1502, 1507, 1509, 1513, 1514, 1517, 1522, 1527, 1529, 1535, 1537, 1538, 1541, 1546, 1555, 1561, 1563, 1565, 1569, 1574, 1577, 1585, 1589, 1591, 1594, 1603, 1618, 1622, 1623, 1631, 1633, 1639, 1641, 1642, 1643, 1646, 1649, 1651, 1654, 1655, 1658, 1661, 1671, 1673, 1678, 1679, 1681, 1685, 1687, 1689, 1691, 1703, 1706, 1707, 1711, 1713, 1714, 1717, 1718, 1726, 1727, 1731, 1735, 1739, 1745, 1751, 1754, 1757, 1761, 1762, 1763, 1765, 1766, 1769, 1774, 1779, 1781, 1793, 1795, 1797, 1799, 1803, 1807, 1814, 1817, 1819, 1821, 1822, 1829, 1835, 1837, 1838, 1839, 1841, 1843, 1849, 1851, 1853, 1857, 1858, 1865, 1874, 1882, 1883, 1891, 1893, 1894, 1895, 1897, 1903, 1906, 1909, 1915, 1919, 1921, 1923, 1927, 1929, 1934, 1937, 1939, 1941, 1942, 1943, 1945, 1954, 1957, 1959, 1961, 1963, 1966, 1967, 1969, 1977, 1981, 1982, 1983, 1985, 1991, 1994, 2005, 2018, 2019, 2021, 2026, 2031, 2033, 2038, 2041, 2042, 2045, 2047, 2049, 2051, 2059, 2062, 2066, 2071, 2073, 2077, 2078, 2095, 2098, 2101, 2102, 2103, 2105, 2117, 2119, 2122, 2123, 2126, 2127, 2138, 2147, 2149, 2155, 2157, 2159, 2165, 2167, 2171, 2173, 2174, 2177, 2181, 2182, 2183, 2186, 2189, 2191, 2194, 2195, 2199, 2201, 2206, 2209, 2215, 2217, 2218, 2219, 2227, 2229, 2231, 2234, 2245, 2246, 2249, 2253, 2257, 2258, 2263, 2271, 2279, 2283, 2285, 2291, 2302, 2305, 2306, 2307, 2315, 2317, 2319, 2321, 2323, 2326, 2327, 2329, 2335, 2342, 2353, 2359, 2361, 2362, 2363, 2369, 2374, 2386, 2391, 2395, 2402, 2407, 2413, 2419, 2426, 2427, 2429, 2433, 2434, 2435, 2443, 2446, 2449, 2453, 2455, 2458, 2461, 2462, 2463, 2469, 2471, 2474, 2479, 2481, 2483, 2487, 2489, 2491, 2495, 2497, 2498, 2501, 2507, 2509, 2513, 2515, 2517, 2518, 2519, 2533, 2537, 2545, 2554, 2558, 2559, 2561, 2563, 2566, 2567, 2569, 2571, 2573, 2577, 2578, 2581, 2582, 2587, 2589, 2594, 2599, 2602, 2603, 2605, 2606, 2611, 2614, 2615, 2623, 2627, 2629, 2631, 2638, 2641, 2642, 2643, 2649, 2651, 2653, 2654, 2661, 2669, 2681, 2701, 2705, 2721, 2722, 2723, 2733, 2734, 2735, 2743, 2746, 2747, 2757, 2759, 2761, 2762, 2771, 2773, 2779, 2785, 2787, 2798, 2807, 2809, 2811, 2813, 2815, 2818, 2823, 2827, 2831, 2839, 2841, 2845, 2846, 2854, 2855, 2858, 2859, 2863, 2866, 2867, 2869, 2878, 2881, 2885, 2893, 2894, 2899, 2901, 2902, 2906, 2911, 2913, 2918, 2921, 2923, 2929, 2931, 2933, 2935, 2941, 2942, 2947, 2949, 2951, 2959, 2962, 2965, 2966, 2973, 2974, 2977, 2978, 2981, 2983, 2986, 2987, 2991, 2993, 2995, 2998]
answer = []
ite = 0
for i in range(0, 2999):
if (i > almost[ite]):
ite = ite + 1;
answer.append(ite)
n = int(input())
print(answer[n - 1])
|
Title: Almost Prime
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input Specification:
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output Specification:
Output the amount of almost prime numbers between 1 and *n*, inclusive.
Demo Input:
['10\n', '21\n']
Demo Output:
['2\n', '8\n']
Note:
none
|
```python
almost = [4, 6, 9, 10, 14, 15, 21, 22, 25, 26, 33, 34, 35, 38, 39, 46, 49, 51, 55, 57, 58, 62, 65, 69, 74, 77, 82, 85, 86, 87, 91, 93, 94, 95, 106, 111, 115, 118, 119, 121, 122, 123, 129, 133, 134, 141, 142, 143, 145, 146, 155, 158, 159, 161, 166, 169, 177, 178, 183, 185, 187, 194, 201, 202, 203, 205, 206, 209, 213, 214, 215, 217, 218, 219, 221, 226, 235, 237, 247, 249, 253, 254, 259, 262, 265, 267, 274, 278, 287, 289, 291, 295, 298, 299, 301, 302, 303, 305, 309, 314, 319, 321, 323, 326, 327, 329, 334, 335, 339, 341, 346, 355, 358, 361, 362, 365, 371, 377, 381, 382, 386, 391, 393, 394, 395, 398, 403, 407, 411, 413, 415, 417, 422, 427, 437, 445, 446, 447, 451, 453, 454, 458, 466, 469, 471, 473, 478, 481, 482, 485, 489, 493, 497, 501, 502, 505, 511, 514, 515, 517, 519, 526, 527, 529, 533, 535, 537, 538, 542, 543, 545, 551, 553, 554, 559, 562, 565, 566, 573, 579, 581, 583, 586, 589, 591, 597, 611, 614, 622, 623, 626, 629, 633, 634, 635, 649, 655, 662, 667, 669, 671, 674, 679, 681, 685, 687, 689, 694, 695, 697, 698, 699, 703, 706, 707, 713, 717, 718, 721, 723, 731, 734, 737, 745, 746, 749, 753, 755, 758, 763, 766, 767, 771, 778, 779, 781, 785, 789, 791, 793, 794, 799, 802, 803, 807, 813, 815, 817, 818, 831, 835, 838, 841, 842, 843, 849, 851, 862, 865, 866, 869, 871, 878, 879, 886, 889, 893, 895, 898, 899, 901, 905, 913, 914, 917, 921, 922, 923, 926, 933, 934, 939, 943, 949, 951, 955, 958, 959, 961, 965, 973, 974, 979, 982, 985, 989, 993, 995, 998, 1003, 1006, 1007, 1011, 1018, 1027, 1037, 1041, 1042, 1043, 1046, 1047, 1055, 1057, 1059, 1067, 1073, 1077, 1079, 1081, 1082, 1094, 1099, 1101, 1111, 1114, 1115, 1119, 1121, 1126, 1133, 1135, 1137, 1138, 1139, 1141, 1142, 1145, 1147, 1149, 1154, 1157, 1159, 1165, 1167, 1169, 1174, 1177, 1186, 1189, 1191, 1195, 1198, 1199, 1202, 1203, 1205, 1207, 1211, 1214, 1219, 1226, 1227, 1234, 1238, 1241, 1243, 1247, 1253, 1255, 1257, 1261, 1262, 1263, 1267, 1271, 1273, 1282, 1285, 1286, 1293, 1294, 1299, 1306, 1313, 1315, 1317, 1318, 1322, 1329, 1333, 1337, 1339, 1343, 1345, 1346, 1347, 1349, 1351, 1354, 1355, 1357, 1363, 1366, 1369, 1371, 1379, 1382, 1383, 1385, 1387, 1389, 1391, 1393, 1397, 1401, 1402, 1403, 1405, 1411, 1415, 1417, 1418, 1437, 1438, 1441, 1454, 1457, 1461, 1465, 1466, 1469, 1473, 1477, 1478, 1486, 1497, 1501, 1502, 1507, 1509, 1513, 1514, 1517, 1522, 1527, 1529, 1535, 1537, 1538, 1541, 1546, 1555, 1561, 1563, 1565, 1569, 1574, 1577, 1585, 1589, 1591, 1594, 1603, 1618, 1622, 1623, 1631, 1633, 1639, 1641, 1642, 1643, 1646, 1649, 1651, 1654, 1655, 1658, 1661, 1671, 1673, 1678, 1679, 1681, 1685, 1687, 1689, 1691, 1703, 1706, 1707, 1711, 1713, 1714, 1717, 1718, 1726, 1727, 1731, 1735, 1739, 1745, 1751, 1754, 1757, 1761, 1762, 1763, 1765, 1766, 1769, 1774, 1779, 1781, 1793, 1795, 1797, 1799, 1803, 1807, 1814, 1817, 1819, 1821, 1822, 1829, 1835, 1837, 1838, 1839, 1841, 1843, 1849, 1851, 1853, 1857, 1858, 1865, 1874, 1882, 1883, 1891, 1893, 1894, 1895, 1897, 1903, 1906, 1909, 1915, 1919, 1921, 1923, 1927, 1929, 1934, 1937, 1939, 1941, 1942, 1943, 1945, 1954, 1957, 1959, 1961, 1963, 1966, 1967, 1969, 1977, 1981, 1982, 1983, 1985, 1991, 1994, 2005, 2018, 2019, 2021, 2026, 2031, 2033, 2038, 2041, 2042, 2045, 2047, 2049, 2051, 2059, 2062, 2066, 2071, 2073, 2077, 2078, 2095, 2098, 2101, 2102, 2103, 2105, 2117, 2119, 2122, 2123, 2126, 2127, 2138, 2147, 2149, 2155, 2157, 2159, 2165, 2167, 2171, 2173, 2174, 2177, 2181, 2182, 2183, 2186, 2189, 2191, 2194, 2195, 2199, 2201, 2206, 2209, 2215, 2217, 2218, 2219, 2227, 2229, 2231, 2234, 2245, 2246, 2249, 2253, 2257, 2258, 2263, 2271, 2279, 2283, 2285, 2291, 2302, 2305, 2306, 2307, 2315, 2317, 2319, 2321, 2323, 2326, 2327, 2329, 2335, 2342, 2353, 2359, 2361, 2362, 2363, 2369, 2374, 2386, 2391, 2395, 2402, 2407, 2413, 2419, 2426, 2427, 2429, 2433, 2434, 2435, 2443, 2446, 2449, 2453, 2455, 2458, 2461, 2462, 2463, 2469, 2471, 2474, 2479, 2481, 2483, 2487, 2489, 2491, 2495, 2497, 2498, 2501, 2507, 2509, 2513, 2515, 2517, 2518, 2519, 2533, 2537, 2545, 2554, 2558, 2559, 2561, 2563, 2566, 2567, 2569, 2571, 2573, 2577, 2578, 2581, 2582, 2587, 2589, 2594, 2599, 2602, 2603, 2605, 2606, 2611, 2614, 2615, 2623, 2627, 2629, 2631, 2638, 2641, 2642, 2643, 2649, 2651, 2653, 2654, 2661, 2669, 2681, 2701, 2705, 2721, 2722, 2723, 2733, 2734, 2735, 2743, 2746, 2747, 2757, 2759, 2761, 2762, 2771, 2773, 2779, 2785, 2787, 2798, 2807, 2809, 2811, 2813, 2815, 2818, 2823, 2827, 2831, 2839, 2841, 2845, 2846, 2854, 2855, 2858, 2859, 2863, 2866, 2867, 2869, 2878, 2881, 2885, 2893, 2894, 2899, 2901, 2902, 2906, 2911, 2913, 2918, 2921, 2923, 2929, 2931, 2933, 2935, 2941, 2942, 2947, 2949, 2951, 2959, 2962, 2965, 2966, 2973, 2974, 2977, 2978, 2981, 2983, 2986, 2987, 2991, 2993, 2995, 2998]
answer = []
ite = 0
for i in range(0, 2999):
if (i > almost[ite]):
ite = ite + 1;
answer.append(ite)
n = int(input())
print(answer[n - 1])
```
| 0
|
1,003
|
D
|
Coins and Queries
|
PROGRAMMING
| 1,600
|
[
"greedy"
] | null | null |
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. It is guaranteed that all the values are integer powers of $2$ (i.e. $a_i = 2^d$ for some non-negative integer number $d$).
Polycarp wants to know answers on $q$ queries. The $j$-th query is described as integer number $b_j$. The answer to the query is the minimum number of coins that is necessary to obtain the value $b_j$ using some subset of coins (Polycarp can use only coins he has). If Polycarp can't obtain the value $b_j$, the answer to the $j$-th query is -1.
The queries are independent (the answer on the query doesn't affect Polycarp's coins).
|
The first line of the input contains two integers $n$ and $q$ ($1 \le n, q \le 2 \cdot 10^5$) — the number of coins and the number of queries.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ — values of coins ($1 \le a_i \le 2 \cdot 10^9$). It is guaranteed that all $a_i$ are integer powers of $2$ (i.e. $a_i = 2^d$ for some non-negative integer number $d$).
The next $q$ lines contain one integer each. The $j$-th line contains one integer $b_j$ — the value of the $j$-th query ($1 \le b_j \le 10^9$).
|
Print $q$ integers $ans_j$. The $j$-th integer must be equal to the answer on the $j$-th query. If Polycarp can't obtain the value $b_j$ the answer to the $j$-th query is -1.
|
[
"5 4\n2 4 8 2 4\n8\n5\n14\n10\n"
] |
[
"1\n-1\n3\n2\n"
] |
none
| 0
|
[
{
"input": "5 4\n2 4 8 2 4\n8\n5\n14\n10",
"output": "1\n-1\n3\n2"
},
{
"input": "3 3\n1 1 1\n1\n2\n3",
"output": "1\n2\n3"
},
{
"input": "4 1\n2 4 16 32\n14",
"output": "-1"
},
{
"input": "1 10\n8\n1\n2\n3\n4\n5\n6\n7\n8\n9\n16",
"output": "-1\n-1\n-1\n-1\n-1\n-1\n-1\n1\n-1\n-1"
},
{
"input": "1 10\n4\n1\n2\n3\n4\n5\n6\n7\n8\n9\n16",
"output": "-1\n-1\n-1\n1\n-1\n-1\n-1\n-1\n-1\n-1"
},
{
"input": "1 10\n2\n1\n2\n3\n4\n5\n6\n7\n8\n9\n16",
"output": "-1\n1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1"
},
{
"input": "1 10\n1\n1\n2\n3\n4\n5\n6\n7\n8\n9\n16",
"output": "1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1"
}
] | 1,673,009,625
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 1
| 2,000
| 2,969,600
|
n = input()
ln = n.split()
n = eval(ln[0])
q = eval(ln[1])
p = input()
lp = p.split()
mp = {}
for i in lp:
mp[eval(i)] = mp.get(eval(i), 0) + 1
mp = sorted(mp.items(), reverse=True)
while q != 0:
cnt = 0
wo = eval(input())
for key, vlue in mp:
x = min(int(wo / key), vlue)
cnt = cnt + x
wo = wo - x * key
if wo:
print(-1)
else:
print(cnt)
q = q - 1
|
Title: Coins and Queries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. It is guaranteed that all the values are integer powers of $2$ (i.e. $a_i = 2^d$ for some non-negative integer number $d$).
Polycarp wants to know answers on $q$ queries. The $j$-th query is described as integer number $b_j$. The answer to the query is the minimum number of coins that is necessary to obtain the value $b_j$ using some subset of coins (Polycarp can use only coins he has). If Polycarp can't obtain the value $b_j$, the answer to the $j$-th query is -1.
The queries are independent (the answer on the query doesn't affect Polycarp's coins).
Input Specification:
The first line of the input contains two integers $n$ and $q$ ($1 \le n, q \le 2 \cdot 10^5$) — the number of coins and the number of queries.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ — values of coins ($1 \le a_i \le 2 \cdot 10^9$). It is guaranteed that all $a_i$ are integer powers of $2$ (i.e. $a_i = 2^d$ for some non-negative integer number $d$).
The next $q$ lines contain one integer each. The $j$-th line contains one integer $b_j$ — the value of the $j$-th query ($1 \le b_j \le 10^9$).
Output Specification:
Print $q$ integers $ans_j$. The $j$-th integer must be equal to the answer on the $j$-th query. If Polycarp can't obtain the value $b_j$ the answer to the $j$-th query is -1.
Demo Input:
['5 4\n2 4 8 2 4\n8\n5\n14\n10\n']
Demo Output:
['1\n-1\n3\n2\n']
Note:
none
|
```python
n = input()
ln = n.split()
n = eval(ln[0])
q = eval(ln[1])
p = input()
lp = p.split()
mp = {}
for i in lp:
mp[eval(i)] = mp.get(eval(i), 0) + 1
mp = sorted(mp.items(), reverse=True)
while q != 0:
cnt = 0
wo = eval(input())
for key, vlue in mp:
x = min(int(wo / key), vlue)
cnt = cnt + x
wo = wo - x * key
if wo:
print(-1)
else:
print(cnt)
q = q - 1
```
| 0
|
|
214
|
A
|
System of Equations
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
|
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
|
On a single line print the answer to the problem.
|
[
"9 3\n",
"14 28\n",
"4 20\n"
] |
[
"1\n",
"1\n",
"0\n"
] |
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
| 500
|
[
{
"input": "9 3",
"output": "1"
},
{
"input": "14 28",
"output": "1"
},
{
"input": "4 20",
"output": "0"
},
{
"input": "18 198",
"output": "1"
},
{
"input": "22 326",
"output": "1"
},
{
"input": "26 104",
"output": "1"
},
{
"input": "14 10",
"output": "0"
},
{
"input": "8 20",
"output": "0"
},
{
"input": "2 8",
"output": "0"
},
{
"input": "20 11",
"output": "0"
},
{
"input": "57 447",
"output": "1"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "66 296",
"output": "1"
},
{
"input": "75 683",
"output": "1"
},
{
"input": "227 975",
"output": "1"
},
{
"input": "247 499",
"output": "1"
},
{
"input": "266 116",
"output": "1"
},
{
"input": "286 916",
"output": "1"
},
{
"input": "307 341",
"output": "1"
},
{
"input": "451 121",
"output": "1"
},
{
"input": "471 921",
"output": "1"
},
{
"input": "502 346",
"output": "1"
},
{
"input": "535 59",
"output": "1"
},
{
"input": "555 699",
"output": "1"
},
{
"input": "747 351",
"output": "1"
},
{
"input": "790 64",
"output": "1"
},
{
"input": "810 704",
"output": "1"
},
{
"input": "855 225",
"output": "1"
},
{
"input": "902 34",
"output": "1"
},
{
"input": "922 514",
"output": "1"
},
{
"input": "971 131",
"output": "1"
},
{
"input": "991 931",
"output": "1"
},
{
"input": "840 780",
"output": "0"
},
{
"input": "102 595",
"output": "0"
},
{
"input": "139 433",
"output": "0"
},
{
"input": "968 288",
"output": "0"
},
{
"input": "563 354",
"output": "0"
},
{
"input": "994 975",
"output": "0"
},
{
"input": "456 221",
"output": "0"
},
{
"input": "205 210",
"output": "0"
},
{
"input": "1 11",
"output": "0"
},
{
"input": "1000 1000",
"output": "0"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "11 99",
"output": "0"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "11 1",
"output": "0"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "100 452",
"output": "0"
},
{
"input": "420 380",
"output": "0"
},
{
"input": "31 31",
"output": "0"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "112 134",
"output": "0"
},
{
"input": "13 13",
"output": "0"
},
{
"input": "1 571",
"output": "0"
}
] | 1,639,753,151
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 11
| 216
| 0
|
n1 = input().split()
n = int(n1[0])
m = int(n1[-1])
a=0
b=0
b1 = False
count = 0
while b1==False:
a+=1
b = n - a**2
if b<0:
break
if (a+b**2) == m:
count+=1
print(count)
|
Title: System of Equations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
Input Specification:
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
Output Specification:
On a single line print the answer to the problem.
Demo Input:
['9 3\n', '14 28\n', '4 20\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
|
```python
n1 = input().split()
n = int(n1[0])
m = int(n1[-1])
a=0
b=0
b1 = False
count = 0
while b1==False:
a+=1
b = n - a**2
if b<0:
break
if (a+b**2) == m:
count+=1
print(count)
```
| 0
|
|
748
|
D
|
Santa Claus and a Palindrome
|
PROGRAMMING
| 2,100
|
[
"constructive algorithms",
"data structures",
"greedy"
] | null | null |
Santa Claus likes palindromes very much. There was his birthday recently. *k* of his friends came to him to congratulate him, and each of them presented to him a string *s**i* having the same length *n*. We denote the beauty of the *i*-th string by *a**i*. It can happen that *a**i* is negative — that means that Santa doesn't find this string beautiful at all.
Santa Claus is crazy about palindromes. He is thinking about the following question: what is the maximum possible total beauty of a palindrome which can be obtained by concatenating some (possibly all) of the strings he has? Each present can be used at most once. Note that all strings have the same length *n*.
Recall that a palindrome is a string that doesn't change after one reverses it.
Since the empty string is a palindrome too, the answer can't be negative. Even if all *a**i*'s are negative, Santa can obtain the empty string.
|
The first line contains two positive integers *k* and *n* divided by space and denoting the number of Santa friends and the length of every string they've presented, respectively (1<=≤<=*k*,<=*n*<=≤<=100<=000; *n*·*k* <=≤<=100<=000).
*k* lines follow. The *i*-th of them contains the string *s**i* and its beauty *a**i* (<=-<=10<=000<=≤<=*a**i*<=≤<=10<=000). The string consists of *n* lowercase English letters, and its beauty is integer. Some of strings may coincide. Also, equal strings can have different beauties.
|
In the only line print the required maximum possible beauty.
|
[
"7 3\nabb 2\naaa -3\nbba -1\nzyz -4\nabb 5\naaa 7\nxyx 4\n",
"3 1\na 1\na 2\na 3\n",
"2 5\nabcde 10000\nabcde 10000\n"
] |
[
"12\n",
"6\n",
"0\n"
] |
In the first example Santa can obtain abbaaaxyxaaabba by concatenating strings 5, 2, 7, 6 and 3 (in this order).
| 2,000
|
[
{
"input": "7 3\nabb 2\naaa -3\nbba -1\nzyz -4\nabb 5\naaa 7\nxyx 4",
"output": "12"
},
{
"input": "3 1\na 1\na 2\na 3",
"output": "6"
},
{
"input": "2 5\nabcde 10000\nabcde 10000",
"output": "0"
},
{
"input": "10 10\nnjxbzflaka -1\nfelbvvtkja 6\ngxiuztqkcw 5\naomvscmtti 6\njsqmkoyuca -2\nwckqtzuixg 5\najktvvblef -5\nittmcsvmoa -1\nakalfzbxjn 10\nacuyokmqsj 8",
"output": "31"
},
{
"input": "10 20\njvyxocgomfmrtllgmagp 13\ngvtjnyaofrswcnnifzfq 17\nqisxpseggpjfoijmqnel -5\nlenqmjiofjpggespxsiq 14\nqfzfinncwsrfoaynjtvg 14\ncaayidazlylxyisihdhx 14\npgamglltrmfmogcoxyvj 11\nxhdhisiyxlylzadiyaac 2\ntbirihfpjgbbtclpxwhv 19\nvhwxplctbbgjpfhiribt 10",
"output": "109"
},
{
"input": "1 1\ne -1",
"output": "0"
},
{
"input": "2 1\nt 1\nt 2",
"output": "3"
},
{
"input": "1 2\nyy 1",
"output": "1"
},
{
"input": "2 2\nsn 1\nns 2",
"output": "3"
},
{
"input": "3 3\nada -1\nxuv -1\nvux 3",
"output": "2"
},
{
"input": "4 3\ndbd 24\naba 90\ncbc 54\naba 46",
"output": "190"
},
{
"input": "2 3\naaa 5\naaa -2",
"output": "5"
},
{
"input": "4 3\naba 4\naba 3\naba 3\naba -2",
"output": "10"
},
{
"input": "4 3\naba 4\naba 2\naba 2\naba -1",
"output": "8"
},
{
"input": "3 2\naa 5\naa -2\nbb 1",
"output": "5"
},
{
"input": "2 2\naa 500\naa -50",
"output": "500"
},
{
"input": "2 1\na 5\na -1",
"output": "5"
},
{
"input": "2 3\naba 10\naba -3",
"output": "10"
},
{
"input": "2 3\naba 10\naba -9",
"output": "10"
}
] | 1,601,946,823
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#pragma GCC optimize(2)
#include <bits/stdc++.h>
#define inf 2147483647
#define IosF ios_base::sync_with_stdio(0), cin.tie(0), cout.tie(0)
using namespace std;
typedef long long ll;
#define N 200010
#define lowbit(x) (x&(-x))
map<string, vector<int> > mymap;
vector<int> a, b;
int ans = 0;
void solve() {
for ( auto it : mymap ) {
string s = it.first;
reverse(s.begin(), s.end());
vector<int> v1 = it.second;
if ( v1.empty() ) continue;
sort(v1.begin(), v1.end(), greater<int>() );
if ( s == it.first ) {
int len1 = v1.size();
int t1 = 0, t2 = 0;
for ( int i = 0; i < len1; i += 2 ) {
if ( i + 1 >= len1 ) {
if ( v1[i] > 0 ) t1 = v1[i];
break;
}
if ( v1[i] + v1[i + 1] <= 0 ) {
if ( v1[i] > 0 ) t1 = v1[i];
break;
}
ans += v1[i] + v1[i + 1];
if ( v1[i + 1] < 0 ) t2 = v1[i + 1];
}
a.push_back(t1);
b.push_back(-t2);
it.second.clear();
}
else {
string s2 = s, s1 = it.first;
vector<int> v2 = mymap[s2];
sort(v2.begin(), v2.end(), greater<int>() );
int len1 = v1.size();
int len2 = v2.size();
for ( int i = 0, j = 0; i < len1 && j < len2; ++ i, ++ j ) {
if ( v1[i] + v2[j] > 0 ) ans += v1[i] + v2[j];
else break;
}
it.second.clear();
mymap[s2].clear();
}
}
}
int main() {
IosF;
int n, len, w;
cin >> n >> len;
string str;
for ( int i = 0; i < n; ++ i ) {
cin >> str >> w;
mymap[str].push_back(w);
}
solve();
a.push_back(0);
b.push_back(0);
sort(a.begin(), a.end(), greater<int>() );
sort(b.begin(), b.end(), greater<int>() );
ans += max(a[0], b[0]);
cout << ans << endl;
return 0;
}
|
Title: Santa Claus and a Palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus likes palindromes very much. There was his birthday recently. *k* of his friends came to him to congratulate him, and each of them presented to him a string *s**i* having the same length *n*. We denote the beauty of the *i*-th string by *a**i*. It can happen that *a**i* is negative — that means that Santa doesn't find this string beautiful at all.
Santa Claus is crazy about palindromes. He is thinking about the following question: what is the maximum possible total beauty of a palindrome which can be obtained by concatenating some (possibly all) of the strings he has? Each present can be used at most once. Note that all strings have the same length *n*.
Recall that a palindrome is a string that doesn't change after one reverses it.
Since the empty string is a palindrome too, the answer can't be negative. Even if all *a**i*'s are negative, Santa can obtain the empty string.
Input Specification:
The first line contains two positive integers *k* and *n* divided by space and denoting the number of Santa friends and the length of every string they've presented, respectively (1<=≤<=*k*,<=*n*<=≤<=100<=000; *n*·*k* <=≤<=100<=000).
*k* lines follow. The *i*-th of them contains the string *s**i* and its beauty *a**i* (<=-<=10<=000<=≤<=*a**i*<=≤<=10<=000). The string consists of *n* lowercase English letters, and its beauty is integer. Some of strings may coincide. Also, equal strings can have different beauties.
Output Specification:
In the only line print the required maximum possible beauty.
Demo Input:
['7 3\nabb 2\naaa -3\nbba -1\nzyz -4\nabb 5\naaa 7\nxyx 4\n', '3 1\na 1\na 2\na 3\n', '2 5\nabcde 10000\nabcde 10000\n']
Demo Output:
['12\n', '6\n', '0\n']
Note:
In the first example Santa can obtain abbaaaxyxaaabba by concatenating strings 5, 2, 7, 6 and 3 (in this order).
|
```python
#pragma GCC optimize(2)
#include <bits/stdc++.h>
#define inf 2147483647
#define IosF ios_base::sync_with_stdio(0), cin.tie(0), cout.tie(0)
using namespace std;
typedef long long ll;
#define N 200010
#define lowbit(x) (x&(-x))
map<string, vector<int> > mymap;
vector<int> a, b;
int ans = 0;
void solve() {
for ( auto it : mymap ) {
string s = it.first;
reverse(s.begin(), s.end());
vector<int> v1 = it.second;
if ( v1.empty() ) continue;
sort(v1.begin(), v1.end(), greater<int>() );
if ( s == it.first ) {
int len1 = v1.size();
int t1 = 0, t2 = 0;
for ( int i = 0; i < len1; i += 2 ) {
if ( i + 1 >= len1 ) {
if ( v1[i] > 0 ) t1 = v1[i];
break;
}
if ( v1[i] + v1[i + 1] <= 0 ) {
if ( v1[i] > 0 ) t1 = v1[i];
break;
}
ans += v1[i] + v1[i + 1];
if ( v1[i + 1] < 0 ) t2 = v1[i + 1];
}
a.push_back(t1);
b.push_back(-t2);
it.second.clear();
}
else {
string s2 = s, s1 = it.first;
vector<int> v2 = mymap[s2];
sort(v2.begin(), v2.end(), greater<int>() );
int len1 = v1.size();
int len2 = v2.size();
for ( int i = 0, j = 0; i < len1 && j < len2; ++ i, ++ j ) {
if ( v1[i] + v2[j] > 0 ) ans += v1[i] + v2[j];
else break;
}
it.second.clear();
mymap[s2].clear();
}
}
}
int main() {
IosF;
int n, len, w;
cin >> n >> len;
string str;
for ( int i = 0; i < n; ++ i ) {
cin >> str >> w;
mymap[str].push_back(w);
}
solve();
a.push_back(0);
b.push_back(0);
sort(a.begin(), a.end(), greater<int>() );
sort(b.begin(), b.end(), greater<int>() );
ans += max(a[0], b[0]);
cout << ans << endl;
return 0;
}
```
| -1
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
On vacations *n* pupils decided to go on excursion and gather all together. They need to overcome the path with the length *l* meters. Each of the pupils will go with the speed equal to *v*1. To get to the excursion quickly, it was decided to rent a bus, which has seats for *k* people (it means that it can't fit more than *k* people at the same time) and the speed equal to *v*2. In order to avoid seasick, each of the pupils want to get into the bus no more than once.
Determine the minimum time required for all *n* pupils to reach the place of excursion. Consider that the embarkation and disembarkation of passengers, as well as the reversal of the bus, take place immediately and this time can be neglected.
|
The first line of the input contains five positive integers *n*, *l*, *v*1, *v*2 and *k* (1<=≤<=*n*<=≤<=10<=000, 1<=≤<=*l*<=≤<=109, 1<=≤<=*v*1<=<<=*v*2<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of pupils, the distance from meeting to the place of excursion, the speed of each pupil, the speed of bus and the number of seats in the bus.
|
Print the real number — the minimum time in which all pupils can reach the place of excursion. Your answer will be considered correct if its absolute or relative error won't exceed 10<=-<=6.
|
[
"5 10 1 2 5\n",
"3 6 1 2 1\n"
] |
[
"5.0000000000\n",
"4.7142857143\n"
] |
In the first sample we should immediately put all five pupils to the bus. The speed of the bus equals 2 and the distance is equal to 10, so the pupils will reach the place of excursion in time 10 / 2 = 5.
| 0
|
[
{
"input": "5 10 1 2 5",
"output": "5.0000000000"
},
{
"input": "3 6 1 2 1",
"output": "4.7142857143"
},
{
"input": "39 252 51 98 26",
"output": "3.5344336938"
},
{
"input": "59 96 75 98 9",
"output": "1.2315651330"
},
{
"input": "87 237 3 21 40",
"output": "33.8571428571"
},
{
"input": "11 81 31 90 1",
"output": "2.3331983806"
},
{
"input": "39 221 55 94 1",
"output": "3.9608012268"
},
{
"input": "59 770 86 94 2",
"output": "8.9269481589"
},
{
"input": "10000 1000000000 1 2 1",
"output": "999925003.7498125093"
},
{
"input": "10000 1 999999999 1000000000 1",
"output": "0.0000000010"
},
{
"input": "9102 808807765 95894 96529 2021",
"output": "8423.2676366126"
},
{
"input": "87 422 7 90 3",
"output": "49.2573051579"
},
{
"input": "15 563 38 51 5",
"output": "13.4211211456"
},
{
"input": "39 407 62 63 2",
"output": "6.5592662969"
},
{
"input": "18 518 99 100 4",
"output": "5.2218163471"
},
{
"input": "8367 515267305 49370 57124 723",
"output": "10310.3492287628"
},
{
"input": "6592 724149457 54877 85492 6302",
"output": "10543.9213545882"
},
{
"input": "8811 929128198 57528 84457 6629",
"output": "13306.2878107183"
},
{
"input": "8861 990217735 49933 64765 6526",
"output": "17403.1926037323"
},
{
"input": "9538 765513348 52584 86675 8268",
"output": "11295.6497404812"
},
{
"input": "9274 783669740 44989 60995 6973",
"output": "14946.9402371816"
},
{
"input": "9103 555078149 86703 93382 8235",
"output": "6168.7893283125"
},
{
"input": "9750 980765213 40044 94985 4226",
"output": "18012.2266672490"
},
{
"input": "5884 943590784 42695 98774 3117",
"output": "14275.9991046103"
},
{
"input": "1 1 1 2 1",
"output": "0.5000000000"
},
{
"input": "10000 1000000000 1 1000000000 1",
"output": "19998.6000479986"
},
{
"input": "10000 1000000000 1 1000000000 10000",
"output": "1.0000000000"
},
{
"input": "10000 1000000000 999999999 1000000000 3",
"output": "1.0000000010"
},
{
"input": "9999 1000000 10 20 3",
"output": "99977.5011249438"
},
{
"input": "1 1 1 1000000000 1",
"output": "0.0000000010"
},
{
"input": "1 1 999999999 1000000000 1",
"output": "0.0000000010"
},
{
"input": "1 1000000000 1 2 1",
"output": "500000000.0000000000"
},
{
"input": "1 1000000000 1 1000000000 1",
"output": "1.0000000000"
},
{
"input": "1 1000000000 999999999 1000000000 1",
"output": "1.0000000000"
},
{
"input": "10000 1 1 2 1",
"output": "0.9999250037"
},
{
"input": "10000 1 1 2 10000",
"output": "0.5000000000"
},
{
"input": "10000 1 1 1000000000 1",
"output": "0.0000199986"
},
{
"input": "10000 1 1 1000000000 10000",
"output": "0.0000000010"
},
{
"input": "10000 1 999999999 1000000000 10000",
"output": "0.0000000010"
},
{
"input": "10000 1000000000 1 2 10000",
"output": "500000000.0000000000"
},
{
"input": "10000 1000000000 999999999 1000000000 1",
"output": "1.0000000010"
},
{
"input": "10000 1000000000 999999999 1000000000 10000",
"output": "1.0000000000"
}
] | 1,691,966,560
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
print("_RANDOM_GUESS_1691966560.0947864")# 1691966560.0948036
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On vacations *n* pupils decided to go on excursion and gather all together. They need to overcome the path with the length *l* meters. Each of the pupils will go with the speed equal to *v*1. To get to the excursion quickly, it was decided to rent a bus, which has seats for *k* people (it means that it can't fit more than *k* people at the same time) and the speed equal to *v*2. In order to avoid seasick, each of the pupils want to get into the bus no more than once.
Determine the minimum time required for all *n* pupils to reach the place of excursion. Consider that the embarkation and disembarkation of passengers, as well as the reversal of the bus, take place immediately and this time can be neglected.
Input Specification:
The first line of the input contains five positive integers *n*, *l*, *v*1, *v*2 and *k* (1<=≤<=*n*<=≤<=10<=000, 1<=≤<=*l*<=≤<=109, 1<=≤<=*v*1<=<<=*v*2<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of pupils, the distance from meeting to the place of excursion, the speed of each pupil, the speed of bus and the number of seats in the bus.
Output Specification:
Print the real number — the minimum time in which all pupils can reach the place of excursion. Your answer will be considered correct if its absolute or relative error won't exceed 10<=-<=6.
Demo Input:
['5 10 1 2 5\n', '3 6 1 2 1\n']
Demo Output:
['5.0000000000\n', '4.7142857143\n']
Note:
In the first sample we should immediately put all five pupils to the bus. The speed of the bus equals 2 and the distance is equal to 10, so the pupils will reach the place of excursion in time 10 / 2 = 5.
|
```python
print("_RANDOM_GUESS_1691966560.0947864")# 1691966560.0948036
```
| 0
|
|
426
|
A
|
Sereja and Mugs
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Sereja showed an interesting game to his friends. The game goes like that. Initially, there is a table with an empty cup and *n* water mugs on it. Then all players take turns to move. During a move, a player takes a non-empty mug of water and pours all water from it into the cup. If the cup overfills, then we assume that this player lost.
As soon as Sereja's friends heard of the game, they wanted to play it. Sereja, on the other hand, wanted to find out whether his friends can play the game in such a way that there are no losers. You are given the volumes of all mugs and the cup. Also, you know that Sereja has (*n*<=-<=1) friends. Determine if Sereja's friends can play the game so that nobody loses.
|
The first line contains integers *n* and *s* (2<=≤<=*n*<=≤<=100; 1<=≤<=*s*<=≤<=1000) — the number of mugs and the volume of the cup. The next line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10). Number *a**i* means the volume of the *i*-th mug.
|
In a single line, print "YES" (without the quotes) if his friends can play in the described manner, and "NO" (without the quotes) otherwise.
|
[
"3 4\n1 1 1\n",
"3 4\n3 1 3\n",
"3 4\n4 4 4\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "3 4\n1 1 1",
"output": "YES"
},
{
"input": "3 4\n3 1 3",
"output": "YES"
},
{
"input": "3 4\n4 4 4",
"output": "NO"
},
{
"input": "2 1\n1 10",
"output": "YES"
},
{
"input": "3 12\n5 6 6",
"output": "YES"
},
{
"input": "4 10\n6 3 8 7",
"output": "NO"
},
{
"input": "5 16\n3 3 2 7 9",
"output": "YES"
},
{
"input": "6 38\n9 10 3 8 10 6",
"output": "YES"
},
{
"input": "7 12\n4 4 5 2 2 4 9",
"output": "NO"
},
{
"input": "8 15\n8 10 4 2 10 9 7 6",
"output": "NO"
},
{
"input": "9 22\n1 3 5 9 7 6 1 10 1",
"output": "NO"
},
{
"input": "10 30\n9 10 4 5 5 7 1 7 7 2",
"output": "NO"
},
{
"input": "38 83\n9 9 3 10 2 4 6 10 9 5 1 8 7 4 7 2 6 5 3 1 10 8 4 8 3 7 1 2 7 6 8 6 5 2 3 1 1 2",
"output": "NO"
},
{
"input": "84 212\n6 2 3 1 2 7 5 1 7 2 9 10 9 5 2 5 4 10 9 9 1 9 8 8 9 4 9 4 8 2 1 8 4 5 10 7 6 2 1 10 10 7 9 4 5 9 5 10 10 3 6 6 4 4 4 8 5 4 9 1 9 9 1 7 9 2 10 9 10 8 3 3 9 3 9 10 1 8 9 2 6 9 7 2",
"output": "NO"
},
{
"input": "8 50\n8 8 8 4 4 6 10 10",
"output": "YES"
},
{
"input": "7 24\n1 4 9 1 2 3 6",
"output": "YES"
},
{
"input": "47 262\n3 7 6 4 10 3 5 7 2 9 3 2 2 10 8 7 3 10 6 3 1 1 4 10 2 9 2 10 6 4 3 6 3 6 9 7 8 8 3 3 10 5 2 10 7 10 9",
"output": "YES"
},
{
"input": "42 227\n3 6 1 9 4 10 4 10 7 8 10 10 8 7 10 4 6 8 7 7 6 9 3 6 5 5 2 7 2 7 4 4 6 6 4 3 9 3 6 4 7 2",
"output": "NO"
},
{
"input": "97 65\n3 10 2 6 1 4 7 5 10 3 10 4 5 5 1 6 10 7 4 5 3 9 9 8 6 9 2 3 6 8 5 5 5 5 5 3 10 4 1 8 8 9 8 4 1 4 9 3 6 3 1 4 8 3 10 8 6 4 5 4 3 2 2 4 3 6 4 6 2 3 3 3 7 5 1 8 1 4 5 1 1 6 4 2 1 7 8 6 1 1 5 6 5 10 6 7 5",
"output": "NO"
},
{
"input": "94 279\n2 5 9 5 10 3 1 8 1 7 1 8 1 6 7 8 4 9 5 10 3 7 6 8 8 5 6 8 10 9 4 1 3 3 4 7 8 2 6 6 5 1 3 7 1 7 2 2 2 8 4 1 1 5 9 4 1 2 3 10 1 4 9 9 6 8 8 1 9 10 4 1 8 5 8 9 4 8 2 1 1 9 4 5 6 1 2 5 6 7 3 1 4 6",
"output": "NO"
},
{
"input": "58 70\n8 2 10 2 7 3 8 3 8 7 6 2 4 10 10 6 10 3 7 6 4 3 5 5 5 3 8 10 3 4 8 4 2 6 8 9 6 9 4 3 5 2 2 6 10 6 2 1 7 5 6 4 1 9 10 2 4 5",
"output": "NO"
},
{
"input": "6 14\n3 9 2 1 4 2",
"output": "YES"
},
{
"input": "78 400\n5 9 3 4 7 4 1 4 6 3 9 1 8 3 3 6 10 2 1 9 6 1 8 10 1 6 4 5 2 1 5 9 6 10 3 6 5 2 4 10 6 9 3 8 10 7 2 8 8 2 10 1 4 5 2 8 6 4 4 3 5 2 3 10 1 9 8 5 6 7 9 1 8 8 5 4 2 4",
"output": "YES"
},
{
"input": "41 181\n5 3 10 4 2 5 9 3 1 6 6 10 4 3 9 8 5 9 2 5 4 6 6 3 7 9 10 3 10 6 10 5 6 1 6 9 9 1 2 4 3",
"output": "NO"
},
{
"input": "2 4\n4 4",
"output": "YES"
},
{
"input": "29 71\n4 8 9 4 8 10 4 10 2 9 3 9 1 2 9 5 9 7 1 10 4 1 1 9 8 7 4 6 7",
"output": "NO"
},
{
"input": "49 272\n4 10 8 7 5 6 9 7 2 6 6 2 10 7 5 6 5 3 6 4 3 7 9 3 7 7 4 10 5 6 7 3 6 4 6 7 7 2 5 5 7 3 7 9 3 6 6 2 1",
"output": "YES"
},
{
"input": "91 486\n1 3 5 4 4 7 3 9 3 4 5 4 5 4 7 9 5 8 4 10 9 1 1 9 9 1 6 2 5 4 7 4 10 3 2 10 9 3 4 5 1 3 4 2 10 9 10 9 10 2 4 6 2 5 3 6 4 9 10 3 9 8 1 2 5 9 2 10 4 6 10 8 10 9 1 2 5 8 6 6 6 1 10 3 9 3 5 6 1 5 5",
"output": "YES"
},
{
"input": "80 78\n1 9 4 9 8 3 7 10 4 9 2 1 4 4 9 5 9 1 2 6 5 2 4 8 4 6 9 6 7 10 1 9 10 4 7 1 7 10 8 9 10 5 2 6 7 7 7 7 7 8 2 5 1 7 2 3 2 5 10 6 3 4 5 2 6 3 4 2 7 9 9 3 8 8 2 3 7 1 5 10",
"output": "NO"
},
{
"input": "53 245\n5 6 9 9 2 3 2 5 10 9 3 5 6 3 10 10 9 4 9 7 10 9 7 7 3 4 9 3 7 3 8 6 8 9 3 8 9 1 3 1 9 10 3 9 3 1 6 6 3 8 7 8 9",
"output": "NO"
},
{
"input": "50 271\n6 9 10 1 1 1 8 3 6 6 3 2 5 9 7 5 7 9 10 9 4 6 6 2 6 6 9 5 1 6 5 8 3 2 5 10 10 1 4 1 4 6 1 8 7 8 9 4 7 5",
"output": "YES"
},
{
"input": "38 214\n5 8 4 5 1 9 9 2 6 3 4 3 5 7 7 7 3 10 1 5 10 4 2 2 10 10 6 6 6 7 1 6 10 5 7 4 5 10",
"output": "YES"
},
{
"input": "100 1\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "100 100\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "100 989\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "100 990\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "YES"
},
{
"input": "100 1000\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "YES"
},
{
"input": "2 1\n1 1",
"output": "YES"
},
{
"input": "2 1\n2 2",
"output": "NO"
},
{
"input": "2 1000\n1 1",
"output": "YES"
},
{
"input": "10 89\n10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "10 44\n1 10 2 3 4 5 6 7 8 9",
"output": "NO"
}
] | 1,565,381,206
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 124
| 0
|
a,b=input().split()
a,b=int(a),int(b)
c=input().split()
for i in range(a-1):
b-=int(min(c))
c.remove(min(c))
if b<0:
print('NO')
else:
print('YES')
|
Title: Sereja and Mugs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja showed an interesting game to his friends. The game goes like that. Initially, there is a table with an empty cup and *n* water mugs on it. Then all players take turns to move. During a move, a player takes a non-empty mug of water and pours all water from it into the cup. If the cup overfills, then we assume that this player lost.
As soon as Sereja's friends heard of the game, they wanted to play it. Sereja, on the other hand, wanted to find out whether his friends can play the game in such a way that there are no losers. You are given the volumes of all mugs and the cup. Also, you know that Sereja has (*n*<=-<=1) friends. Determine if Sereja's friends can play the game so that nobody loses.
Input Specification:
The first line contains integers *n* and *s* (2<=≤<=*n*<=≤<=100; 1<=≤<=*s*<=≤<=1000) — the number of mugs and the volume of the cup. The next line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10). Number *a**i* means the volume of the *i*-th mug.
Output Specification:
In a single line, print "YES" (without the quotes) if his friends can play in the described manner, and "NO" (without the quotes) otherwise.
Demo Input:
['3 4\n1 1 1\n', '3 4\n3 1 3\n', '3 4\n4 4 4\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none
|
```python
a,b=input().split()
a,b=int(a),int(b)
c=input().split()
for i in range(a-1):
b-=int(min(c))
c.remove(min(c))
if b<0:
print('NO')
else:
print('YES')
```
| 3
|
|
312
|
A
|
Whose sentence is it?
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100.
|
For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG>.< I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions.
|
[
"5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n"
] |
[
"Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\n"
] |
none
| 500
|
[
{
"input": "5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .",
"output": "Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!"
},
{
"input": "10\nLpAEKiHVJrzSZqBVSSyY\nYECGBlala.\nUZeGpeM.UCwiHmmA\nqt_,.b_.LSwJtJ.\nFAnXZtHlala.\nmiao.iapelala.\nCFPlbUgObrXLejPNu.F\nZSUfvisiHyrIMjMlala.\nmiao. lala.\nd,IWSeumytrVlala.",
"output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's"
},
{
"input": "10\nmiao.,taUvXPVlala.\nmiao.txEeId.X_lala.\nLZIeAEd JaeBVlala.\ncKPIsWpwIlala.\nfYp.eSvn,g\nKMx,nFEslala.\nmiao.QtMyxYqiajjuM\nDutxNkCqywgcnCYskcd\ngFLKACjeqfD\n,Ss UmY.wJvcX",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.Plala.\nDVm,VYslala.\nmiao.rlala.\nmiao.,KQNL.fO_.QRc\nUBLCKEUePlala.\nIouS.Alala.\nmiao.lala.\nmiao.rlala.\nEJZwRJeKlala.\nmiao.Olala.",
"output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nRainbow's\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.grFTpju.jCLRnZ\ng.pVHYA_Usnm\nlloWONolcMFElala.\nAW,n.JJkOTe.Nd\n.bP.HvKlala.\nGziqPGQa,lala.\nmiao.,QkOCH.vFlala.\n.PUtOwImvUsoeh \nmiao.Z,KIds.R\nmiao.,_MDzoaAiJlala.",
"output": "Rainbow's\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.xWfjV\nHFVrGCDQXyZ,Sbm\nLMDS.xVkTCAY.vm\nmiao.lLBglala.\nnl,jRPyClala.\nFYnHoXlala.\nmiao. oxaHE\n.WTrw_mNpOQCa\nHOk..wHYoyMhl\nQX,XpMuPIROM",
"output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nJBQqiXlala.\npUNUWQRiMPCXv\nAiLnfNHWznwkC.lala.\nmiao.Dl_Oy\nxJJJkVkdfOzQBH_SmKh\nfgD_IHvdHiorE,W\nmiao.usBKixglala.\nwCpqPUzEtD\nmiao.rlala.\nmiao.JylcGvWlala.",
"output": "Freda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nmiao..FLhPl_Wjslala.\nmiao. tdEGtfdJlala.\nGAzEUlala.\nKCcmOa .aKBlZyYsdu.V\nmiao.lala.\njKylnM,FXK\nmiao.GBWqjGH.v\nmiao.RefxS Cni.\nOxaaEihuHQR_s,\nmiao.a,Axtlala.",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nNo.I_aTXlala.\nmiao.JKSCoRZS\nnOBMIlala.\nmiao.nlala.\nmiao._xqxoHIIlala.\nmiao.NJPy SWyiUDWc\nmiao.cCnahFaqqj.Xqp\nnreSMDeXPPYAQxI,W\nAktPajWimdd_qRn\nmiao.QHwKCYlala.",
"output": "Freda's\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\n \n,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ \n \nmiao.miao.miao.\nlala.lala.lala.\nlala.miao.\nmiaolala. \nmiao.lala\nmiaolala_\n,.._ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nduClyjMIPsEuWmx_Ce.byVoizYlTM,sF\nuZHsNip_,Mwtg,FZjM_LzPC,_pSvEOyTHfAOvoZXvxCZdgYDTCDdCAoSVZWyxXGcLgWlala.\nEGtJFPAvTEcqjkhaGxdduaQ_rmUzF.WaU, EIuX B,aVzFFpFrxpwADXuayRD azDfj \n_tJqYzXyqc.,u.F,mUYukveBPWnPq,f,dJnPHuBazdnbRHfzwNUdRbheAIjcoaPcnLvocrzcioxCapb R\n.YUBeb_zmwUt.QQuUdQIiOXtqshcsycEe,HLytHlala.\ndJndLqGBHt.GfpN.BgvsbXoLh_DIzAJOtFDmLSCYEztvPcS_GHPxivzV,NPMmSAtfk.Mg.w,A UcCt_lCD.csEzyJJBYtSMkzqiA\nmiao.qlala.\nmiao.FmDlY\nmiao.UQI.aJmnanNvRLskuVaMybDMsOlala.\nmiao.lala.",
"output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.vyscfysAtWcPkpFHdwZqAQ,UPPcjhKQTlala.\nmiao.KESqus DybUuYFoWVpo..LWZh.UqEdUsTHFlKfzqkThAUPklala.\nUNoE vfZIAdxkiWKhsHPfsqRPTNQoHgAxooVLYxRzugHjo jaEHWQFF\nCCmdIwr.UkoiYWK.Z,,ZesMpISTXNgnpYnJaWquCyL,gO\n.JvOayhXK_bgoYbfAtnXg\nbvdSzRrXoGxVgWvdXnsjEnEfxDzIQo_aZVGDGrzwuAMtzVAHioMBx_DHuTxyieGbGuSRNUojOREqxBBxvCgqAOMzwIWT\nMBuaWduZmRaOGyIPzWOsBVeqtDrblAbXxmM_uRfqMvnVlLEuhVKlhidN_aigiXyq,ZEDqQAx\nmiao.wCHVCuVKNePKmIUFLL_lala.\nmiao.iAqstXHUv\n pMO yvPkNtnNwmUCao W,wW.OvIMVaEeVYHmqaniWq.ivlala.",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's"
},
{
"input": "10\nmiao.\nmiao.jrwLBCpNaDCjyoK.PFzbwWU.h.. wfQquG_P..lala.\nmiao.LGlYdKjw__.Chlala.\nW.wtr qG KDOHj.xWxPbXIXjD_,GJZDaAZ,JBHphsjWJwSKcZAIAi\nmiao.pHsGAZQDWPJQwKC.zHjJituLgp.eUrzObTI.wrpect.FMUJqu,Zuslala.\nmiao.YVlOpXccUA_YU igbsbZbhOVwyYTyOjnWqgiTmxwAuFa.flCHn.,MtVbqxZQl_BGHXWkwijGjuL, ,ezyNlala.\nmiao.xCrVSz.aMv UOSOroDlQxWeBmlWe.FA.ZfUmviMlala.\nxebAlala.\nmiao.qVSxqf vOTlala.\nD.oBUwsLQRgXAoNkQJhQN.w.oMhuvtujnmiwgQYMfjlNTSHh .lSKgI.OEp",
"output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nZXXzYlTiQU\nkXE.DdcbOojSaSgjMcFBPubKHefEVAzbi,PDFgSZIz,lala.\nxEfrTCjKhhwBC.UNmJXgTGUdkQeVDlala.\nLfaEw.jvMmuOBWtfoiJNtDIlQAVWNU,xWK_efBBtfkM\nqtBpqKZMWZMX_NKrUAEKYyQcLZWQlqbM\nmiao.PrJEbUtInremuaKRItqXOrfQEjQcAak VQ\nMpGCq awvQaHRvDr uvtVMKsvZI\nmiao.A.RVGu.szCEp.pXQJwL EuTltlN.WradoTvWHJyhcNSoulala.\nmiao.rzlUHzUdxtDRpWRuc,QZwEBfsKKGHMLGtFymPPQdptLFlzZ_ORWqrlfOrlntuDkpXEvz.CxwAsFYUvpnOnFWG\nmiao.VXUoNBwlgBwcna_n.CgAAcKKUuiVA.doOJKHpMdwNwlHAcLpdfN.Awa SthrlEWpUcuOonUTxIQNszYcHDXxnhArrM..A",
"output": "OMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's"
},
{
"input": "10\nmiao.qbxBFzrjtWv.yOk\nDBgi,loApO AACrGnwssCHN\nmiao.LV.wbQEE_V.BSAtdTIHTQOJVJ_nGOthbL,nJvQ.UeWFpsa.GGsK_Uv,HQxHS,AN_bkrolala.\nmiao.tBEqk rIQuByGKhfq_iP.BW,nySZEfrfySEcqnnIzxC,lrjIiivbxlkoVXJFiegGFRn NO,txGPhVBcv.CVhMmNO zlala.\nmiao.aBZWDWxk.wkR ,NyCzGxJnJDqBZpetdUPAmmBZDXl_Tbflala.\nmiao. XN,uMwWm. VqloYr..jTLszlala.\n.rshcgfZ.eZOdMu_RMh\nmiao.ahiwpECEe.lala.\nLeoUSroTekQAMSO__M L_ZEeRD_tUihYvQETFB,RzJmFtFiKrU\nBtygQG_OoFEFBL.KsVWTYbtqtalXoStFCZ RINHda.NuLmlkRB.vAQJFvelbsfoJ.T,M sJn",
"output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nYoYBCcaqhXLfvKKf.UYMODTHyPZlala.\ncxgWn J.Q\nmiao.nwH.IHntgKYDhdsjU DMTHXEVRyeJP ZaAecCIBJXuv.YjhEmtbjvjKnK.U,oc,x\nmiao.EcQ.FDtRJgmpAzxhq.RwXBLxjyC,IeMqaFoheMPFCGWBcwUAFnbiwlbz_fcsEGPfJaeryCtFocBNEWTlala.\nmiao.W\nmiao. ZQpIeyCXJSnFgAIzu.THfrmyoogYWQzFqblala.\nmiao.ifzdCwnTDcxpvdr OTC.YqPv.MKDp..utICtAsbfYyGlala.\nmiao.\nmiao.tS.U.wH.s,CxORZJsBAHLi,fXeoDJWVBH\nrcUMpeupOVRKrcIRAvU.rP kgUEfoeXcrFPQOBYG.BNvAQPg.XHMWizhLpZNljXc .LQmVXCi",
"output": "Freda's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!"
},
{
"input": "10\nlala.\nmiao.milalala.lmmialamiao.la.o.iao.a.ao.\nmialala.o.\nmiao.millala.allala.amiao..miao.miao.lala.ao.miammiao.iao.o.\nmiao.miaomiao..\nlalmiao.amiao..\nmiao.lala.lamiamiaolala..o.lalala.miao..\nmlala.iao.lalamiao..\nlmlala.iao.alalamiao.lmialala.lala.miao.o.alala..lala..lalmiaomiao..lalmiao.a.lalamiao..miao.alala..\nlalllamiao.la.lala.alamiao.lalalala.lala..miao.lamiao.la.lallalamiao..a..a.",
"output": "Freda's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nlalllala.ala.lala.a.mmimiao.aomiao.lllala.ala.amiao.la.mialalala.la.o..imiao.miao.amlala.iao.o.\nmilala.alllala.ala.amiao.lamiao..o.\nlala.lalalala..lalalala..\nlala.miao.\nmimiao.ao.lala.\nlalmiao.amlala.iamialala.o.o..\nlalammlala.iaolammiao.imiao.ao.la..iao..\nmiao.mialala.omiao..mlala.iaolala..\nmiamiao.o.llallala.ala.la.miao.ala.miao.mimialmiao.ala.o.alala.miaomiao..olala..\nmialala.lamiao.la.lala.miao.ollala.allala.ala.lmiaommiao.imiao.ao.lallallala.a.miao.a..a..",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nlamiao.lamiao.mimiao.ao..\nllala.almiaomiao..lala.miao.a.\nlalala.lala.lalala.lala.lalala..la.\nlalala.la.miao.\nmiao.llalallala.miao.a.la.lala.almimiao.ao.a.\nmiao.mlala.ilala.aomilala.ao..\nmilala.ao.\nmmiao.iao.\nmlala.lala.ialalmiao.alala..olala.lala..\nlala.lmlalalalalala...iao.milala.aommiao.iao..alamiaolallala.milala.ao.a..lalalmiao.a..llala.amiao..",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "4\n \n miao. \n lala. \n ",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "1\nMiao.",
"output": "OMG>.< I don't know!"
},
{
"input": "1\nm",
"output": "OMG>.< I don't know!"
},
{
"input": "1\nMiAo.sdsdlala.",
"output": "Freda's"
},
{
"input": "1\nLalA.",
"output": "OMG>.< I don't know!"
},
{
"input": "3\n.\nm\nl",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
}
] | 1,677,235,467
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 46
| 409,600
|
import re
for _ in range(int(input())):
a=input()
b=re.findall(r"(miao\.){1}|(lala\.){1}",a)
if b==[]: print("OMG>.< I don't know!")
elif len(b) == 2: print("OMG>.< I don't know!")
elif len(b) == 1: print("Freda's" if b[0][-1] == "lala." else "Rainbow's")
|
Title: Whose sentence is it?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100.
Output Specification:
For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG>.< I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions.
Demo Input:
['5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n']
Demo Output:
["Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\n"]
Note:
none
|
```python
import re
for _ in range(int(input())):
a=input()
b=re.findall(r"(miao\.){1}|(lala\.){1}",a)
if b==[]: print("OMG>.< I don't know!")
elif len(b) == 2: print("OMG>.< I don't know!")
elif len(b) == 1: print("Freda's" if b[0][-1] == "lala." else "Rainbow's")
```
| 0
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,617,230,961
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 92
| 0
|
# python code for E-1
x,y = int(input()).split()
print((x * y) // 2)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
# python code for E-1
x,y = int(input()).split()
print((x * y) // 2)
```
| -1
|
873
|
B
|
Balanced Substring
|
PROGRAMMING
| 1,500
|
[
"dp",
"implementation"
] | null | null |
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
|
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
|
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
|
[
"8\n11010111\n",
"3\n111\n"
] |
[
"4\n",
"0\n"
] |
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring.
| 0
|
[
{
"input": "8\n11010111",
"output": "4"
},
{
"input": "3\n111",
"output": "0"
},
{
"input": "11\n00001000100",
"output": "2"
},
{
"input": "10\n0100000000",
"output": "2"
},
{
"input": "13\n0001000011010",
"output": "6"
},
{
"input": "14\n00000100101011",
"output": "10"
},
{
"input": "14\n01111101111111",
"output": "2"
},
{
"input": "18\n110010101101111111",
"output": "10"
},
{
"input": "11\n00010000011",
"output": "4"
},
{
"input": "10\n1000010110",
"output": "6"
},
{
"input": "15\n100000100000011",
"output": "4"
},
{
"input": "18\n011010101110111101",
"output": "8"
},
{
"input": "10\n0011011111",
"output": "6"
},
{
"input": "3\n011",
"output": "2"
},
{
"input": "14\n11111111111111",
"output": "0"
},
{
"input": "65\n11001000110001001011011110111100000000101001001010101111000100010",
"output": "48"
},
{
"input": "10\n0011111000",
"output": "10"
},
{
"input": "13\n1110000001110",
"output": "12"
},
{
"input": "3\n110",
"output": "2"
},
{
"input": "4\n1110",
"output": "2"
},
{
"input": "9\n001011001",
"output": "8"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n01",
"output": "2"
},
{
"input": "12\n110000110000",
"output": "8"
},
{
"input": "3\n001",
"output": "2"
},
{
"input": "14\n11000011000000",
"output": "8"
},
{
"input": "19\n0000011111111100000",
"output": "18"
},
{
"input": "45\n011010001100001111110001011100000001101100111",
"output": "44"
},
{
"input": "18\n000001111111100000",
"output": "16"
},
{
"input": "4\n0101",
"output": "4"
},
{
"input": "12\n000101011001",
"output": "10"
}
] | 1,511,414,049
| 4,149
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
n = int(input())
s = input(); res = str()
for i in range(n - 1):
res += str(int(s[i]) ^ int(s[i+1]))
print(res.count('1'))
|
Title: Balanced Substring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
Input Specification:
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
Output Specification:
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
Demo Input:
['8\n11010111\n', '3\n111\n']
Demo Output:
['4\n', '0\n']
Note:
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring.
|
```python
n = int(input())
s = input(); res = str()
for i in range(n - 1):
res += str(int(s[i]) ^ int(s[i+1]))
print(res.count('1'))
```
| 0
|
|
776
|
B
|
Sherlock and his girlfriend
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"number theory"
] | null | null |
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
|
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
|
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
|
[
"3\n",
"4\n"
] |
[
"2\n1 1 2 ",
"2\n2 1 1 2\n"
] |
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct.
| 1,000
|
[
{
"input": "3",
"output": "2\n1 1 2 "
},
{
"input": "4",
"output": "2\n1 1 2 1 "
},
{
"input": "17",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 "
},
{
"input": "25",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 "
},
{
"input": "85",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 "
},
{
"input": "105",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 "
},
{
"input": "123",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "452",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "641",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "293",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "733",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "10",
"output": "2\n1 1 2 1 2 1 2 2 2 1 "
},
{
"input": "287",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3202",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "728",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3509",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "5137",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2023",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "4890",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "8507",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1796",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3466",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1098",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11226",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11731",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11644",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "14553",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "17307",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "23189",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "6818",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1054",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "28163",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "30885",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "27673",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11656",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "36325",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "31205",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29958",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1696",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "44907",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "13736",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29594",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "19283",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "15346",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "41794",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99998",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99971",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
}
] | 1,661,523,906
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 11
| 93
| 1,331,200
|
import math
def isPrime(n: int):
for i in range(2, int(math.sqrt(n)) + 1):
if n % i == 0:
return 2
return 1
n = int(input())
if n == 1:
print(1)
else:
print(2)
for u in [isPrime(x) for x in range(2, n+2)]:
print(u, end = ' ')
|
Title: Sherlock and his girlfriend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
Input Specification:
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
Output Specification:
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
Demo Input:
['3\n', '4\n']
Demo Output:
['2\n1 1 2 ', '2\n2 1 1 2\n']
Note:
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct.
|
```python
import math
def isPrime(n: int):
for i in range(2, int(math.sqrt(n)) + 1):
if n % i == 0:
return 2
return 1
n = int(input())
if n == 1:
print(1)
else:
print(2)
for u in [isPrime(x) for x in range(2, n+2)]:
print(u, end = ' ')
```
| 0
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,694,094,648
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
n=list(map(int,input().split()))
for i in n:
print(min(n))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n=list(map(int,input().split()))
for i in n:
print(min(n))
```
| 0
|
557
|
B
|
Pasha and Tea
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"implementation",
"math",
"sortings"
] | null | null |
Pasha decided to invite his friends to a tea party. For that occasion, he has a large teapot with the capacity of *w* milliliters and 2*n* tea cups, each cup is for one of Pasha's friends. The *i*-th cup can hold at most *a**i* milliliters of water.
It turned out that among Pasha's friends there are exactly *n* boys and exactly *n* girls and all of them are going to come to the tea party. To please everyone, Pasha decided to pour the water for the tea as follows:
- Pasha can boil the teapot exactly once by pouring there at most *w* milliliters of water; - Pasha pours the same amount of water to each girl; - Pasha pours the same amount of water to each boy; - if each girl gets *x* milliliters of water, then each boy gets 2*x* milliliters of water.
In the other words, each boy should get two times more water than each girl does.
Pasha is very kind and polite, so he wants to maximize the total amount of the water that he pours to his friends. Your task is to help him and determine the optimum distribution of cups between Pasha's friends.
|
The first line of the input contains two integers, *n* and *w* (1<=≤<=*n*<=≤<=105, 1<=≤<=*w*<=≤<=109) — the number of Pasha's friends that are boys (equal to the number of Pasha's friends that are girls) and the capacity of Pasha's teapot in milliliters.
The second line of the input contains the sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=109, 1<=≤<=*i*<=≤<=2*n*) — the capacities of Pasha's tea cups in milliliters.
|
Print a single real number — the maximum total amount of water in milliliters that Pasha can pour to his friends without violating the given conditions. Your answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=6.
|
[
"2 4\n1 1 1 1\n",
"3 18\n4 4 4 2 2 2\n",
"1 5\n2 3\n"
] |
[
"3",
"18",
"4.5"
] |
Pasha also has candies that he is going to give to girls but that is another task...
| 1,000
|
[
{
"input": "2 4\n1 1 1 1",
"output": "3.0000000000"
},
{
"input": "3 18\n4 4 4 2 2 2",
"output": "18.0000000000"
},
{
"input": "1 5\n2 3",
"output": "4.5000000000"
},
{
"input": "1 1\n1000000000 1000000000",
"output": "1.0000000000"
},
{
"input": "4 1000000000\n1 1 1 1 1 1 1 1",
"output": "6.0000000000"
},
{
"input": "4 1000000000\n1 1 1 1 2 2 2 2",
"output": "12.0000000000"
},
{
"input": "4 1\n3 3 3 3 4 4 4 4",
"output": "1.0000000000"
},
{
"input": "2 19\n3 3 5 5",
"output": "15.0000000000"
},
{
"input": "3 31\n3 3 3 5 5 5",
"output": "22.5000000000"
},
{
"input": "5 15\n2 3 4 1 2 4 5 3 5 10",
"output": "15.0000000000"
},
{
"input": "5 14\n2 3 4 1 2 4 5 3 5 10",
"output": "14.0000000000"
},
{
"input": "5 16\n2 3 4 1 2 4 5 3 5 10",
"output": "15.0000000000"
},
{
"input": "1 100\n1 200",
"output": "3.0000000000"
},
{
"input": "1 1\n1 1",
"output": "1.0000000000"
},
{
"input": "2 1000000000\n1 1 1 100",
"output": "3.0000000000"
},
{
"input": "4 30\n3 3 3 3 4 5 6 7",
"output": "24.0000000000"
},
{
"input": "2 100\n1 1 1 10",
"output": "3.0000000000"
},
{
"input": "3 18\n1 1 1 1 1 5",
"output": "4.5000000000"
}
] | 1,550,509,444
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 93
| 0
|
n, w = map(int, input().split())
l = list(map(int, input().split()))
sortedArray = sorted(l)
girls = sortedArray[0:n]
boys = sorted(sortedArray[n:n*2])
count = 0
teaB = min(boys)
teaG = teaB/2
while teaB+teaG <= w and w - teaG - teaB > min(boys):
teaB = teaB + min(boys)
teaG = teaG + min(boys)/2
print(teaG + teaB)
|
Title: Pasha and Tea
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha decided to invite his friends to a tea party. For that occasion, he has a large teapot with the capacity of *w* milliliters and 2*n* tea cups, each cup is for one of Pasha's friends. The *i*-th cup can hold at most *a**i* milliliters of water.
It turned out that among Pasha's friends there are exactly *n* boys and exactly *n* girls and all of them are going to come to the tea party. To please everyone, Pasha decided to pour the water for the tea as follows:
- Pasha can boil the teapot exactly once by pouring there at most *w* milliliters of water; - Pasha pours the same amount of water to each girl; - Pasha pours the same amount of water to each boy; - if each girl gets *x* milliliters of water, then each boy gets 2*x* milliliters of water.
In the other words, each boy should get two times more water than each girl does.
Pasha is very kind and polite, so he wants to maximize the total amount of the water that he pours to his friends. Your task is to help him and determine the optimum distribution of cups between Pasha's friends.
Input Specification:
The first line of the input contains two integers, *n* and *w* (1<=≤<=*n*<=≤<=105, 1<=≤<=*w*<=≤<=109) — the number of Pasha's friends that are boys (equal to the number of Pasha's friends that are girls) and the capacity of Pasha's teapot in milliliters.
The second line of the input contains the sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=109, 1<=≤<=*i*<=≤<=2*n*) — the capacities of Pasha's tea cups in milliliters.
Output Specification:
Print a single real number — the maximum total amount of water in milliliters that Pasha can pour to his friends without violating the given conditions. Your answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['2 4\n1 1 1 1\n', '3 18\n4 4 4 2 2 2\n', '1 5\n2 3\n']
Demo Output:
['3', '18', '4.5']
Note:
Pasha also has candies that he is going to give to girls but that is another task...
|
```python
n, w = map(int, input().split())
l = list(map(int, input().split()))
sortedArray = sorted(l)
girls = sortedArray[0:n]
boys = sorted(sortedArray[n:n*2])
count = 0
teaB = min(boys)
teaG = teaB/2
while teaB+teaG <= w and w - teaG - teaB > min(boys):
teaB = teaB + min(boys)
teaG = teaG + min(boys)/2
print(teaG + teaB)
```
| 0
|
|
404
|
A
|
Valera and X
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
|
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
|
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
|
[
"5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n",
"3\nwsw\nsws\nwsw\n",
"3\nxpx\npxp\nxpe\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nwsw\nsws\nwsw",
"output": "YES"
},
{
"input": "3\nxpx\npxp\nxpe",
"output": "NO"
},
{
"input": "5\nliiil\nilili\niilii\nilili\nliiil",
"output": "YES"
},
{
"input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt",
"output": "NO"
},
{
"input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos",
"output": "YES"
},
{
"input": "3\naaa\naaa\naaa",
"output": "NO"
},
{
"input": "3\naca\noec\nzba",
"output": "NO"
},
{
"input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "3\nxxx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxx\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxxx",
"output": "NO"
},
{
"input": "3\nxax\nxxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naaa\nxax",
"output": "NO"
},
{
"input": "3\naax\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxaa\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\naax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaa",
"output": "NO"
},
{
"input": "3\nxfx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\nafa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaf",
"output": "NO"
},
{
"input": "3\nxox\nxxx\nxxx",
"output": "NO"
},
{
"input": "3\naxa\naax\nxxa",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxox",
"output": "NO"
},
{
"input": "3\nxox\nooo\nxox",
"output": "NO"
},
{
"input": "3\naaa\naab\nbbb",
"output": "NO"
},
{
"input": "3\nxxx\nsxs\nxsx",
"output": "NO"
},
{
"input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba",
"output": "NO"
},
{
"input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba",
"output": "NO"
},
{
"input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxxx",
"output": "NO"
},
{
"input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox",
"output": "NO"
},
{
"input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox",
"output": "NO"
},
{
"input": "3\naaa\nbab\naba",
"output": "NO"
}
] | 1,697,511,295
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 0
|
# code.py
n = int(input())
arr = [list(input()) for _ in range(n)]
d1 = ""
d2 = ""
rem = arr[0][n//2]
new_pap = arr
for i in range(n):
d1 += arr[i][i]
d2 += arr[i][n-i-1]
new_pap[i][i] = rem
new_pap[i][n-i-1] = rem
goal_pap = [[rem for _ in range(n)] for _ in range(n)]
cond1 = (d1 == d2)
cond2 = (new_pap == goal_pap)
if (cond1 and cond2):
print("YES")
else:
print("NO")
|
Title: Valera and X
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Output Specification:
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
Demo Input:
['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none
|
```python
# code.py
n = int(input())
arr = [list(input()) for _ in range(n)]
d1 = ""
d2 = ""
rem = arr[0][n//2]
new_pap = arr
for i in range(n):
d1 += arr[i][i]
d2 += arr[i][n-i-1]
new_pap[i][i] = rem
new_pap[i][n-i-1] = rem
goal_pap = [[rem for _ in range(n)] for _ in range(n)]
cond1 = (d1 == d2)
cond2 = (new_pap == goal_pap)
if (cond1 and cond2):
print("YES")
else:
print("NO")
```
| 0
|
|
794
|
B
|
Cutting Carrot
|
PROGRAMMING
| 1,200
|
[
"geometry",
"math"
] | null | null |
Igor the analyst has adopted *n* little bunnies. As we all know, bunnies love carrots. Thus, Igor has bought a carrot to be shared between his bunnies. Igor wants to treat all the bunnies equally, and thus he wants to cut the carrot into *n* pieces of equal area.
Formally, the carrot can be viewed as an isosceles triangle with base length equal to 1 and height equal to *h*. Igor wants to make *n*<=-<=1 cuts parallel to the base to cut the carrot into *n* pieces. He wants to make sure that all *n* pieces have the same area. Can you help Igor determine where to cut the carrot so that each piece have equal area?
|
The first and only line of input contains two space-separated integers, *n* and *h* (2<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=105).
|
The output should contain *n*<=-<=1 real numbers *x*1,<=*x*2,<=...,<=*x**n*<=-<=1. The number *x**i* denotes that the *i*-th cut must be made *x**i* units away from the apex of the carrot. In addition, 0<=<<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=-<=1<=<<=*h* must hold.
Your output will be considered correct if absolute or relative error of every number in your output doesn't exceed 10<=-<=6.
Formally, let your answer be *a*, and the jury's answer be *b*. Your answer is considered correct if .
|
[
"3 2\n",
"2 100000\n"
] |
[
"1.154700538379 1.632993161855\n",
"70710.678118654752\n"
] |
Definition of isosceles triangle: [https://en.wikipedia.org/wiki/Isosceles_triangle](https://en.wikipedia.org/wiki/Isosceles_triangle).
| 1,000
|
[
{
"input": "3 2",
"output": "1.154700538379 1.632993161855"
},
{
"input": "2 100000",
"output": "70710.678118654752"
},
{
"input": "1000 100000",
"output": "3162.277660168379 4472.135954999579 5477.225575051661 6324.555320336759 7071.067811865475 7745.966692414834 8366.600265340755 8944.271909999159 9486.832980505138 10000.000000000000 10488.088481701515 10954.451150103322 11401.754250991380 11832.159566199232 12247.448713915890 12649.110640673517 13038.404810405297 13416.407864998738 13784.048752090222 14142.135623730950 14491.376746189439 14832.396974191326 15165.750888103101 15491.933384829668 15811.388300841897 16124.515496597099 16431.676725154983 16733.2..."
},
{
"input": "2 1",
"output": "0.707106781187"
},
{
"input": "1000 1",
"output": "0.031622776602 0.044721359550 0.054772255751 0.063245553203 0.070710678119 0.077459666924 0.083666002653 0.089442719100 0.094868329805 0.100000000000 0.104880884817 0.109544511501 0.114017542510 0.118321595662 0.122474487139 0.126491106407 0.130384048104 0.134164078650 0.137840487521 0.141421356237 0.144913767462 0.148323969742 0.151657508881 0.154919333848 0.158113883008 0.161245154966 0.164316767252 0.167332005307 0.170293863659 0.173205080757 0.176068168617 0.178885438200 0.181659021246 0.184390889146 0..."
},
{
"input": "20 17",
"output": "3.801315561750 5.375872022286 6.584071688553 7.602631123499 8.500000000000 9.311283477588 10.057335631269 10.751744044572 11.403946685249 12.020815280171 12.607537428063 13.168143377105 13.705838172108 14.223220451079 14.722431864335 15.205262246999 15.673225577398 16.127616066859 16.569550386175"
},
{
"input": "999 1",
"output": "0.031638599858 0.044743737014 0.054799662435 0.063277199717 0.070746059996 0.077498425829 0.083707867056 0.089487474029 0.094915799575 0.100050037531 0.104933364623 0.109599324870 0.114074594073 0.118380800867 0.122535770349 0.126554399434 0.130449289063 0.134231211043 0.137909459498 0.141492119993 0.144986278734 0.148398187395 0.151733394554 0.154996851658 0.158192999292 0.161325838061 0.164398987305 0.167415734111 0.170379074505 0.173291748303 0.176156268782 0.178974948057 0.181749918935 0.184483153795 0..."
},
{
"input": "998 99999",
"output": "3165.413034717700 4476.570044210349 5482.656203071844 6330.826069435401 7078.078722492680 7753.646760213179 8374.895686665300 8953.140088420697 9496.239104153101 10009.914924893578 10498.487342658843 10965.312406143687 11413.059004696742 11843.891063542002 12259.591967329534 12661.652138870802 13051.332290848021 13429.710132631046 13797.715532900862 14156.157444985360 14505.744837393740 14847.103184390411 15180.787616204127 15507.293520426358 15827.065173588502 16140.502832606510 16447.968609215531 16749.7..."
},
{
"input": "574 29184",
"output": "1218.116624752432 1722.677051277028 2109.839883615525 2436.233249504864 2723.791577469041 2983.764177844748 3222.833656968322 3445.354102554056 3654.349874257297 3852.022989934325 4040.035795197963 4219.679767231051 4391.981950040022 4557.775066957079 4717.745401404559 4872.466499009729 5022.423508175150 5168.031153831084 5309.647268742708 5447.583154938083 5582.111638212139 5713.473414041731 5841.882108059006 5967.528355689497 6090.583123762161 6211.200439444432 6329.519650846576 6445.667313936643 6559.75..."
},
{
"input": "2 5713",
"output": "4039.701040918746"
},
{
"input": "937 23565",
"output": "769.834993893392 1088.711089153444 1333.393322867831 1539.669987786784 1721.403377803760 1885.702921177414 2036.791944396843 2177.422178306887 2309.504981680176 2434.432003204934 2553.253825229922 2666.786645735663 2775.679544129132 2880.458791498282 2981.558110676796 3079.339975573568 3174.110994119182 3266.133267460331 3355.632941582547 3442.806755607520 3527.827132142336 3610.846187821139 3691.998931463184 3771.405842354828 3849.174969466960 3925.403656108988 4000.179968603494 4073.583888793686 4145.688..."
},
{
"input": "693 39706",
"output": "1508.306216302128 2133.067107306117 2612.463000007259 3016.612432604256 3372.675230537060 3694.580605808168 3990.603149268227 4266.134214612233 4524.918648906384 4769.683052505315 5002.485788434792 5224.926000014517 5438.275401978402 5643.565095743912 5841.644856719264 6033.224865208513 6218.905845589392 6399.201321918350 6574.554372775177 6745.350461074120 6911.927407376938 7074.583247583148 7233.582498950279 7389.161211616337 7541.531081510641 7690.882829397851 7837.389000021776 7981.206298536455 8122.47..."
},
{
"input": "449 88550",
"output": "4178.932872810542 5909.903544975429 7238.124057127628 8357.865745621084 9344.377977012855 10236.253207728862 11056.417127089408 11819.807089950858 12536.798618431626 13214.946067032045 13859.952363194553 14476.248114255256 15067.356749640443 15636.135052384012 16184.937421313947 16715.731491242168 17230.181636963718 17729.710634926286 18215.546084421264 18688.755954025709 19150.276213793575 19600.932605874766 20041.458005232581 20472.506415457724 20894.664364052710 21308.460264455309 21714.372171382883 221..."
},
{
"input": "642 37394",
"output": "1475.823459881026 2087.129552632132 2556.201215516026 2951.646919762052 3300.041579082908 3615.014427137354 3904.661853880105 4174.259105264265 4427.470379643078 4666.963557534173 4894.752673229489 5112.402431032051 5321.157158133711 5522.025750238117 5715.839682061424 5903.293839524104 6084.976009853978 6261.388657896397 6432.965320127946 6600.083158165816 6763.072717296425 6922.225614943105 7077.800671741869 7230.028854274709 7379.117299405130 7525.252620551370 7668.603646548077 7809.323707760210 7947.55..."
},
{
"input": "961 53535",
"output": "1726.935483870968 2442.255582633666 2991.139999458060 3453.870967741935 3861.545134691976 4230.110754190240 4569.041820575576 4884.511165267332 5180.806451612903 5461.049501197232 5727.597037150849 5982.279998916119 6226.554436514989 6461.600909707837 6688.392369006905 6907.741935483871 7120.337408627144 7326.766747900998 7527.537256208063 7723.090269383951 7913.812575143900 8100.045409746687 8282.091632275692 8460.221508380480 8634.677419354839 8805.677730973862 8973.419998374179 9138.083641151152 9299.83..."
},
{
"input": "4 31901",
"output": "15950.500000000000 22557.413426632053 27627.076406127377"
},
{
"input": "4 23850",
"output": "11925.000000000000 16864.496731299158 20654.705880258862"
},
{
"input": "4 72694",
"output": "36347.000000000000 51402.420351574886 62954.850702705983"
},
{
"input": "4 21538",
"output": "10769.000000000000 15229.665853195861 18652.455146709240"
},
{
"input": "4 70383",
"output": "35191.500000000000 49768.296580252774 60953.465994560145"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "20 1",
"output": "0.223606797750 0.316227766017 0.387298334621 0.447213595500 0.500000000000 0.547722557505 0.591607978310 0.632455532034 0.670820393250 0.707106781187 0.741619848710 0.774596669241 0.806225774830 0.836660026534 0.866025403784 0.894427191000 0.921954445729 0.948683298051 0.974679434481"
},
{
"input": "775 1",
"output": "0.035921060405 0.050800050800 0.062217101684 0.071842120811 0.080321932890 0.087988269013 0.095038192662 0.101600101600 0.107763181216 0.113592366849 0.119136679436 0.124434203368 0.129515225161 0.134404301006 0.139121668728 0.143684241621 0.148106326235 0.152400152400 0.156576272252 0.160643865780 0.164610978351 0.168484707835 0.172271353843 0.175976538026 0.179605302027 0.183162187956 0.186651305051 0.190076385325 0.193440830330 0.196747750735 0.200000000000 0.203200203200 0.206350781829 0.209453975235 0..."
},
{
"input": "531 1",
"output": "0.043396303660 0.061371641193 0.075164602800 0.086792607321 0.097037084957 0.106298800691 0.114815827305 0.122743282386 0.130188910981 0.137231161599 0.143929256529 0.150329205601 0.156467598013 0.162374100149 0.168073161363 0.173585214641 0.178927543753 0.184114923580 0.189160102178 0.194074169913 0.198866846404 0.203546706606 0.208121361089 0.212597601381 0.216981518301 0.221278599182 0.225493808401 0.229631654609 0.233696247231 0.237691344271 0.241620392998 0.245486564773 0.249292785005 0.253041759057 0..."
},
{
"input": "724 1",
"output": "0.037164707312 0.052558833123 0.064371161313 0.074329414625 0.083102811914 0.091034569355 0.098328573097 0.105117666246 0.111494121937 0.117525123681 0.123261389598 0.128742322627 0.133999257852 0.139057601643 0.143938292487 0.148658829249 0.153234013794 0.157676499368 0.161997203441 0.166205623829 0.170310084440 0.174317928887 0.178235674883 0.182069138710 0.185823536562 0.189503567803 0.193113483940 0.196657146194 0.200138073886 0.203559485381 0.206924332929 0.210235332491 0.213494989396 0.216705620524 0..."
},
{
"input": "917 1",
"output": "0.033022909334 0.046701446249 0.057197356781 0.066045818668 0.073841470086 0.080889277691 0.087370405666 0.093402892499 0.099068728003 0.104427608461 0.109524599747 0.114394713561 0.119065792869 0.123560412643 0.127897177895 0.132091637337 0.136156943250 0.140104338748 0.143943524609 0.147682940172 0.151329981692 0.154891174376 0.158372309576 0.161778555382 0.165114546671 0.168384459091 0.171592070342 0.174740811332 0.177833809176 0.180873923568 0.183863777748 0.186805784998 0.189702171441 0.192554995756 0..."
},
{
"input": "458 100",
"output": "4.672693135160 6.608186004551 8.093341918275 9.345386270320 10.448459488214 11.445713905748 12.362783988552 13.216372009102 14.018079405480 14.776353114139 15.497569889795 16.186683836551 16.847634693328 17.483616785299 18.097262694412 18.690772540640 19.266007352363 19.824558013653 20.367797170339 20.896918976429 21.412969991171 21.916873521973 22.409449036367 22.891427811495 23.363465675800 23.826153477212 24.280025754826 24.725567977104 25.163222626003 25.593394344267 26.016454316384 26.432744018204 26...."
}
] | 1,562,591,283
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 109
| 102,400
|
from math import sqrt
n,hn = list(map(int,input().split()))
kn = sqrt(n)
h = hn/kn
for i in range(1,n):
print(h*sqrt(i),end = ' ')
|
Title: Cutting Carrot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Igor the analyst has adopted *n* little bunnies. As we all know, bunnies love carrots. Thus, Igor has bought a carrot to be shared between his bunnies. Igor wants to treat all the bunnies equally, and thus he wants to cut the carrot into *n* pieces of equal area.
Formally, the carrot can be viewed as an isosceles triangle with base length equal to 1 and height equal to *h*. Igor wants to make *n*<=-<=1 cuts parallel to the base to cut the carrot into *n* pieces. He wants to make sure that all *n* pieces have the same area. Can you help Igor determine where to cut the carrot so that each piece have equal area?
Input Specification:
The first and only line of input contains two space-separated integers, *n* and *h* (2<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=105).
Output Specification:
The output should contain *n*<=-<=1 real numbers *x*1,<=*x*2,<=...,<=*x**n*<=-<=1. The number *x**i* denotes that the *i*-th cut must be made *x**i* units away from the apex of the carrot. In addition, 0<=<<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=-<=1<=<<=*h* must hold.
Your output will be considered correct if absolute or relative error of every number in your output doesn't exceed 10<=-<=6.
Formally, let your answer be *a*, and the jury's answer be *b*. Your answer is considered correct if .
Demo Input:
['3 2\n', '2 100000\n']
Demo Output:
['1.154700538379 1.632993161855\n', '70710.678118654752\n']
Note:
Definition of isosceles triangle: [https://en.wikipedia.org/wiki/Isosceles_triangle](https://en.wikipedia.org/wiki/Isosceles_triangle).
|
```python
from math import sqrt
n,hn = list(map(int,input().split()))
kn = sqrt(n)
h = hn/kn
for i in range(1,n):
print(h*sqrt(i),end = ' ')
```
| 3
|
|
883
|
M
|
Quadcopter Competition
|
PROGRAMMING
| 1,100
|
[
"greedy",
"math"
] | null | null |
Polycarp takes part in a quadcopter competition. According to the rules a flying robot should:
- start the race from some point of a field, - go around the flag, - close cycle returning back to the starting point.
Polycarp knows the coordinates of the starting point (*x*1,<=*y*1) and the coordinates of the point where the flag is situated (*x*2,<=*y*2). Polycarp’s quadcopter can fly only parallel to the sides of the field each tick changing exactly one coordinate by 1. It means that in one tick the quadcopter can fly from the point (*x*,<=*y*) to any of four points: (*x*<=-<=1,<=*y*), (*x*<=+<=1,<=*y*), (*x*,<=*y*<=-<=1) or (*x*,<=*y*<=+<=1).
Thus the quadcopter path is a closed cycle starting and finishing in (*x*1,<=*y*1) and containing the point (*x*2,<=*y*2) strictly inside.
What is the minimal length of the quadcopter path?
|
The first line contains two integer numbers *x*1 and *y*1 (<=-<=100<=≤<=*x*1,<=*y*1<=≤<=100) — coordinates of the quadcopter starting (and finishing) point.
The second line contains two integer numbers *x*2 and *y*2 (<=-<=100<=≤<=*x*2,<=*y*2<=≤<=100) — coordinates of the flag.
It is guaranteed that the quadcopter starting point and the flag do not coincide.
|
Print the length of minimal path of the quadcopter to surround the flag and return back.
|
[
"1 5\n5 2\n",
"0 1\n0 0\n"
] |
[
"18\n",
"8\n"
] |
none
| 0
|
[
{
"input": "1 5\n5 2",
"output": "18"
},
{
"input": "0 1\n0 0",
"output": "8"
},
{
"input": "-100 -100\n100 100",
"output": "804"
},
{
"input": "-100 -100\n-100 100",
"output": "406"
},
{
"input": "-100 -100\n100 -100",
"output": "406"
},
{
"input": "100 -100\n-100 -100",
"output": "406"
},
{
"input": "100 -100\n-100 100",
"output": "804"
},
{
"input": "100 -100\n100 100",
"output": "406"
},
{
"input": "-100 100\n-100 -100",
"output": "406"
},
{
"input": "-100 100\n100 -100",
"output": "804"
},
{
"input": "-100 100\n100 100",
"output": "406"
},
{
"input": "100 100\n-100 -100",
"output": "804"
},
{
"input": "100 100\n-100 100",
"output": "406"
},
{
"input": "100 100\n100 -100",
"output": "406"
},
{
"input": "45 -43\n45 -44",
"output": "8"
},
{
"input": "76 76\n75 75",
"output": "8"
},
{
"input": "-34 -56\n-35 -56",
"output": "8"
},
{
"input": "56 -7\n55 -6",
"output": "8"
},
{
"input": "43 -11\n43 -10",
"output": "8"
},
{
"input": "1 -3\n2 -2",
"output": "8"
},
{
"input": "55 71\n56 71",
"output": "8"
},
{
"input": "54 -87\n55 -88",
"output": "8"
},
{
"input": "22 98\n100 33",
"output": "290"
},
{
"input": "37 84\n-83 5",
"output": "402"
},
{
"input": "52 74\n-73 -39",
"output": "480"
},
{
"input": "66 51\n51 -71",
"output": "278"
},
{
"input": "-31 44\n73 86",
"output": "296"
},
{
"input": "-20 34\n-9 55",
"output": "68"
},
{
"input": "-5 19\n-91 -86",
"output": "386"
},
{
"input": "-82 5\n28 -17",
"output": "268"
},
{
"input": "-90 -100\n55 48",
"output": "590"
},
{
"input": "-75 -14\n-32 8",
"output": "134"
},
{
"input": "-53 -28\n-13 -28",
"output": "86"
},
{
"input": "-42 -46\n10 -64",
"output": "144"
},
{
"input": "55 -42\n25 2",
"output": "152"
},
{
"input": "70 -64\n-54 70",
"output": "520"
},
{
"input": "93 -78\n-32 -75",
"output": "260"
},
{
"input": "8 -93\n79 -6",
"output": "320"
},
{
"input": "50 43\n54 10",
"output": "78"
},
{
"input": "65 32\n-37 71",
"output": "286"
},
{
"input": "80 18\n-15 -58",
"output": "346"
},
{
"input": "94 92\n4 -1",
"output": "370"
},
{
"input": "-10 96\n27 64",
"output": "142"
},
{
"input": "-96 78\n-56 32",
"output": "176"
},
{
"input": "-81 64\n-37 -8",
"output": "236"
},
{
"input": "-58 49\n74 -40",
"output": "446"
},
{
"input": "-62 -55\n1 18",
"output": "276"
},
{
"input": "-51 -69\n-78 86",
"output": "368"
},
{
"input": "-29 -80\n-56 -47",
"output": "124"
},
{
"input": "-14 -94\n55 -90",
"output": "150"
},
{
"input": "83 -2\n82 83",
"output": "176"
},
{
"input": "98 -16\n-96 40",
"output": "504"
},
{
"input": "17 -34\n-86 -93",
"output": "328"
},
{
"input": "32 -48\n33 -37",
"output": "28"
},
{
"input": "74 87\n3 92",
"output": "156"
},
{
"input": "89 73\n-80 49",
"output": "390"
},
{
"input": "4 58\n-61 -80",
"output": "410"
},
{
"input": "15 48\n50 -20",
"output": "210"
},
{
"input": "-82 45\n81 46",
"output": "332"
},
{
"input": "-68 26\n-2 6",
"output": "176"
},
{
"input": "-53 4\n-92 -31",
"output": "152"
},
{
"input": "-30 94\n31 -58",
"output": "430"
},
{
"input": "-38 -11\n58 99",
"output": "416"
},
{
"input": "-27 -25\n-28 68",
"output": "192"
},
{
"input": "-5 -39\n-10 -77",
"output": "90"
},
{
"input": "-90 -54\n9 -9",
"output": "292"
},
{
"input": "7 -57\n28 61",
"output": "282"
},
{
"input": "18 -67\n-51 21",
"output": "318"
},
{
"input": "41 -82\n-33 -15",
"output": "286"
},
{
"input": "56 -8\n91 -55",
"output": "168"
},
{
"input": "-23 -13\n-24 -12",
"output": "8"
},
{
"input": "1 32\n1 33",
"output": "8"
},
{
"input": "25 76\n24 76",
"output": "8"
},
{
"input": "-29 -78\n-28 -79",
"output": "8"
},
{
"input": "-77 19\n-76 19",
"output": "8"
},
{
"input": "-53 63\n-53 62",
"output": "8"
},
{
"input": "86 12\n86 11",
"output": "8"
},
{
"input": "14 56\n13 56",
"output": "8"
},
{
"input": "63 41\n62 40",
"output": "8"
},
{
"input": "0 -4\n1 -4",
"output": "8"
},
{
"input": "24 41\n24 42",
"output": "8"
},
{
"input": "48 85\n49 86",
"output": "8"
},
{
"input": "0 0\n0 1",
"output": "8"
},
{
"input": "0 0\n1 0",
"output": "8"
},
{
"input": "0 0\n1 1",
"output": "8"
},
{
"input": "0 1\n0 0",
"output": "8"
},
{
"input": "0 1\n1 0",
"output": "8"
},
{
"input": "0 1\n1 1",
"output": "8"
},
{
"input": "1 0\n0 0",
"output": "8"
},
{
"input": "1 0\n0 1",
"output": "8"
},
{
"input": "1 0\n1 1",
"output": "8"
},
{
"input": "1 1\n0 0",
"output": "8"
},
{
"input": "1 1\n0 1",
"output": "8"
},
{
"input": "1 1\n1 0",
"output": "8"
},
{
"input": "100 100\n99 -100",
"output": "406"
},
{
"input": "100 100\n-100 99",
"output": "406"
},
{
"input": "-100 -100\n-99 100",
"output": "406"
},
{
"input": "-100 -100\n100 -99",
"output": "406"
},
{
"input": "0 0\n1 2",
"output": "10"
},
{
"input": "0 0\n2 1",
"output": "10"
}
] | 1,578,112,523
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 100
| 155
| 0
|
a, b = map(int, input().split())
c, d = map(int, input().split())
print((max(2, abs(a - c) + 1) + max(2, abs(b - d) + 1)) * 2)
|
Title: Quadcopter Competition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp takes part in a quadcopter competition. According to the rules a flying robot should:
- start the race from some point of a field, - go around the flag, - close cycle returning back to the starting point.
Polycarp knows the coordinates of the starting point (*x*1,<=*y*1) and the coordinates of the point where the flag is situated (*x*2,<=*y*2). Polycarp’s quadcopter can fly only parallel to the sides of the field each tick changing exactly one coordinate by 1. It means that in one tick the quadcopter can fly from the point (*x*,<=*y*) to any of four points: (*x*<=-<=1,<=*y*), (*x*<=+<=1,<=*y*), (*x*,<=*y*<=-<=1) or (*x*,<=*y*<=+<=1).
Thus the quadcopter path is a closed cycle starting and finishing in (*x*1,<=*y*1) and containing the point (*x*2,<=*y*2) strictly inside.
What is the minimal length of the quadcopter path?
Input Specification:
The first line contains two integer numbers *x*1 and *y*1 (<=-<=100<=≤<=*x*1,<=*y*1<=≤<=100) — coordinates of the quadcopter starting (and finishing) point.
The second line contains two integer numbers *x*2 and *y*2 (<=-<=100<=≤<=*x*2,<=*y*2<=≤<=100) — coordinates of the flag.
It is guaranteed that the quadcopter starting point and the flag do not coincide.
Output Specification:
Print the length of minimal path of the quadcopter to surround the flag and return back.
Demo Input:
['1 5\n5 2\n', '0 1\n0 0\n']
Demo Output:
['18\n', '8\n']
Note:
none
|
```python
a, b = map(int, input().split())
c, d = map(int, input().split())
print((max(2, abs(a - c) + 1) + max(2, abs(b - d) + 1)) * 2)
```
| 3
|
|
544
|
A
|
Set of Strings
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct.
Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist.
|
The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence.
The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive.
|
If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*.
If there are multiple possible answers, print any of them.
|
[
"1\nabca\n",
"2\naaacas\n",
"4\nabc\n"
] |
[
"YES\nabca\n",
"YES\naaa\ncas\n",
"NO\n"
] |
In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}.
| 500
|
[
{
"input": "1\nabca",
"output": "YES\nabca"
},
{
"input": "2\naaacas",
"output": "YES\naaa\ncas"
},
{
"input": "4\nabc",
"output": "NO"
},
{
"input": "3\nnddkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk",
"output": "YES\nn\ndd\nkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk"
},
{
"input": "26\nbiibfmmfifmffbmmfmbmbmiimbmiffmffibibfbiffibibiiimbffbbfbifmiibffbmbbbfmfibmibfffibfbffmfmimbmmmfmfm",
"output": "NO"
},
{
"input": "3\nkydoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia",
"output": "YES\nk\ny\ndoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia"
},
{
"input": "3\nssussususskkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus",
"output": "YES\nss\nussususs\nkkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus"
},
{
"input": "5\naaaaabcdef",
"output": "YES\naaaaa\nb\nc\nd\nef"
},
{
"input": "3\niiiiiiimiriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc",
"output": "YES\niiiiiii\nmi\nriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc"
},
{
"input": "20\ngggggllglgllltgtlglttstsgtttsslhhlssghgagtlsaghhoggtfgsaahtotdodthfltdxggxislnttlanxonhnkddtigppitdh",
"output": "NO"
},
{
"input": "16\nkkkkkkyykkynkknkkonyokdndkyonokdywkwykdkdotknnwzkoywiooinkcyzyntcdnitnppnpziomyzdspomoqmomcyrrospppn",
"output": "NO"
},
{
"input": "15\nwwwgggowgwwhoohwgwghwyohhggywhyyodgwydwgggkhgyydqyggkgkpokgthqghidhworprodtcogqkwgtfiodwdurcctkmrfmh",
"output": "YES\nwww\nggg\nowgww\nhoohwgwghw\nyohhggywhyyo\ndgwydwggg\nkhgyyd\nqyggkgk\npokg\nthqgh\nidhwo\nrprodt\ncogqkwgt\nfiodwd\nurcctkmrfmh"
},
{
"input": "15\nnnnnnntnttttttqqnqqynnqqwwnnnwneenhwtyhhoqeyeqyeuthwtnhtpnphhwetjhouhwnpojvvovoswwjryrwerbwwpbvrwvjj",
"output": "YES\nnnnnnn\ntntttttt\nqqnqq\nynnqq\nwwnnnwn\neen\nhwtyhh\noqeyeqye\nuthwtnht\npnphhwet\njhouhwnpoj\nvvovo\nswwj\nryrwer\nbwwpbvrwvjj"
},
{
"input": "15\nvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "1\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai",
"output": "YES\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai"
},
{
"input": "26\nvvvnnsnnnpsnnswwspncvshtncwphaphmwnwkhvvhuvctvnehemowkmtzissswjaxuuvphzrmfzihamdqmmyhhijbitlipgltyy",
"output": "YES\nvvv\nnn\nsnnn\npsnns\nwwspn\ncvs\nh\ntncwph\naph\nmwnw\nkhvvh\nuvctvn\nehem\nowkmt\nz\nisssw\nja\nxuuvphz\nrm\nfziham\nd\nqmm\nyhhij\nbit\nlip\ngltyy"
},
{
"input": "26\njexzsbwaih",
"output": "NO"
},
{
"input": "1\nk",
"output": "YES\nk"
},
{
"input": "1\nzz",
"output": "YES\nzz"
},
{
"input": "3\nziw",
"output": "YES\nz\ni\nw"
},
{
"input": "26\ntjmbyqwuahlixegopkzrfndcsv",
"output": "YES\nt\nj\nm\nb\ny\nq\nw\nu\na\nh\nl\ni\nx\ne\ng\no\np\nk\nz\nr\nf\nn\nd\nc\ns\nv"
},
{
"input": "25\nvobekscyadzqwnjxruplifmthg",
"output": "YES\nv\no\nb\ne\nk\ns\nc\ny\na\nd\nz\nq\nw\nn\nj\nx\nr\nu\np\nl\ni\nf\nm\nt\nhg"
},
{
"input": "26\nlllplzkkzflzflffzznnnnfgflqlttlmtnkzlztskngyymitqagattkdllyutzimsrskpapcmuupjdopxqlnhqcscwvdtxbflefy",
"output": "YES\nlll\npl\nz\nkkz\nflzflffzz\nnnnnf\ngfl\nql\nttl\nmtnkzlzt\nskng\nyym\nitq\nagattk\ndlly\nutzims\nrskpap\ncmuup\njd\nop\nxqln\nhqcsc\nw\nvdtx\nbfl\nefy"
},
{
"input": "25\nkkrrkrkrkrsrskpskbrppdsdbgbkrbllkbswdwcchgskmkhwiidicczlscsodtjglxbmeotzxnmbjmoqgkquglaoxgcykxvbhdi",
"output": "YES\nkk\nrrkrkrkr\nsrsk\npsk\nbrpp\ndsdb\ngbkrb\nllkbs\nwdw\ncc\nhgsk\nmkhw\niidicc\nzlscs\nod\nt\njgl\nxbm\neotzx\nnmbjmo\nqgkq\nugl\naoxgc\nykx\nvbhdi"
},
{
"input": "25\nuuuuuccpucubccbupxubcbpujiliwbpqbpyiweuywaxwqasbsllwehceruytjvphytraawgbjmerfeymoayujqranlvkpkiypadr",
"output": "YES\nuuuuu\ncc\npucu\nbccbup\nxubcbpu\nj\ni\nli\nwbp\nqbp\nyiw\neuyw\naxwqa\nsbsllwe\nhce\nruy\ntj\nvphytraaw\ngbj\nmer\nfeym\noayujqra\nnlv\nkpkiypa\ndr"
},
{
"input": "26\nxxjxodrogovufvohrodliretxxyjqnrbzmicorptkjafiwmsbwml",
"output": "YES\nxx\njx\no\nd\nro\ngo\nv\nu\nfvo\nhrod\nl\nir\ne\ntxx\nyj\nq\nnr\nb\nz\nmi\ncor\npt\nkj\nafi\nwm\nsbwml"
},
{
"input": "26\npjhsxjbvkqntwmsdnrguecaofylzti",
"output": "YES\np\nj\nh\ns\nxj\nb\nv\nk\nq\nn\nt\nw\nms\ndn\nr\ng\nu\ne\nc\na\no\nf\ny\nl\nzt\ni"
},
{
"input": "25\nrrrrqqwrlqrwglrlylwhrrwyvrhvzgvqahrhgsvavtggyduayivxzgeicinlnrkapoepbsfyjjrt",
"output": "YES\nrrrr\nqq\nwr\nlqrw\nglrl\nylw\nhrrwy\nvrhv\nzgvq\nahrhg\nsvav\ntggy\nd\nuay\niv\nxzg\nei\nci\nnlnr\nka\np\noep\nbs\nfy\njjrt"
},
{
"input": "26\ncccccccaacwwaxxaacczacnnnqqwnaggzqrwagcnabxnrcvgjqjamqzgdntzanaxvjfwqlvdttuzjoxiwtkqvrydospmpeirhg",
"output": "YES\nccccccc\naac\nwwa\nxxaacc\nzac\nnnn\nqqwna\nggzq\nrwagcna\nbxnrc\nvg\njqja\nmqzg\ndn\ntzanaxvj\nfwq\nlvdtt\nuzj\nox\niwt\nkqvr\nydo\ns\npmp\neir\nhg"
},
{
"input": "4\nsssssssssssssssssssssssssslsslslsllsslssslslssllaaslsaalsasaassllasasalrlrslarlaarlsrsaslasarlr",
"output": "YES\nssssssssssssssssssssssssss\nlsslslsllsslssslslssll\naaslsaalsasaassllasasal\nrlrslarlaarlsrsaslasarlr"
},
{
"input": "26\na",
"output": "NO"
},
{
"input": "26\nab",
"output": "NO"
},
{
"input": "2\nab",
"output": "YES\na\nb"
}
] | 1,503,457,145
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 31
| 0
|
k=int(input())
s=input()
if(k>len(s)):
print("NO")
else:
print("YES")
for i in range(k-1):
print(s[i])
print(s[k-1:])
|
Title: Set of Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct.
Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist.
Input Specification:
The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence.
The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive.
Output Specification:
If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*.
If there are multiple possible answers, print any of them.
Demo Input:
['1\nabca\n', '2\naaacas\n', '4\nabc\n']
Demo Output:
['YES\nabca\n', 'YES\naaa\ncas\n', 'NO\n']
Note:
In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}.
|
```python
k=int(input())
s=input()
if(k>len(s)):
print("NO")
else:
print("YES")
for i in range(k-1):
print(s[i])
print(s[k-1:])
```
| 0
|
|
585
|
A
|
Gennady the Dentist
|
PROGRAMMING
| 1,800
|
[
"brute force",
"implementation"
] | null | null |
Gennady is one of the best child dentists in Berland. Today *n* children got an appointment with him, they lined up in front of his office.
All children love to cry loudly at the reception at the dentist. We enumerate the children with integers from 1 to *n* in the order they go in the line. Every child is associated with the value of his cofidence *p**i*. The children take turns one after another to come into the office; each time the child that is the first in the line goes to the doctor.
While Gennady treats the teeth of the *i*-th child, the child is crying with the volume of *v**i*. At that the confidence of the first child in the line is reduced by the amount of *v**i*, the second one — by value *v**i*<=-<=1, and so on. The children in the queue after the *v**i*-th child almost do not hear the crying, so their confidence remains unchanged.
If at any point in time the confidence of the *j*-th child is less than zero, he begins to cry with the volume of *d**j* and leaves the line, running towards the exit, without going to the doctor's office. At this the confidence of all the children after the *j*-th one in the line is reduced by the amount of *d**j*.
All these events occur immediately one after the other in some order. Some cries may lead to other cries, causing a chain reaction. Once in the hallway it is quiet, the child, who is first in the line, goes into the doctor's office.
Help Gennady the Dentist to determine the numbers of kids, whose teeth he will cure. Print their numbers in the chronological order.
|
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=4000) — the number of kids in the line.
Next *n* lines contain three integers each *v**i*,<=*d**i*,<=*p**i* (1<=≤<=*v**i*,<=*d**i*,<=*p**i*<=≤<=106) — the volume of the cry in the doctor's office, the volume of the cry in the hall and the confidence of the *i*-th child.
|
In the first line print number *k* — the number of children whose teeth Gennady will cure.
In the second line print *k* integers — the numbers of the children who will make it to the end of the line in the increasing order.
|
[
"5\n4 2 2\n4 1 2\n5 2 4\n3 3 5\n5 1 2\n",
"5\n4 5 1\n5 3 9\n4 1 2\n2 1 8\n4 1 9\n"
] |
[
"2\n1 3 ",
"4\n1 2 4 5 "
] |
In the first example, Gennady first treats the teeth of the first child who will cry with volume 4. The confidences of the remaining children will get equal to - 2, 1, 3, 1, respectively. Thus, the second child also cries at the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 0, 2, 0. Then the third child will go to the office, and cry with volume 5. The other children won't bear this, and with a loud cry they will run to the exit.
In the second sample, first the first child goes into the office, he will cry with volume 4. The confidence of the remaining children will be equal to 5, - 1, 6, 8. Thus, the third child will cry with the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 5, 5, 7. After that, the second child goes to the office and cry with the volume of 5. The confidences of the remaining children will be equal to 0, 3. Then the fourth child will go into the office and cry with the volume of 2. Because of this the confidence of the fifth child will be 1, and he will go into the office last.
| 500
|
[
{
"input": "5\n4 2 2\n4 1 2\n5 2 4\n3 3 5\n5 1 2",
"output": "2\n1 3 "
},
{
"input": "5\n4 5 1\n5 3 9\n4 1 2\n2 1 8\n4 1 9",
"output": "4\n1 2 4 5 "
},
{
"input": "10\n10 7 10\n3 6 11\n8 4 10\n10 1 11\n7 3 13\n7 2 13\n7 6 14\n3 4 17\n9 4 20\n5 2 24",
"output": "3\n1 2 5 "
},
{
"input": "10\n5 6 3\n7 4 10\n9 1 17\n2 8 23\n9 10 24\n6 8 18\n3 2 35\n7 6 6\n1 3 12\n9 9 5",
"output": "6\n1 2 3 4 5 7 "
},
{
"input": "10\n4 9 1\n8 2 14\n7 10 20\n6 9 18\n5 3 19\n2 9 7\n6 8 30\n8 7 38\n6 5 5\n6 9 37",
"output": "8\n1 2 3 4 5 7 8 10 "
},
{
"input": "10\n10 3 3\n8 6 17\n9 5 26\n10 7 17\n3 10 29\n3 1 27\n3 3 7\n8 10 28\n1 3 23\n3 4 6",
"output": "5\n1 2 3 5 8 "
},
{
"input": "10\n5 6 1\n9 2 6\n4 1 5\n4 10 5\n1 8 23\n9 4 21\n3 9 6\n7 8 34\n7 4 24\n8 9 21",
"output": "5\n1 2 5 6 8 "
},
{
"input": "4\n2 10 1\n1 2 2\n2 1 1\n5 5 1",
"output": "3\n1 2 4 "
},
{
"input": "1\n1 1 1",
"output": "1\n1 "
},
{
"input": "2\n5 1 1\n1 1 5",
"output": "2\n1 2 "
},
{
"input": "2\n5 1 1\n1 1 4",
"output": "1\n1 "
},
{
"input": "2\n5 1 1\n1 1 6",
"output": "2\n1 2 "
},
{
"input": "3\n5 1 1\n1 1 4\n1 1 4",
"output": "1\n1 "
},
{
"input": "3\n5 1 1\n1 1 4\n1 1 5",
"output": "2\n1 3 "
},
{
"input": "3\n5 1 1\n1 1 5\n1 1 3",
"output": "2\n1 2 "
},
{
"input": "3\n5 1 1\n10 1 5\n1000 1000 14",
"output": "3\n1 2 3 "
},
{
"input": "10\n9 8 8\n2 9 33\n10 7 42\n7 2 18\n3 5 82\n9 9 25\n3 2 86\n3 5 49\n5 3 72\n4 4 71",
"output": "10\n1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10\n9 8 8\n2 9 8\n10 7 16\n7 2 9\n3 5 23\n9 9 25\n3 2 35\n3 5 36\n5 3 40\n4 4 42",
"output": "1\n1 "
}
] | 1,460,090,635
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 11
| 62
| 5,120,000
|
n=int(input())
Child=[]
ind=[1]*n
Output=[1]
for i in range(n) :
Child.append(list(map(int,input().split())))
def cry(Vol,Position) :
V=[Vol]
s=Vol
global Output
while Position<n :
#print(Position,V,s)
if ind[Position]==0 : Position+=1;continue
Child[Position][2]-=s
t=[]
for i in range(len(V)) :
if V[i] :
s-=1
if V[i]-1 :
t.append(V[i]-1)
if Child[Position][2]<0 :
ind[Position]=0
s+=Child[Position][1]
else :
Output.append(Position+1)
t.append(Child[Position][0])
s+=Child[Position][0]
V=t
Position+=1
cry(Child[0][0],1)
print(len(Output))
print(" ".join(map(str,Output)))
|
Title: Gennady the Dentist
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gennady is one of the best child dentists in Berland. Today *n* children got an appointment with him, they lined up in front of his office.
All children love to cry loudly at the reception at the dentist. We enumerate the children with integers from 1 to *n* in the order they go in the line. Every child is associated with the value of his cofidence *p**i*. The children take turns one after another to come into the office; each time the child that is the first in the line goes to the doctor.
While Gennady treats the teeth of the *i*-th child, the child is crying with the volume of *v**i*. At that the confidence of the first child in the line is reduced by the amount of *v**i*, the second one — by value *v**i*<=-<=1, and so on. The children in the queue after the *v**i*-th child almost do not hear the crying, so their confidence remains unchanged.
If at any point in time the confidence of the *j*-th child is less than zero, he begins to cry with the volume of *d**j* and leaves the line, running towards the exit, without going to the doctor's office. At this the confidence of all the children after the *j*-th one in the line is reduced by the amount of *d**j*.
All these events occur immediately one after the other in some order. Some cries may lead to other cries, causing a chain reaction. Once in the hallway it is quiet, the child, who is first in the line, goes into the doctor's office.
Help Gennady the Dentist to determine the numbers of kids, whose teeth he will cure. Print their numbers in the chronological order.
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=4000) — the number of kids in the line.
Next *n* lines contain three integers each *v**i*,<=*d**i*,<=*p**i* (1<=≤<=*v**i*,<=*d**i*,<=*p**i*<=≤<=106) — the volume of the cry in the doctor's office, the volume of the cry in the hall and the confidence of the *i*-th child.
Output Specification:
In the first line print number *k* — the number of children whose teeth Gennady will cure.
In the second line print *k* integers — the numbers of the children who will make it to the end of the line in the increasing order.
Demo Input:
['5\n4 2 2\n4 1 2\n5 2 4\n3 3 5\n5 1 2\n', '5\n4 5 1\n5 3 9\n4 1 2\n2 1 8\n4 1 9\n']
Demo Output:
['2\n1 3 ', '4\n1 2 4 5 ']
Note:
In the first example, Gennady first treats the teeth of the first child who will cry with volume 4. The confidences of the remaining children will get equal to - 2, 1, 3, 1, respectively. Thus, the second child also cries at the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 0, 2, 0. Then the third child will go to the office, and cry with volume 5. The other children won't bear this, and with a loud cry they will run to the exit.
In the second sample, first the first child goes into the office, he will cry with volume 4. The confidence of the remaining children will be equal to 5, - 1, 6, 8. Thus, the third child will cry with the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 5, 5, 7. After that, the second child goes to the office and cry with the volume of 5. The confidences of the remaining children will be equal to 0, 3. Then the fourth child will go into the office and cry with the volume of 2. Because of this the confidence of the fifth child will be 1, and he will go into the office last.
|
```python
n=int(input())
Child=[]
ind=[1]*n
Output=[1]
for i in range(n) :
Child.append(list(map(int,input().split())))
def cry(Vol,Position) :
V=[Vol]
s=Vol
global Output
while Position<n :
#print(Position,V,s)
if ind[Position]==0 : Position+=1;continue
Child[Position][2]-=s
t=[]
for i in range(len(V)) :
if V[i] :
s-=1
if V[i]-1 :
t.append(V[i]-1)
if Child[Position][2]<0 :
ind[Position]=0
s+=Child[Position][1]
else :
Output.append(Position+1)
t.append(Child[Position][0])
s+=Child[Position][0]
V=t
Position+=1
cry(Child[0][0],1)
print(len(Output))
print(" ".join(map(str,Output)))
```
| 0
|
|
770
|
B
|
Maximize Sum of Digits
|
PROGRAMMING
| 1,300
|
[
"*special",
"implementation",
"math"
] | null | null |
Anton has the integer *x*. He is interested what positive integer, which doesn't exceed *x*, has the maximum sum of digits.
Your task is to help Anton and to find the integer that interests him. If there are several such integers, determine the biggest of them.
|
The first line contains the positive integer *x* (1<=≤<=*x*<=≤<=1018) — the integer which Anton has.
|
Print the positive integer which doesn't exceed *x* and has the maximum sum of digits. If there are several such integers, print the biggest of them. Printed integer must not contain leading zeros.
|
[
"100\n",
"48\n",
"521\n"
] |
[
"99\n",
"48\n",
"499\n"
] |
none
| 1,000
|
[
{
"input": "100",
"output": "99"
},
{
"input": "48",
"output": "48"
},
{
"input": "521",
"output": "499"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "3"
},
{
"input": "39188",
"output": "38999"
},
{
"input": "5",
"output": "5"
},
{
"input": "6",
"output": "6"
},
{
"input": "7",
"output": "7"
},
{
"input": "8",
"output": "8"
},
{
"input": "9",
"output": "9"
},
{
"input": "10",
"output": "9"
},
{
"input": "59999154",
"output": "59998999"
},
{
"input": "1000",
"output": "999"
},
{
"input": "10000",
"output": "9999"
},
{
"input": "100000",
"output": "99999"
},
{
"input": "1000000",
"output": "999999"
},
{
"input": "10000000",
"output": "9999999"
},
{
"input": "100000000",
"output": "99999999"
},
{
"input": "1000000000",
"output": "999999999"
},
{
"input": "10000000000",
"output": "9999999999"
},
{
"input": "100000000000",
"output": "99999999999"
},
{
"input": "1000000000000",
"output": "999999999999"
},
{
"input": "10000000000000",
"output": "9999999999999"
},
{
"input": "100000000000000",
"output": "99999999999999"
},
{
"input": "1000000000000000",
"output": "999999999999999"
},
{
"input": "10000000000000000",
"output": "9999999999999999"
},
{
"input": "100000000000000000",
"output": "99999999999999999"
},
{
"input": "1000000000000000000",
"output": "999999999999999999"
},
{
"input": "999999990",
"output": "999999989"
},
{
"input": "666666899789879",
"output": "599999999999999"
},
{
"input": "65499992294999000",
"output": "59999999999999999"
},
{
"input": "9879100000000099",
"output": "8999999999999999"
},
{
"input": "9991919190909919",
"output": "9989999999999999"
},
{
"input": "978916546899999999",
"output": "899999999999999999"
},
{
"input": "5684945999999999",
"output": "4999999999999999"
},
{
"input": "999999999999999999",
"output": "999999999999999999"
},
{
"input": "999999999999990999",
"output": "999999999999989999"
},
{
"input": "999999999999999990",
"output": "999999999999999989"
},
{
"input": "909999999999999999",
"output": "899999999999999999"
},
{
"input": "199999999999999999",
"output": "199999999999999999"
},
{
"input": "299999999999999999",
"output": "299999999999999999"
},
{
"input": "999999990009999999",
"output": "999999989999999999"
},
{
"input": "999000000001999999",
"output": "998999999999999999"
},
{
"input": "999999999991",
"output": "999999999989"
},
{
"input": "999999999992",
"output": "999999999989"
},
{
"input": "79320",
"output": "78999"
},
{
"input": "99004",
"output": "98999"
},
{
"input": "99088",
"output": "98999"
},
{
"input": "99737",
"output": "98999"
},
{
"input": "29652",
"output": "28999"
},
{
"input": "59195",
"output": "58999"
},
{
"input": "19930",
"output": "19899"
},
{
"input": "49533",
"output": "48999"
},
{
"input": "69291",
"output": "68999"
},
{
"input": "59452",
"output": "58999"
},
{
"input": "11",
"output": "9"
},
{
"input": "110",
"output": "99"
},
{
"input": "111",
"output": "99"
},
{
"input": "119",
"output": "99"
},
{
"input": "118",
"output": "99"
},
{
"input": "1100",
"output": "999"
},
{
"input": "1199",
"output": "999"
},
{
"input": "1109",
"output": "999"
},
{
"input": "1190",
"output": "999"
},
{
"input": "12",
"output": "9"
},
{
"input": "120",
"output": "99"
},
{
"input": "121",
"output": "99"
},
{
"input": "129",
"output": "99"
},
{
"input": "128",
"output": "99"
},
{
"input": "1200",
"output": "999"
},
{
"input": "1299",
"output": "999"
},
{
"input": "1209",
"output": "999"
},
{
"input": "1290",
"output": "999"
},
{
"input": "13",
"output": "9"
},
{
"input": "130",
"output": "99"
},
{
"input": "131",
"output": "99"
},
{
"input": "139",
"output": "99"
},
{
"input": "138",
"output": "99"
},
{
"input": "1300",
"output": "999"
},
{
"input": "1399",
"output": "999"
},
{
"input": "1309",
"output": "999"
},
{
"input": "1390",
"output": "999"
},
{
"input": "14",
"output": "9"
},
{
"input": "140",
"output": "99"
},
{
"input": "141",
"output": "99"
},
{
"input": "149",
"output": "99"
},
{
"input": "148",
"output": "99"
},
{
"input": "1400",
"output": "999"
},
{
"input": "1499",
"output": "999"
},
{
"input": "1409",
"output": "999"
},
{
"input": "1490",
"output": "999"
},
{
"input": "15",
"output": "9"
},
{
"input": "150",
"output": "99"
},
{
"input": "151",
"output": "99"
},
{
"input": "159",
"output": "99"
},
{
"input": "158",
"output": "99"
},
{
"input": "1500",
"output": "999"
},
{
"input": "1599",
"output": "999"
},
{
"input": "1509",
"output": "999"
},
{
"input": "1590",
"output": "999"
},
{
"input": "16",
"output": "9"
},
{
"input": "160",
"output": "99"
},
{
"input": "161",
"output": "99"
},
{
"input": "169",
"output": "99"
},
{
"input": "168",
"output": "99"
},
{
"input": "1600",
"output": "999"
},
{
"input": "1699",
"output": "999"
},
{
"input": "1609",
"output": "999"
},
{
"input": "1690",
"output": "999"
},
{
"input": "17",
"output": "9"
},
{
"input": "170",
"output": "99"
},
{
"input": "171",
"output": "99"
},
{
"input": "179",
"output": "99"
},
{
"input": "178",
"output": "99"
},
{
"input": "1700",
"output": "999"
},
{
"input": "1799",
"output": "999"
},
{
"input": "1709",
"output": "999"
},
{
"input": "1790",
"output": "999"
},
{
"input": "18",
"output": "18"
},
{
"input": "180",
"output": "99"
},
{
"input": "181",
"output": "99"
},
{
"input": "189",
"output": "189"
},
{
"input": "188",
"output": "99"
},
{
"input": "1800",
"output": "999"
},
{
"input": "1899",
"output": "1899"
},
{
"input": "1809",
"output": "999"
},
{
"input": "1890",
"output": "999"
},
{
"input": "19",
"output": "19"
},
{
"input": "190",
"output": "189"
},
{
"input": "191",
"output": "189"
},
{
"input": "199",
"output": "199"
},
{
"input": "198",
"output": "198"
},
{
"input": "1900",
"output": "1899"
},
{
"input": "1999",
"output": "1999"
},
{
"input": "1909",
"output": "1899"
},
{
"input": "1990",
"output": "1989"
},
{
"input": "20",
"output": "19"
},
{
"input": "200",
"output": "199"
},
{
"input": "201",
"output": "199"
},
{
"input": "209",
"output": "199"
},
{
"input": "208",
"output": "199"
},
{
"input": "2000",
"output": "1999"
},
{
"input": "2099",
"output": "1999"
},
{
"input": "2009",
"output": "1999"
},
{
"input": "2090",
"output": "1999"
},
{
"input": "21",
"output": "19"
},
{
"input": "210",
"output": "199"
},
{
"input": "211",
"output": "199"
},
{
"input": "219",
"output": "199"
},
{
"input": "218",
"output": "199"
},
{
"input": "2100",
"output": "1999"
},
{
"input": "2199",
"output": "1999"
},
{
"input": "2109",
"output": "1999"
},
{
"input": "2190",
"output": "1999"
},
{
"input": "22",
"output": "19"
},
{
"input": "220",
"output": "199"
},
{
"input": "221",
"output": "199"
},
{
"input": "229",
"output": "199"
},
{
"input": "228",
"output": "199"
},
{
"input": "2200",
"output": "1999"
},
{
"input": "2299",
"output": "1999"
},
{
"input": "2209",
"output": "1999"
},
{
"input": "2290",
"output": "1999"
},
{
"input": "23",
"output": "19"
},
{
"input": "230",
"output": "199"
},
{
"input": "231",
"output": "199"
},
{
"input": "239",
"output": "199"
},
{
"input": "238",
"output": "199"
},
{
"input": "2300",
"output": "1999"
},
{
"input": "2399",
"output": "1999"
},
{
"input": "2309",
"output": "1999"
},
{
"input": "2390",
"output": "1999"
},
{
"input": "24",
"output": "19"
},
{
"input": "240",
"output": "199"
},
{
"input": "241",
"output": "199"
},
{
"input": "249",
"output": "199"
},
{
"input": "248",
"output": "199"
},
{
"input": "2400",
"output": "1999"
},
{
"input": "2499",
"output": "1999"
},
{
"input": "2409",
"output": "1999"
},
{
"input": "2490",
"output": "1999"
},
{
"input": "25",
"output": "19"
},
{
"input": "250",
"output": "199"
},
{
"input": "251",
"output": "199"
},
{
"input": "259",
"output": "199"
},
{
"input": "258",
"output": "199"
},
{
"input": "2500",
"output": "1999"
},
{
"input": "2599",
"output": "1999"
},
{
"input": "2509",
"output": "1999"
},
{
"input": "2590",
"output": "1999"
},
{
"input": "26",
"output": "19"
},
{
"input": "260",
"output": "199"
},
{
"input": "261",
"output": "199"
},
{
"input": "269",
"output": "199"
},
{
"input": "268",
"output": "199"
},
{
"input": "2600",
"output": "1999"
},
{
"input": "2699",
"output": "1999"
},
{
"input": "2609",
"output": "1999"
},
{
"input": "2690",
"output": "1999"
},
{
"input": "27",
"output": "19"
},
{
"input": "270",
"output": "199"
},
{
"input": "271",
"output": "199"
},
{
"input": "279",
"output": "199"
},
{
"input": "278",
"output": "199"
},
{
"input": "2700",
"output": "1999"
},
{
"input": "2799",
"output": "1999"
},
{
"input": "2709",
"output": "1999"
},
{
"input": "2790",
"output": "1999"
},
{
"input": "28",
"output": "28"
},
{
"input": "280",
"output": "199"
},
{
"input": "281",
"output": "199"
},
{
"input": "289",
"output": "289"
},
{
"input": "288",
"output": "199"
},
{
"input": "2800",
"output": "1999"
},
{
"input": "2899",
"output": "2899"
},
{
"input": "2809",
"output": "1999"
},
{
"input": "2890",
"output": "1999"
},
{
"input": "29",
"output": "29"
},
{
"input": "290",
"output": "289"
},
{
"input": "291",
"output": "289"
},
{
"input": "299",
"output": "299"
},
{
"input": "298",
"output": "298"
},
{
"input": "2900",
"output": "2899"
},
{
"input": "2999",
"output": "2999"
},
{
"input": "2909",
"output": "2899"
},
{
"input": "2990",
"output": "2989"
},
{
"input": "999",
"output": "999"
},
{
"input": "999",
"output": "999"
},
{
"input": "890",
"output": "889"
},
{
"input": "995",
"output": "989"
},
{
"input": "999",
"output": "999"
},
{
"input": "989",
"output": "989"
},
{
"input": "999",
"output": "999"
},
{
"input": "999",
"output": "999"
},
{
"input": "991",
"output": "989"
},
{
"input": "999",
"output": "999"
},
{
"input": "9929",
"output": "9899"
},
{
"input": "4999",
"output": "4999"
},
{
"input": "9690",
"output": "8999"
},
{
"input": "8990",
"output": "8989"
},
{
"input": "9982",
"output": "9899"
},
{
"input": "9999",
"output": "9999"
},
{
"input": "1993",
"output": "1989"
},
{
"input": "9367",
"output": "8999"
},
{
"input": "8939",
"output": "8899"
},
{
"input": "9899",
"output": "9899"
},
{
"input": "99999",
"output": "99999"
},
{
"input": "93929",
"output": "89999"
},
{
"input": "99999",
"output": "99999"
},
{
"input": "38579",
"output": "29999"
},
{
"input": "79096",
"output": "78999"
},
{
"input": "72694",
"output": "69999"
},
{
"input": "99999",
"output": "99999"
},
{
"input": "99999",
"output": "99999"
},
{
"input": "99992",
"output": "99989"
},
{
"input": "27998",
"output": "19999"
},
{
"input": "460999",
"output": "399999"
},
{
"input": "999999",
"output": "999999"
},
{
"input": "999999",
"output": "999999"
},
{
"input": "998999",
"output": "998999"
},
{
"input": "999999",
"output": "999999"
},
{
"input": "999929",
"output": "999899"
},
{
"input": "999999",
"output": "999999"
},
{
"input": "999999",
"output": "999999"
},
{
"input": "979199",
"output": "899999"
},
{
"input": "999999",
"output": "999999"
},
{
"input": "9899999",
"output": "9899999"
},
{
"input": "9699959",
"output": "8999999"
},
{
"input": "9999999",
"output": "9999999"
},
{
"input": "9997099",
"output": "9989999"
},
{
"input": "8992091",
"output": "8989999"
},
{
"input": "9599295",
"output": "8999999"
},
{
"input": "2999902",
"output": "2999899"
},
{
"input": "9999953",
"output": "9999899"
},
{
"input": "9999999",
"output": "9999999"
},
{
"input": "9590999",
"output": "8999999"
}
] | 1,619,171,556
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 13
| 1,000
| 1,331,200
|
# cook your dish here
I = lambda : int(input())
n = I()
ans = 0
ax = 0
for i in range(1,n+1):
j = i
x = 0
while j:
x += j % 10
j //= 10
if x >= ax:
ax = x
ans = i
print(ans)
|
Title: Maximize Sum of Digits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton has the integer *x*. He is interested what positive integer, which doesn't exceed *x*, has the maximum sum of digits.
Your task is to help Anton and to find the integer that interests him. If there are several such integers, determine the biggest of them.
Input Specification:
The first line contains the positive integer *x* (1<=≤<=*x*<=≤<=1018) — the integer which Anton has.
Output Specification:
Print the positive integer which doesn't exceed *x* and has the maximum sum of digits. If there are several such integers, print the biggest of them. Printed integer must not contain leading zeros.
Demo Input:
['100\n', '48\n', '521\n']
Demo Output:
['99\n', '48\n', '499\n']
Note:
none
|
```python
# cook your dish here
I = lambda : int(input())
n = I()
ans = 0
ax = 0
for i in range(1,n+1):
j = i
x = 0
while j:
x += j % 10
j //= 10
if x >= ax:
ax = x
ans = i
print(ans)
```
| 0
|
|
567
|
A
|
Lineland Mail
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
|
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
|
[
"4\n-5 -2 2 7\n",
"2\n-1 1\n"
] |
[
"3 12\n3 9\n4 7\n5 12\n",
"2 2\n2 2\n"
] |
none
| 500
|
[
{
"input": "4\n-5 -2 2 7",
"output": "3 12\n3 9\n4 7\n5 12"
},
{
"input": "2\n-1 1",
"output": "2 2\n2 2"
},
{
"input": "3\n-1 0 1",
"output": "1 2\n1 1\n1 2"
},
{
"input": "4\n-1 0 1 3",
"output": "1 4\n1 3\n1 2\n2 4"
},
{
"input": "3\n-1000000000 0 1000000000",
"output": "1000000000 2000000000\n1000000000 1000000000\n1000000000 2000000000"
},
{
"input": "2\n-1000000000 1000000000",
"output": "2000000000 2000000000\n2000000000 2000000000"
},
{
"input": "10\n1 10 12 15 59 68 130 912 1239 9123",
"output": "9 9122\n2 9113\n2 9111\n3 9108\n9 9064\n9 9055\n62 8993\n327 8211\n327 7884\n7884 9122"
},
{
"input": "5\n-2 -1 0 1 2",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "5\n-2 -1 0 1 3",
"output": "1 5\n1 4\n1 3\n1 3\n2 5"
},
{
"input": "3\n-10000 1 10000",
"output": "10001 20000\n9999 10001\n9999 20000"
},
{
"input": "5\n-1000000000 -999999999 -999999998 -999999997 -999999996",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "10\n-857422304 -529223472 82412729 145077145 188538640 265299215 527377039 588634631 592896147 702473706",
"output": "328198832 1559896010\n328198832 1231697178\n62664416 939835033\n43461495 1002499449\n43461495 1045960944\n76760575 1122721519\n61257592 1384799343\n4261516 1446056935\n4261516 1450318451\n109577559 1559896010"
},
{
"input": "10\n-876779400 -829849659 -781819137 -570920213 18428128 25280705 121178189 219147240 528386329 923854124",
"output": "46929741 1800633524\n46929741 1753703783\n48030522 1705673261\n210898924 1494774337\n6852577 905425996\n6852577 902060105\n95897484 997957589\n97969051 1095926640\n309239089 1405165729\n395467795 1800633524"
},
{
"input": "30\n-15 1 21 25 30 40 59 60 77 81 97 100 103 123 139 141 157 158 173 183 200 215 226 231 244 256 267 279 289 292",
"output": "16 307\n16 291\n4 271\n4 267\n5 262\n10 252\n1 233\n1 232\n4 215\n4 211\n3 195\n3 192\n3 189\n16 169\n2 154\n2 156\n1 172\n1 173\n10 188\n10 198\n15 215\n11 230\n5 241\n5 246\n12 259\n11 271\n11 282\n10 294\n3 304\n3 307"
},
{
"input": "10\n-1000000000 -999999999 -999999997 -999999996 -999999995 -999999994 -999999992 -999999990 -999999988 -999999986",
"output": "1 14\n1 13\n1 11\n1 10\n1 9\n1 8\n2 8\n2 10\n2 12\n2 14"
},
{
"input": "50\n-50000 -49459 -48875 -48456 -48411 -48096 -47901 -47500 -47150 -46808 -46687 -46679 -46337 -45747 -45604 -45194 -44752 -44242 -44231 -44122 -43636 -43274 -42916 -42881 -42386 -42095 -41830 -41618 -41145 -40897 -40534 -40007 -39761 -39389 -39104 -38909 -38630 -38561 -38364 -38255 -38214 -38084 -37959 -37607 -37202 -36890 -36681 -36136 -36123 -35886",
"output": "541 14114\n541 13573\n419 12989\n45 12570\n45 12525\n195 12210\n195 12015\n350 11614\n342 11264\n121 10922\n8 10801\n8 10793\n342 10451\n143 9861\n143 9718\n410 9308\n442 8866\n11 8356\n11 8345\n109 8236\n362 7750\n358 7388\n35 7084\n35 7119\n291 7614\n265 7905\n212 8170\n212 8382\n248 8855\n248 9103\n363 9466\n246 9993\n246 10239\n285 10611\n195 10896\n195 11091\n69 11370\n69 11439\n109 11636\n41 11745\n41 11786\n125 11916\n125 12041\n352 12393\n312 12798\n209 13110\n209 13319\n13 13864\n13 13877\n237 141..."
},
{
"input": "3\n-1000000000 999999999 1000000000",
"output": "1999999999 2000000000\n1 1999999999\n1 2000000000"
}
] | 1,698,315,866
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 358
| 13,926,400
|
n = int(input())
coordinates = list(map(int, input().split()))
for i in range(n):
temp = coordinates[i]
if i != 0 and i != n - 1:
min_ = min(abs(temp - coordinates[i - 1]), abs(temp - coordinates[i + 1]))
max_ = max(abs(temp - coordinates[0]), abs(temp - coordinates[-1]))
elif i == 0:
min_ = abs(temp - coordinates[i + 1])
max_ = abs(temp - coordinates[-1])
else:
min_ = abs(temp - coordinates[i - 1])
max_ = abs(temp - coordinates[0])
print(min_, max_)
|
Title: Lineland Mail
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
Output Specification:
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
Demo Input:
['4\n-5 -2 2 7\n', '2\n-1 1\n']
Demo Output:
['3 12\n3 9\n4 7\n5 12\n', '2 2\n2 2\n']
Note:
none
|
```python
n = int(input())
coordinates = list(map(int, input().split()))
for i in range(n):
temp = coordinates[i]
if i != 0 and i != n - 1:
min_ = min(abs(temp - coordinates[i - 1]), abs(temp - coordinates[i + 1]))
max_ = max(abs(temp - coordinates[0]), abs(temp - coordinates[-1]))
elif i == 0:
min_ = abs(temp - coordinates[i + 1])
max_ = abs(temp - coordinates[-1])
else:
min_ = abs(temp - coordinates[i - 1])
max_ = abs(temp - coordinates[0])
print(min_, max_)
```
| 3
|
|
787
|
A
|
The Monster
|
PROGRAMMING
| 1,200
|
[
"brute force",
"math",
"number theory"
] | null | null |
A monster is chasing after Rick and Morty on another planet. They're so frightened that sometimes they scream. More accurately, Rick screams at times *b*,<=*b*<=+<=*a*,<=*b*<=+<=2*a*,<=*b*<=+<=3*a*,<=... and Morty screams at times *d*,<=*d*<=+<=*c*,<=*d*<=+<=2*c*,<=*d*<=+<=3*c*,<=....
The Monster will catch them if at any point they scream at the same time, so it wants to know when it will catch them (the first time they scream at the same time) or that they will never scream at the same time.
|
The first line of input contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100).
The second line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100).
|
Print the first time Rick and Morty will scream at the same time, or <=-<=1 if they will never scream at the same time.
|
[
"20 2\n9 19\n",
"2 1\n16 12\n"
] |
[
"82\n",
"-1\n"
] |
In the first sample testcase, Rick's 5th scream and Morty's 8th time are at time 82.
In the second sample testcase, all Rick's screams will be at odd times and Morty's will be at even times, so they will never scream at the same time.
| 500
|
[
{
"input": "20 2\n9 19",
"output": "82"
},
{
"input": "2 1\n16 12",
"output": "-1"
},
{
"input": "39 52\n88 78",
"output": "1222"
},
{
"input": "59 96\n34 48",
"output": "1748"
},
{
"input": "87 37\n91 29",
"output": "211"
},
{
"input": "11 81\n49 7",
"output": "301"
},
{
"input": "39 21\n95 89",
"output": "3414"
},
{
"input": "59 70\n48 54",
"output": "1014"
},
{
"input": "87 22\n98 32",
"output": "718"
},
{
"input": "15 63\n51 13",
"output": "-1"
},
{
"input": "39 7\n97 91",
"output": "1255"
},
{
"input": "18 18\n71 71",
"output": "1278"
},
{
"input": "46 71\n16 49",
"output": "209"
},
{
"input": "70 11\n74 27",
"output": "2321"
},
{
"input": "94 55\n20 96",
"output": "-1"
},
{
"input": "18 4\n77 78",
"output": "1156"
},
{
"input": "46 44\n23 55",
"output": "-1"
},
{
"input": "74 88\n77 37",
"output": "1346"
},
{
"input": "94 37\n34 7",
"output": "789"
},
{
"input": "22 81\n80 88",
"output": "-1"
},
{
"input": "46 30\n34 62",
"output": "674"
},
{
"input": "40 4\n81 40",
"output": "364"
},
{
"input": "69 48\n39 9",
"output": "48"
},
{
"input": "89 93\n84 87",
"output": "5967"
},
{
"input": "17 45\n42 65",
"output": "317"
},
{
"input": "41 85\n95 46",
"output": "331"
},
{
"input": "69 30\n41 16",
"output": "1410"
},
{
"input": "93 74\n99 93",
"output": "-1"
},
{
"input": "17 19\n44 75",
"output": "427"
},
{
"input": "45 63\n98 53",
"output": "3483"
},
{
"input": "69 11\n48 34",
"output": "-1"
},
{
"input": "55 94\n3 96",
"output": "204"
},
{
"input": "100 100\n100 100",
"output": "100"
},
{
"input": "1 1\n1 1",
"output": "1"
},
{
"input": "1 1\n1 100",
"output": "100"
},
{
"input": "1 100\n100 1",
"output": "101"
},
{
"input": "98 1\n99 100",
"output": "9703"
},
{
"input": "98 1\n99 2",
"output": "9605"
},
{
"input": "97 2\n99 100",
"output": "4852"
},
{
"input": "3 3\n3 1",
"output": "-1"
},
{
"input": "3 2\n7 2",
"output": "2"
},
{
"input": "2 3\n2 5",
"output": "5"
},
{
"input": "2 3\n2 3",
"output": "3"
},
{
"input": "100 3\n100 5",
"output": "-1"
},
{
"input": "6 10\n12 14",
"output": "-1"
},
{
"input": "4 2\n4 4",
"output": "-1"
},
{
"input": "2 3\n2 2",
"output": "-1"
},
{
"input": "2 3\n4 99",
"output": "99"
},
{
"input": "1 5\n1 5",
"output": "5"
},
{
"input": "1 100\n3 1",
"output": "100"
},
{
"input": "2 2\n2 1",
"output": "-1"
},
{
"input": "2 10\n6 20",
"output": "20"
},
{
"input": "2 2\n2 10",
"output": "10"
},
{
"input": "3 7\n3 6",
"output": "-1"
},
{
"input": "1 100\n1 100",
"output": "100"
},
{
"input": "7 25\n39 85",
"output": "319"
},
{
"input": "84 82\n38 6",
"output": "82"
},
{
"input": "7 7\n7 14",
"output": "14"
}
] | 1,597,647,920
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 109
| 307,200
|
#Author: M@sud_P@rvez
from math import *
a,b=map(int,input().split())
c,d=map(int,input().split())
x=[]; y=[]
for i in range(0,101):
x.append(b+a*i)
y.append(d+c*i)
for i in range(0,101):
for j in range(0,101):
if x[i]-y[j]==0:
print(x[i])
exit()
print(-1)
|
Title: The Monster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A monster is chasing after Rick and Morty on another planet. They're so frightened that sometimes they scream. More accurately, Rick screams at times *b*,<=*b*<=+<=*a*,<=*b*<=+<=2*a*,<=*b*<=+<=3*a*,<=... and Morty screams at times *d*,<=*d*<=+<=*c*,<=*d*<=+<=2*c*,<=*d*<=+<=3*c*,<=....
The Monster will catch them if at any point they scream at the same time, so it wants to know when it will catch them (the first time they scream at the same time) or that they will never scream at the same time.
Input Specification:
The first line of input contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100).
The second line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100).
Output Specification:
Print the first time Rick and Morty will scream at the same time, or <=-<=1 if they will never scream at the same time.
Demo Input:
['20 2\n9 19\n', '2 1\n16 12\n']
Demo Output:
['82\n', '-1\n']
Note:
In the first sample testcase, Rick's 5th scream and Morty's 8th time are at time 82.
In the second sample testcase, all Rick's screams will be at odd times and Morty's will be at even times, so they will never scream at the same time.
|
```python
#Author: M@sud_P@rvez
from math import *
a,b=map(int,input().split())
c,d=map(int,input().split())
x=[]; y=[]
for i in range(0,101):
x.append(b+a*i)
y.append(d+c*i)
for i in range(0,101):
for j in range(0,101):
if x[i]-y[j]==0:
print(x[i])
exit()
print(-1)
```
| 3
|
|
794
|
C
|
Naming Company
|
PROGRAMMING
| 1,800
|
[
"games",
"greedy",
"sortings"
] | null | null |
Oleg the client and Igor the analyst are good friends. However, sometimes they argue over little things. Recently, they started a new company, but they are having trouble finding a name for the company.
To settle this problem, they've decided to play a game. The company name will consist of *n* letters. Oleg and Igor each have a set of *n* letters (which might contain multiple copies of the same letter, the sets can be different). Initially, the company name is denoted by *n* question marks. Oleg and Igor takes turns to play the game, Oleg moves first. In each turn, a player can choose one of the letters *c* in his set and replace any of the question marks with *c*. Then, a copy of the letter *c* is removed from his set. The game ends when all the question marks has been replaced by some letter.
For example, suppose Oleg has the set of letters {*i*,<=*o*,<=*i*} and Igor has the set of letters {*i*,<=*m*,<=*o*}. One possible game is as follows :
Initially, the company name is ???.
Oleg replaces the second question mark with 'i'. The company name becomes ?i?. The set of letters Oleg have now is {*i*,<=*o*}.
Igor replaces the third question mark with 'o'. The company name becomes ?io. The set of letters Igor have now is {*i*,<=*m*}.
Finally, Oleg replaces the first question mark with 'o'. The company name becomes oio. The set of letters Oleg have now is {*i*}.
In the end, the company name is oio.
Oleg wants the company name to be as lexicographically small as possible while Igor wants the company name to be as lexicographically large as possible. What will be the company name if Oleg and Igor always play optimally?
A string *s*<==<=*s*1*s*2...*s**m* is called lexicographically smaller than a string *t*<==<=*t*1*t*2...*t**m* (where *s*<=≠<=*t*) if *s**i*<=<<=*t**i* where *i* is the smallest index such that *s**i*<=≠<=*t**i*. (so *s**j*<==<=*t**j* for all *j*<=<<=*i*)
|
The first line of input contains a string *s* of length *n* (1<=≤<=*n*<=≤<=3·105). All characters of the string are lowercase English letters. This string denotes the set of letters Oleg has initially.
The second line of input contains a string *t* of length *n*. All characters of the string are lowercase English letters. This string denotes the set of letters Igor has initially.
|
The output should contain a string of *n* lowercase English letters, denoting the company name if Oleg and Igor plays optimally.
|
[
"tinkoff\nzscoder\n",
"xxxxxx\nxxxxxx\n",
"ioi\nimo\n"
] |
[
"fzfsirk\n",
"xxxxxx\n",
"ioi\n"
] |
One way to play optimally in the first sample is as follows :
- Initially, the company name is ???????.- Oleg replaces the first question mark with 'f'. The company name becomes f??????.- Igor replaces the second question mark with 'z'. The company name becomes fz?????.- Oleg replaces the third question mark with 'f'. The company name becomes fzf????.- Igor replaces the fourth question mark with 's'. The company name becomes fzfs???.- Oleg replaces the fifth question mark with 'i'. The company name becomes fzfsi??.- Igor replaces the sixth question mark with 'r'. The company name becomes fzfsir?.- Oleg replaces the seventh question mark with 'k'. The company name becomes fzfsirk.
For the second sample, no matter how they play, the company name will always be xxxxxx.
| 1,750
|
[
{
"input": "tinkoff\nzscoder",
"output": "fzfsirk"
},
{
"input": "xxxxxx\nxxxxxx",
"output": "xxxxxx"
},
{
"input": "ioi\nimo",
"output": "ioi"
},
{
"input": "abc\naaa",
"output": "aab"
},
{
"input": "reddit\nabcdef",
"output": "dfdeed"
},
{
"input": "cbxz\naaaa",
"output": "abac"
},
{
"input": "bcdef\nabbbc",
"output": "bccdb"
},
{
"input": "z\ny",
"output": "z"
},
{
"input": "y\nz",
"output": "y"
}
] | 1,494,669,284
| 1,184
|
Python 3
|
RUNTIME_ERROR
|
PRETESTS
| 0
| 31
| 0
|
s1 = input()
s2 = input()
s1.sort()
s2.sort()
print(s1)
|
Title: Naming Company
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Oleg the client and Igor the analyst are good friends. However, sometimes they argue over little things. Recently, they started a new company, but they are having trouble finding a name for the company.
To settle this problem, they've decided to play a game. The company name will consist of *n* letters. Oleg and Igor each have a set of *n* letters (which might contain multiple copies of the same letter, the sets can be different). Initially, the company name is denoted by *n* question marks. Oleg and Igor takes turns to play the game, Oleg moves first. In each turn, a player can choose one of the letters *c* in his set and replace any of the question marks with *c*. Then, a copy of the letter *c* is removed from his set. The game ends when all the question marks has been replaced by some letter.
For example, suppose Oleg has the set of letters {*i*,<=*o*,<=*i*} and Igor has the set of letters {*i*,<=*m*,<=*o*}. One possible game is as follows :
Initially, the company name is ???.
Oleg replaces the second question mark with 'i'. The company name becomes ?i?. The set of letters Oleg have now is {*i*,<=*o*}.
Igor replaces the third question mark with 'o'. The company name becomes ?io. The set of letters Igor have now is {*i*,<=*m*}.
Finally, Oleg replaces the first question mark with 'o'. The company name becomes oio. The set of letters Oleg have now is {*i*}.
In the end, the company name is oio.
Oleg wants the company name to be as lexicographically small as possible while Igor wants the company name to be as lexicographically large as possible. What will be the company name if Oleg and Igor always play optimally?
A string *s*<==<=*s*1*s*2...*s**m* is called lexicographically smaller than a string *t*<==<=*t*1*t*2...*t**m* (where *s*<=≠<=*t*) if *s**i*<=<<=*t**i* where *i* is the smallest index such that *s**i*<=≠<=*t**i*. (so *s**j*<==<=*t**j* for all *j*<=<<=*i*)
Input Specification:
The first line of input contains a string *s* of length *n* (1<=≤<=*n*<=≤<=3·105). All characters of the string are lowercase English letters. This string denotes the set of letters Oleg has initially.
The second line of input contains a string *t* of length *n*. All characters of the string are lowercase English letters. This string denotes the set of letters Igor has initially.
Output Specification:
The output should contain a string of *n* lowercase English letters, denoting the company name if Oleg and Igor plays optimally.
Demo Input:
['tinkoff\nzscoder\n', 'xxxxxx\nxxxxxx\n', 'ioi\nimo\n']
Demo Output:
['fzfsirk\n', 'xxxxxx\n', 'ioi\n']
Note:
One way to play optimally in the first sample is as follows :
- Initially, the company name is ???????.- Oleg replaces the first question mark with 'f'. The company name becomes f??????.- Igor replaces the second question mark with 'z'. The company name becomes fz?????.- Oleg replaces the third question mark with 'f'. The company name becomes fzf????.- Igor replaces the fourth question mark with 's'. The company name becomes fzfs???.- Oleg replaces the fifth question mark with 'i'. The company name becomes fzfsi??.- Igor replaces the sixth question mark with 'r'. The company name becomes fzfsir?.- Oleg replaces the seventh question mark with 'k'. The company name becomes fzfsirk.
For the second sample, no matter how they play, the company name will always be xxxxxx.
|
```python
s1 = input()
s2 = input()
s1.sort()
s2.sort()
print(s1)
```
| -1
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,643,213,899
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 92
| 0
|
from math import gcd
x, y = map(int, input().split())
a, b = 6 - max(x, y) + 1, 6
while gcd(a, b) != 1:
j = gcd(a, b)
a, b = a // j, b // j
print('{0}/{1}'.format(a, b))
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
from math import gcd
x, y = map(int, input().split())
a, b = 6 - max(x, y) + 1, 6
while gcd(a, b) != 1:
j = gcd(a, b)
a, b = a // j, b // j
print('{0}/{1}'.format(a, b))
```
| 3.954
|
241
|
A
|
Old Peykan
|
PROGRAMMING
| 1,300
|
[
"greedy"
] | null | null |
There are *n* cities in the country where the Old Peykan lives. These cities are located on a straight line, we'll denote them from left to right as *c*1,<=*c*2,<=...,<=*c**n*. The Old Peykan wants to travel from city *c*1 to *c**n* using roads. There are (*n*<=-<=1) one way roads, the *i*-th road goes from city *c**i* to city *c**i*<=+<=1 and is *d**i* kilometers long.
The Old Peykan travels 1 kilometer in 1 hour and consumes 1 liter of fuel during this time.
Each city *c**i* (except for the last city *c**n*) has a supply of *s**i* liters of fuel which immediately transfers to the Old Peykan if it passes the city or stays in it. This supply refreshes instantly *k* hours after it transfers. The Old Peykan can stay in a city for a while and fill its fuel tank many times.
Initially (at time zero) the Old Peykan is at city *c*1 and *s*1 liters of fuel is transferred to it's empty tank from *c*1's supply. The Old Peykan's fuel tank capacity is unlimited. Old Peykan can not continue its travel if its tank is emptied strictly between two cities.
Find the minimum time the Old Peykan needs to reach city *c**n*.
|
The first line of the input contains two space-separated integers *m* and *k* (1<=≤<=*m*,<=*k*<=≤<=1000). The value *m* specifies the number of roads between cities which is equal to *n*<=-<=1.
The next line contains *m* space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=1000) and the following line contains *m* space-separated integers *s*1,<=*s*2,<=...,<=*s**m* (1<=≤<=*s**i*<=≤<=1000).
|
In the only line of the output print a single integer — the minimum time required for The Old Peykan to reach city *c**n* from city *c*1.
|
[
"4 6\n1 2 5 2\n2 3 3 4\n",
"2 3\n5 6\n5 5\n"
] |
[
"10\n",
"14\n"
] |
In the second sample above, the Old Peykan stays in *c*<sub class="lower-index">1</sub> for 3 hours.
| 0
|
[
{
"input": "4 6\n1 2 5 2\n2 3 3 4",
"output": "10"
},
{
"input": "2 3\n5 6\n5 5",
"output": "14"
},
{
"input": "24 3\n11 8 8 12 17 4 4 25 39 37 31 32 38 34 29 29 34 39 39 39 17 9 24 6\n3 5 4 3 3 3 4 3 4 3 3 3 3 4 3 3 4 3 4 3 3 3 3 3",
"output": "862"
},
{
"input": "43 5\n6 7 15 12 15 7 22 33 38 15 7 23 31 21 26 41 25 14 26 33 5 28 22 6 35 17 19 32 41 27 20 25 5 32 37 19 40 9 25 22 10 24 9\n3 5 3 6 5 4 5 3 3 3 3 6 6 3 3 3 3 3 3 3 3 6 3 3 4 3 4 3 6 4 3 6 3 4 6 3 4 5 4 4 3 3 5",
"output": "1566"
},
{
"input": "62 5\n12 12 10 7 27 7 32 15 33 3 23 13 24 30 32 22 21 31 27 27 37 7 5 31 19 16 10 20 24 32 36 42 33 14 41 8 13 3 8 8 12 27 36 15 24 17 23 33 31 5 32 17 14 41 37 31 23 31 41 23 36 12\n4 5 4 3 4 3 5 3 4 3 3 3 3 3 3 3 3 3 5 3 4 3 6 4 4 5 3 4 3 3 3 4 3 5 5 3 4 3 3 3 3 5 3 3 5 3 6 3 3 3 3 4 3 3 4 3 5 3 3 3 4 3",
"output": "2406"
},
{
"input": "81 4\n15 20 14 10 39 4 26 8 8 30 13 43 7 7 4 6 23 42 24 35 12 19 21 31 5 20 8 17 25 31 8 31 9 14 29 35 39 35 19 13 35 11 24 3 22 3 22 41 26 32 17 42 21 16 15 44 12 5 16 20 19 38 15 11 36 14 6 21 5 27 15 40 6 9 32 33 35 4 10 15 26\n3 5 4 3 4 6 4 7 5 4 3 4 3 3 4 3 4 3 3 4 6 5 5 3 3 6 6 5 3 3 5 3 3 6 4 4 3 6 4 3 3 5 6 6 7 3 3 3 3 3 7 3 3 5 3 3 3 4 6 4 6 4 5 3 3 6 4 3 3 3 7 5 4 5 3 5 4 3 3 4 3",
"output": "2419"
},
{
"input": "100 6\n15 20 32 8 29 10 33 15 9 26 28 21 34 7 41 23 9 17 16 15 14 29 25 31 24 26 13 18 19 40 9 16 36 32 39 11 4 31 37 28 32 40 7 18 45 21 15 45 6 15 27 22 27 41 28 7 22 43 25 40 6 7 32 31 36 14 5 27 31 28 23 9 13 14 7 25 28 33 40 22 44 9 29 26 41 30 16 15 31 42 13 40 36 44 17 29 32 29 38 13\n4 4 3 4 3 4 3 3 4 3 4 4 5 6 5 3 3 5 3 5 3 3 5 6 3 4 4 5 4 3 4 3 3 4 4 4 3 5 4 4 4 4 3 3 4 4 6 4 4 5 6 6 4 4 3 5 3 4 3 6 5 3 5 4 4 4 4 3 5 4 3 5 3 3 3 4 3 4 5 4 3 6 5 3 7 3 5 4 5 4 3 5 5 3 5 4 3 5 3 4",
"output": "4491"
}
] | 1,689,369,888
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
print("_RANDOM_GUESS_1689369888.4785001")# 1689369888.478519
|
Title: Old Peykan
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in the country where the Old Peykan lives. These cities are located on a straight line, we'll denote them from left to right as *c*1,<=*c*2,<=...,<=*c**n*. The Old Peykan wants to travel from city *c*1 to *c**n* using roads. There are (*n*<=-<=1) one way roads, the *i*-th road goes from city *c**i* to city *c**i*<=+<=1 and is *d**i* kilometers long.
The Old Peykan travels 1 kilometer in 1 hour and consumes 1 liter of fuel during this time.
Each city *c**i* (except for the last city *c**n*) has a supply of *s**i* liters of fuel which immediately transfers to the Old Peykan if it passes the city or stays in it. This supply refreshes instantly *k* hours after it transfers. The Old Peykan can stay in a city for a while and fill its fuel tank many times.
Initially (at time zero) the Old Peykan is at city *c*1 and *s*1 liters of fuel is transferred to it's empty tank from *c*1's supply. The Old Peykan's fuel tank capacity is unlimited. Old Peykan can not continue its travel if its tank is emptied strictly between two cities.
Find the minimum time the Old Peykan needs to reach city *c**n*.
Input Specification:
The first line of the input contains two space-separated integers *m* and *k* (1<=≤<=*m*,<=*k*<=≤<=1000). The value *m* specifies the number of roads between cities which is equal to *n*<=-<=1.
The next line contains *m* space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=1000) and the following line contains *m* space-separated integers *s*1,<=*s*2,<=...,<=*s**m* (1<=≤<=*s**i*<=≤<=1000).
Output Specification:
In the only line of the output print a single integer — the minimum time required for The Old Peykan to reach city *c**n* from city *c*1.
Demo Input:
['4 6\n1 2 5 2\n2 3 3 4\n', '2 3\n5 6\n5 5\n']
Demo Output:
['10\n', '14\n']
Note:
In the second sample above, the Old Peykan stays in *c*<sub class="lower-index">1</sub> for 3 hours.
|
```python
print("_RANDOM_GUESS_1689369888.4785001")# 1689369888.478519
```
| 0
|
|
475
|
B
|
Strongly Connected City
|
PROGRAMMING
| 1,400
|
[
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null |
Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection.
The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern.
|
The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets.
The second line contains a string of length *n*, made of characters '<' and '>', denoting direction of each horizontal street. If the *i*-th character is equal to '<', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south.
The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east.
|
If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO".
|
[
"3 3\n><>\nv^v\n",
"4 6\n<><>\nv^v^v^\n"
] |
[
"NO\n",
"YES\n"
] |
The figure above shows street directions in the second sample test case.
| 1,000
|
[
{
"input": "3 3\n><>\nv^v",
"output": "NO"
},
{
"input": "4 6\n<><>\nv^v^v^",
"output": "YES"
},
{
"input": "2 2\n<>\nv^",
"output": "YES"
},
{
"input": "2 2\n>>\n^v",
"output": "NO"
},
{
"input": "3 3\n>><\n^^v",
"output": "YES"
},
{
"input": "3 4\n>><\n^v^v",
"output": "YES"
},
{
"input": "3 8\n>><\nv^^^^^^^",
"output": "NO"
},
{
"input": "7 2\n<><<<<>\n^^",
"output": "NO"
},
{
"input": "4 5\n><<<\n^^^^v",
"output": "YES"
},
{
"input": "2 20\n><\n^v^^v^^v^^^v^vv^vv^^",
"output": "NO"
},
{
"input": "2 20\n<>\nv^vv^v^^vvv^^^v^vvv^",
"output": "YES"
},
{
"input": "20 2\n<><<><<>><<<>><><<<<\n^^",
"output": "NO"
},
{
"input": "20 2\n><>><>><>><<<><<><><\n^v",
"output": "YES"
},
{
"input": "11 12\n><<<><><<>>\nvv^^^^vvvvv^",
"output": "NO"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "16 11\n<<<<>><><<<<<><<\nvv^v^vvvv^v",
"output": "NO"
},
{
"input": "14 7\n><<<<>>>>>>><<\nvv^^^vv",
"output": "NO"
},
{
"input": "5 14\n<<><>\nv^vv^^vv^v^^^v",
"output": "NO"
},
{
"input": "8 18\n>>>><>>>\nv^vv^v^^^^^vvv^^vv",
"output": "NO"
},
{
"input": "18 18\n<<><>><<>><>><><<<\n^^v^v^vvvv^v^vv^vv",
"output": "NO"
},
{
"input": "4 18\n<<<>\n^^^^^vv^vv^^vv^v^v",
"output": "NO"
},
{
"input": "19 18\n><><>>><<<<<>>><<<>\n^^v^^v^^v^vv^v^vvv",
"output": "NO"
},
{
"input": "14 20\n<<<><><<>><><<\nvvvvvvv^v^vvvv^^^vv^",
"output": "NO"
},
{
"input": "18 18\n><>>><<<>><><>>>><\nvv^^^^v^v^^^^v^v^^",
"output": "NO"
},
{
"input": "8 18\n<><<<>>>\n^^^^^^v^^^vv^^vvvv",
"output": "NO"
},
{
"input": "11 12\n><><><<><><\n^^v^^^^^^^^v",
"output": "YES"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "16 11\n>><<><<<<>>><><<\n^^^^vvvv^vv",
"output": "YES"
},
{
"input": "14 7\n<><><<<>>>><>>\nvv^^v^^",
"output": "YES"
},
{
"input": "5 14\n>>>><\n^v^v^^^vv^vv^v",
"output": "YES"
},
{
"input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^",
"output": "YES"
},
{
"input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v",
"output": "YES"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "19 18\n>>>><><<>>><<<><<<<\n^v^^^^vv^^v^^^^v^v",
"output": "YES"
},
{
"input": "14 20\n<>><<<><<>>>>>\nvv^^v^^^^v^^vv^^vvv^",
"output": "YES"
},
{
"input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v",
"output": "YES"
},
{
"input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^",
"output": "YES"
},
{
"input": "20 19\n<><>>>>><<<<<><<>>>>\nv^vv^^vvvvvv^vvvv^v",
"output": "NO"
},
{
"input": "20 19\n<<<><<<>><<<>><><><>\nv^v^vvv^vvv^^^vvv^^",
"output": "YES"
},
{
"input": "19 20\n<><<<><><><<<<<<<<>\n^v^^^^v^^vvvv^^^^vvv",
"output": "NO"
},
{
"input": "19 20\n>>>>>>>><>>><><<<><\n^v^v^^^vvv^^^v^^vvvv",
"output": "YES"
},
{
"input": "20 20\n<<<>>>><>><<>><<>>>>\n^vvv^^^^vv^^^^^v^^vv",
"output": "NO"
},
{
"input": "20 20\n>>><><<><<<<<<<><<><\nvv^vv^vv^^^^^vv^^^^^",
"output": "NO"
},
{
"input": "20 20\n><<><<<<<<<>>><>>><<\n^^^^^^^^vvvv^vv^vvvv",
"output": "YES"
},
{
"input": "20 20\n<>>>>>>>><>>><>><<<>\nvv^^vv^^^^v^vv^v^^^^",
"output": "YES"
},
{
"input": "20 20\n><>><<>><>>>>>>>><<>\n^^v^vv^^^vvv^v^^^vv^",
"output": "NO"
},
{
"input": "20 20\n<<<<><<>><><<<>><<><\nv^^^^vvv^^^vvvv^v^vv",
"output": "NO"
},
{
"input": "20 20\n><<<><<><>>><><<<<<<\nvv^^vvv^^v^^v^vv^vvv",
"output": "NO"
},
{
"input": "20 20\n<<>>><>>>><<<<>>><<>\nv^vv^^^^^vvv^^v^^v^v",
"output": "NO"
},
{
"input": "20 20\n><<><<><<<<<<>><><>>\nv^^^v^vv^^v^^vvvv^vv",
"output": "NO"
},
{
"input": "20 20\n<<<<<<<<><>><><>><<<\n^vvv^^^v^^^vvv^^^^^v",
"output": "NO"
},
{
"input": "20 20\n>>><<<<<>>><><><<><<\n^^^vvv^^^v^^v^^v^vvv",
"output": "YES"
},
{
"input": "20 20\n<><<<><><>><><><<<<>\n^^^vvvv^vv^v^^^^v^vv",
"output": "NO"
},
{
"input": "20 20\n>>>>>>>>>><>>><>><>>\n^vvv^^^vv^^^^^^vvv^v",
"output": "NO"
},
{
"input": "20 20\n<><>><><<<<<>><<>>><\nv^^^v^v^v^vvvv^^^vv^",
"output": "NO"
},
{
"input": "20 20\n><<<><<<><<<><>>>><<\nvvvv^^^^^vv^v^^vv^v^",
"output": "NO"
},
{
"input": "20 20\n<<><<<<<<>>>>><<<>>>\nvvvvvv^v^vvv^^^^^^^^",
"output": "YES"
},
{
"input": "20 20\n><<><<>>>>><><>><>>>\nv^^^^vvv^^^^^v^v^vv^",
"output": "NO"
},
{
"input": "20 20\n<<>>><>><<>>>><<<><<\n^^vvv^^vvvv^vv^^v^v^",
"output": "NO"
},
{
"input": "20 20\n><<>><>>>><<><>><><<\n^v^^^^^^vvvv^v^v^v^^",
"output": "NO"
},
{
"input": "20 20\n<<><<<<><><<>>><>>>>\n^^vvvvv^v^^^^^^^vvv^",
"output": "NO"
},
{
"input": "20 20\n>><<<<<<><>>>><>>><>\n^^^v^v^vv^^vv^vvv^^^",
"output": "NO"
},
{
"input": "20 20\n>>>>>>>>>>>>>>>>>>>>\nvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "2 2\n><\nv^",
"output": "NO"
},
{
"input": "2 2\n<>\n^v",
"output": "NO"
},
{
"input": "3 3\n>><\nvvv",
"output": "NO"
},
{
"input": "2 3\n<>\nv^^",
"output": "YES"
},
{
"input": "4 4\n>>><\nvvv^",
"output": "NO"
},
{
"input": "20 20\n<><><><><><><><><><>\nvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "4 4\n<>>>\nv^^^",
"output": "YES"
},
{
"input": "20 20\n<><><><><><><><><><>\nv^v^v^v^v^v^v^v^v^v^",
"output": "YES"
},
{
"input": "2 3\n<>\n^v^",
"output": "NO"
},
{
"input": "4 3\n<><>\n^vv",
"output": "NO"
},
{
"input": "3 3\n<<>\nvv^",
"output": "YES"
},
{
"input": "2 3\n><\nvv^",
"output": "NO"
},
{
"input": "7 6\n>>><>><\n^vv^vv",
"output": "YES"
},
{
"input": "2 2\n<<\nv^",
"output": "NO"
},
{
"input": "3 3\n>><\n^^^",
"output": "NO"
},
{
"input": "3 3\n<><\nv^v",
"output": "NO"
},
{
"input": "20 20\n><><><><><><><><><><\n^v^v^v^v^v^v^v^v^v^v",
"output": "YES"
},
{
"input": "4 4\n<>>>\nvvv^",
"output": "YES"
}
] | 1,584,697,041
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 93
| 0
|
_,a,b=[raw_input() for i in range(3)]
print('YES') if a[0]!=a[-1] and b[0]!=b[-1] else print('NO')
|
Title: Strongly Connected City
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection.
The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern.
Input Specification:
The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets.
The second line contains a string of length *n*, made of characters '<' and '>', denoting direction of each horizontal street. If the *i*-th character is equal to '<', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south.
The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east.
Output Specification:
If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO".
Demo Input:
['3 3\n><>\nv^v\n', '4 6\n<><>\nv^v^v^\n']
Demo Output:
['NO\n', 'YES\n']
Note:
The figure above shows street directions in the second sample test case.
|
```python
_,a,b=[raw_input() for i in range(3)]
print('YES') if a[0]!=a[-1] and b[0]!=b[-1] else print('NO')
```
| -1
|
|
166
|
E
|
Tetrahedron
|
PROGRAMMING
| 1,500
|
[
"dp",
"math",
"matrices"
] | null | null |
You are given a tetrahedron. Let's mark its vertices with letters *A*, *B*, *C* and *D* correspondingly.
An ant is standing in the vertex *D* of the tetrahedron. The ant is quite active and he wouldn't stay idle. At each moment of time he makes a step from one vertex to another one along some edge of the tetrahedron. The ant just can't stand on one place.
You do not have to do much to solve the problem: your task is to count the number of ways in which the ant can go from the initial vertex *D* to itself in exactly *n* steps. In other words, you are asked to find out the number of different cyclic paths with the length of *n* from vertex *D* to itself. As the number can be quite large, you should print it modulo 1000000007 (109<=+<=7).
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=107) — the required length of the cyclic path.
|
Print the only integer — the required number of ways modulo 1000000007 (109<=+<=7).
|
[
"2\n",
"4\n"
] |
[
"3\n",
"21\n"
] |
The required paths in the first sample are:
- *D* - *A* - *D* - *D* - *B* - *D* - *D* - *C* - *D*
| 1,000
|
[
{
"input": "2",
"output": "3"
},
{
"input": "4",
"output": "21"
},
{
"input": "1",
"output": "0"
},
{
"input": "3",
"output": "6"
},
{
"input": "5",
"output": "60"
},
{
"input": "6",
"output": "183"
},
{
"input": "7",
"output": "546"
},
{
"input": "8",
"output": "1641"
},
{
"input": "9",
"output": "4920"
},
{
"input": "10",
"output": "14763"
},
{
"input": "15",
"output": "3587226"
},
{
"input": "30",
"output": "782663359"
},
{
"input": "10000000",
"output": "192336614"
},
{
"input": "100",
"output": "721510432"
},
{
"input": "300",
"output": "327873818"
},
{
"input": "900",
"output": "295068084"
},
{
"input": "1500",
"output": "451187545"
},
{
"input": "3000",
"output": "645417275"
},
{
"input": "5000",
"output": "755610910"
},
{
"input": "10000",
"output": "723907367"
},
{
"input": "50000",
"output": "969527595"
},
{
"input": "90000",
"output": "548978368"
},
{
"input": "99999",
"output": "909741855"
},
{
"input": "100000",
"output": "729225554"
},
{
"input": "300000",
"output": "93822635"
},
{
"input": "800000",
"output": "178940616"
},
{
"input": "1000000",
"output": "266233856"
},
{
"input": "4000000",
"output": "882155933"
},
{
"input": "9000000",
"output": "295060537"
},
{
"input": "9999999",
"output": "730778875"
},
{
"input": "1000000",
"output": "266233856"
},
{
"input": "9999999",
"output": "730778875"
},
{
"input": "10000000",
"output": "192336614"
},
{
"input": "9999998",
"output": "576926295"
},
{
"input": "30",
"output": "782663359"
},
{
"input": "31",
"output": "347990060"
}
] | 1,614,699,919
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 12
| 2,000
| 15,257,600
|
n=int(input())
dp=[[0,0,0,1]]
for i in range(1,n+1):
dp.append([0,0,0,0])
for j in range(4):
for k in range(4):
if j!=k:
dp[i][j]+=dp[i-1][k]
dp[i][j]%=10**9+7
print(dp[-1][3]%(10**9+7))
|
Title: Tetrahedron
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a tetrahedron. Let's mark its vertices with letters *A*, *B*, *C* and *D* correspondingly.
An ant is standing in the vertex *D* of the tetrahedron. The ant is quite active and he wouldn't stay idle. At each moment of time he makes a step from one vertex to another one along some edge of the tetrahedron. The ant just can't stand on one place.
You do not have to do much to solve the problem: your task is to count the number of ways in which the ant can go from the initial vertex *D* to itself in exactly *n* steps. In other words, you are asked to find out the number of different cyclic paths with the length of *n* from vertex *D* to itself. As the number can be quite large, you should print it modulo 1000000007 (109<=+<=7).
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=107) — the required length of the cyclic path.
Output Specification:
Print the only integer — the required number of ways modulo 1000000007 (109<=+<=7).
Demo Input:
['2\n', '4\n']
Demo Output:
['3\n', '21\n']
Note:
The required paths in the first sample are:
- *D* - *A* - *D* - *D* - *B* - *D* - *D* - *C* - *D*
|
```python
n=int(input())
dp=[[0,0,0,1]]
for i in range(1,n+1):
dp.append([0,0,0,0])
for j in range(4):
for k in range(4):
if j!=k:
dp[i][j]+=dp[i-1][k]
dp[i][j]%=10**9+7
print(dp[-1][3]%(10**9+7))
```
| 0
|
|
460
|
A
|
Vasya and Socks
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
|
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
|
Print a single integer — the answer to the problem.
|
[
"2 2\n",
"9 3\n"
] |
[
"3\n",
"13\n"
] |
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
| 500
|
[
{
"input": "2 2",
"output": "3"
},
{
"input": "9 3",
"output": "13"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "1 99",
"output": "1"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "10 2",
"output": "19"
},
{
"input": "10 9",
"output": "11"
},
{
"input": "100 100",
"output": "101"
},
{
"input": "2 27",
"output": "2"
},
{
"input": "99 100",
"output": "99"
},
{
"input": "99 2",
"output": "197"
},
{
"input": "100 3",
"output": "149"
},
{
"input": "98 3",
"output": "146"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 2",
"output": "199"
},
{
"input": "62 4",
"output": "82"
},
{
"input": "99 10",
"output": "109"
},
{
"input": "100 5",
"output": "124"
},
{
"input": "80 80",
"output": "81"
},
{
"input": "95 16",
"output": "101"
},
{
"input": "75 16",
"output": "79"
},
{
"input": "99 74",
"output": "100"
},
{
"input": "20 21",
"output": "20"
},
{
"input": "52 96",
"output": "52"
},
{
"input": "24 5",
"output": "29"
}
] | 1,671,859,729
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
x=int(input()) #пары 2 / 1
day=int(input()) #день\дни 3 / 3
b=0
v=0
o=0
while x>=0:
x=x-1
x=x+b
b=0
if x>=0:
v+=1
o += 1
#print(x,v)
if v==day:
b+=1
v=0
print(o)
|
Title: Vasya and Socks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
Input Specification:
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['2 2\n', '9 3\n']
Demo Output:
['3\n', '13\n']
Note:
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
|
```python
x=int(input()) #пары 2 / 1
day=int(input()) #день\дни 3 / 3
b=0
v=0
o=0
while x>=0:
x=x-1
x=x+b
b=0
if x>=0:
v+=1
o += 1
#print(x,v)
if v==day:
b+=1
v=0
print(o)
```
| -1
|
|
766
|
B
|
Mahmoud and a Triangle
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"geometry",
"greedy",
"math",
"number theory",
"sortings"
] | null | null |
Mahmoud has *n* line segments, the *i*-th of them has length *a**i*. Ehab challenged him to use exactly 3 line segments to form a non-degenerate triangle. Mahmoud doesn't accept challenges unless he is sure he can win, so he asked you to tell him if he should accept the challenge. Given the lengths of the line segments, check if he can choose exactly 3 of them to form a non-degenerate triangle.
Mahmoud should use exactly 3 line segments, he can't concatenate two line segments or change any length. A non-degenerate triangle is a triangle with positive area.
|
The first line contains single integer *n* (3<=≤<=*n*<=≤<=105) — the number of line segments Mahmoud has.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the lengths of line segments Mahmoud has.
|
In the only line print "YES" if he can choose exactly three line segments and form a non-degenerate triangle with them, and "NO" otherwise.
|
[
"5\n1 5 3 2 4\n",
"3\n4 1 2\n"
] |
[
"YES\n",
"NO\n"
] |
For the first example, he can use line segments with lengths 2, 4 and 5 to form a non-degenerate triangle.
| 1,000
|
[
{
"input": "5\n1 5 3 2 4",
"output": "YES"
},
{
"input": "3\n4 1 2",
"output": "NO"
},
{
"input": "30\n197 75 517 39724 7906061 1153471 3 15166 168284 3019844 272293 316 16 24548 42 118 5792 5 9373 1866366 4886214 24 2206 712886 104005 1363 836 64273 440585 3576",
"output": "NO"
},
{
"input": "30\n229017064 335281886 247217656 670601882 743442492 615491486 544941439 911270108 474843964 803323771 177115397 62179276 390270885 754889875 881720571 902691435 154083299 328505383 761264351 182674686 94104683 357622370 573909964 320060691 33548810 247029007 812823597 946798893 813659359 710111761",
"output": "YES"
},
{
"input": "40\n740553458 532562042 138583675 75471987 487348843 476240280 972115023 103690894 546736371 915774563 35356828 819948191 138721993 24257926 761587264 767176616 608310208 78275645 386063134 227581756 672567198 177797611 87579917 941781518 274774331 843623616 981221615 630282032 118843963 749160513 354134861 132333165 405839062 522698334 29698277 541005920 856214146 167344951 398332403 68622974",
"output": "YES"
},
{
"input": "40\n155 1470176 7384 765965701 1075 4 561554 6227772 93 16304522 1744 662 3 292572860 19335 908613 42685804 347058 20 132560 3848974 69067081 58 2819 111752888 408 81925 30 11951 4564 251 26381275 473392832 50628 180819969 2378797 10076746 9 214492 31291",
"output": "NO"
},
{
"input": "3\n1 1000000000 1000000000",
"output": "YES"
},
{
"input": "4\n1 1000000000 1000000000 1000000000",
"output": "YES"
},
{
"input": "3\n1 1000000000 1",
"output": "NO"
},
{
"input": "5\n1 2 3 5 2",
"output": "YES"
},
{
"input": "41\n19 161 4090221 118757367 2 45361275 1562319 596751 140871 97 1844 310910829 10708344 6618115 698 1 87059 33 2527892 12703 73396090 17326460 3 368811 20550 813975131 10 53804 28034805 7847 2992 33254 1139 227930 965568 261 4846 503064297 192153458 57 431",
"output": "NO"
},
{
"input": "42\n4317083 530966905 202811311 104 389267 35 1203 18287479 125344279 21690 859122498 65 859122508 56790 1951 148683 457 1 22 2668100 8283 2 77467028 13405 11302280 47877251 328155592 35095 29589769 240574 4 10 1019123 6985189 629846 5118 169 1648973 91891 741 282 3159",
"output": "YES"
},
{
"input": "43\n729551585 11379 5931704 330557 1653 15529406 729551578 278663905 1 729551584 2683 40656510 29802 147 1400284 2 126260 865419 51 17 172223763 86 1 534861 450887671 32 234 25127103 9597697 48226 7034 389 204294 2265706 65783617 4343 3665990 626 78034 106440137 5 18421 1023",
"output": "YES"
},
{
"input": "44\n719528276 2 235 444692918 24781885 169857576 18164 47558 15316043 9465834 64879816 2234575 1631 853530 8 1001 621 719528259 84 6933 31 1 3615623 719528266 40097928 274835337 1381044 11225 2642 5850203 6 527506 18 104977753 76959 29393 49 4283 141 201482 380 1 124523 326015",
"output": "YES"
},
{
"input": "45\n28237 82 62327732 506757 691225170 5 970 4118 264024506 313192 367 14713577 73933 691225154 6660 599 691225145 3473403 51 427200630 1326718 2146678 100848386 1569 27 163176119 193562 10784 45687 819951 38520653 225 119620 1 3 691225169 691225164 17445 23807072 1 9093493 5620082 2542 139 14",
"output": "YES"
},
{
"input": "44\n165580141 21 34 55 1 89 144 17711 2 377 610 987 2584 13 5 4181 6765 10946 1597 8 28657 3 233 75025 121393 196418 317811 9227465 832040 1346269 2178309 3524578 5702887 1 14930352 102334155 24157817 39088169 63245986 701408733 267914296 433494437 514229 46368",
"output": "NO"
},
{
"input": "3\n1 1000000000 999999999",
"output": "NO"
},
{
"input": "5\n1 1 1 1 1",
"output": "YES"
},
{
"input": "10\n1 10 100 1000 10000 100000 1000000 10000000 100000000 1000000000",
"output": "NO"
},
{
"input": "5\n2 3 4 10 20",
"output": "YES"
},
{
"input": "6\n18 23 40 80 160 161",
"output": "YES"
},
{
"input": "4\n5 6 7 888",
"output": "YES"
},
{
"input": "9\n1 1 2 2 4 5 10 10 20",
"output": "YES"
},
{
"input": "7\n3 150 900 4 500 1500 5",
"output": "YES"
},
{
"input": "3\n2 2 3",
"output": "YES"
},
{
"input": "7\n1 2 100 200 250 1000000 2000000",
"output": "YES"
},
{
"input": "8\n2 3 5 5 5 6 6 13",
"output": "YES"
},
{
"input": "3\n2 3 4",
"output": "YES"
},
{
"input": "6\n1 1 1 4 5 100",
"output": "YES"
},
{
"input": "13\n1 2 3 5 8 13 22 34 55 89 144 233 377",
"output": "YES"
},
{
"input": "4\n2 3 4 8",
"output": "YES"
},
{
"input": "3\n5 6 7",
"output": "YES"
},
{
"input": "5\n1 4 5 6 1000000",
"output": "YES"
},
{
"input": "4\n5 6 7 20",
"output": "YES"
},
{
"input": "6\n1 1 1 1 1 65",
"output": "YES"
},
{
"input": "4\n3 4 5 100",
"output": "YES"
},
{
"input": "3\n2 4 5",
"output": "YES"
},
{
"input": "7\n1 1 1 1 1 10 1000",
"output": "YES"
},
{
"input": "4\n1 1 2 3",
"output": "NO"
},
{
"input": "11\n1 2 5 6 7 8 9 17 18 19 100",
"output": "YES"
},
{
"input": "4\n5 16 20 200",
"output": "YES"
},
{
"input": "5\n17 6 3 3 1",
"output": "YES"
},
{
"input": "3\n1 1 1",
"output": "YES"
},
{
"input": "6\n1 1 1 2 3 5",
"output": "YES"
},
{
"input": "4\n2 4 6 6",
"output": "YES"
},
{
"input": "9\n1 2 4 4 4 4 7 8 20",
"output": "YES"
},
{
"input": "9\n1 1 2 5 5 5 10 10 20",
"output": "YES"
},
{
"input": "7\n3 150 600 4 1700 6000 5",
"output": "YES"
},
{
"input": "5\n5761 20966 27841 28800 29399",
"output": "YES"
},
{
"input": "9\n1 2 3 6 7 10 11 12 24",
"output": "YES"
},
{
"input": "4\n1 2 1 1",
"output": "YES"
},
{
"input": "5\n1 1 2 3 4",
"output": "YES"
}
] | 1,682,181,579
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 20
| 217
| 13,414,400
|
n = int(input())
a = list(map(int , input().split()))
a.sort();a.reverse();
for i in range(len(a)-2):
p=a[i];q=a[i+1];r=a[i+2]
if q+r>p:
print('YES')
break
else:
print('NO')
break
|
Title: Mahmoud and a Triangle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mahmoud has *n* line segments, the *i*-th of them has length *a**i*. Ehab challenged him to use exactly 3 line segments to form a non-degenerate triangle. Mahmoud doesn't accept challenges unless he is sure he can win, so he asked you to tell him if he should accept the challenge. Given the lengths of the line segments, check if he can choose exactly 3 of them to form a non-degenerate triangle.
Mahmoud should use exactly 3 line segments, he can't concatenate two line segments or change any length. A non-degenerate triangle is a triangle with positive area.
Input Specification:
The first line contains single integer *n* (3<=≤<=*n*<=≤<=105) — the number of line segments Mahmoud has.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the lengths of line segments Mahmoud has.
Output Specification:
In the only line print "YES" if he can choose exactly three line segments and form a non-degenerate triangle with them, and "NO" otherwise.
Demo Input:
['5\n1 5 3 2 4\n', '3\n4 1 2\n']
Demo Output:
['YES\n', 'NO\n']
Note:
For the first example, he can use line segments with lengths 2, 4 and 5 to form a non-degenerate triangle.
|
```python
n = int(input())
a = list(map(int , input().split()))
a.sort();a.reverse();
for i in range(len(a)-2):
p=a[i];q=a[i+1];r=a[i+2]
if q+r>p:
print('YES')
break
else:
print('NO')
break
```
| 0
|
|
260
|
A
|
Adding Digits
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
Vasya has got two number: *a* and *b*. However, Vasya finds number *a* too short. So he decided to repeat the operation of lengthening number *a* *n* times.
One operation of lengthening a number means adding exactly one digit to the number (in the decimal notation) to the right provided that the resulting number is divisible by Vasya's number *b*. If it is impossible to obtain the number which is divisible by *b*, then the lengthening operation cannot be performed.
Your task is to help Vasya and print the number he can get after applying the lengthening operation to number *a* *n* times.
|
The first line contains three integers: *a*,<=*b*,<=*n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=105).
|
In a single line print the integer without leading zeros, which Vasya can get when he applies the lengthening operations to number *a* *n* times. If no such number exists, then print number -1. If there are multiple possible answers, print any of them.
|
[
"5 4 5\n",
"12 11 1\n",
"260 150 10\n"
] |
[
"524848\n",
"121\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "5 4 5",
"output": "524848"
},
{
"input": "12 11 1",
"output": "121"
},
{
"input": "260 150 10",
"output": "-1"
},
{
"input": "78843 5684 42717",
"output": "-1"
},
{
"input": "93248 91435 1133",
"output": "-1"
},
{
"input": "100000 10 64479",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99999 21 73839",
"output": "9999990000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99991 623 36438",
"output": "9999150000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99999 334 94854",
"output": "9999960000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99252 9827 84849",
"output": "9925270000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99313 9833 10561",
"output": "9931330000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "94885 55815 11417",
"output": "9488550000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99492 58525 53481",
"output": "9949250000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99858 28531 79193",
"output": "9985850000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99136 47208 42607",
"output": "9913680000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "63270 19953 5555",
"output": "-1"
},
{
"input": "10240 128 100000",
"output": "1024000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "12 11 3",
"output": "12100"
},
{
"input": "14 12 99998",
"output": "1440000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "1 11 3",
"output": "1100"
},
{
"input": "3 40 1",
"output": "-1"
},
{
"input": "150 100 10",
"output": "1500000000000"
},
{
"input": "5 10 1",
"output": "50"
},
{
"input": "1 15 10",
"output": "15000000000"
},
{
"input": "3 13 2",
"output": "390"
}
] | 1,686,790,299
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 5
| 46
| 2,764,800
|
a,b,n=map(int,input().split())
no=a*10
f=False
for i in range(0,10):
no+=1
if no%b==0:
print(no * (10 ** (n-1)))
f=True
break
if not f:
print(-1)
|
Title: Adding Digits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has got two number: *a* and *b*. However, Vasya finds number *a* too short. So he decided to repeat the operation of lengthening number *a* *n* times.
One operation of lengthening a number means adding exactly one digit to the number (in the decimal notation) to the right provided that the resulting number is divisible by Vasya's number *b*. If it is impossible to obtain the number which is divisible by *b*, then the lengthening operation cannot be performed.
Your task is to help Vasya and print the number he can get after applying the lengthening operation to number *a* *n* times.
Input Specification:
The first line contains three integers: *a*,<=*b*,<=*n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=105).
Output Specification:
In a single line print the integer without leading zeros, which Vasya can get when he applies the lengthening operations to number *a* *n* times. If no such number exists, then print number -1. If there are multiple possible answers, print any of them.
Demo Input:
['5 4 5\n', '12 11 1\n', '260 150 10\n']
Demo Output:
['524848\n', '121\n', '-1\n']
Note:
none
|
```python
a,b,n=map(int,input().split())
no=a*10
f=False
for i in range(0,10):
no+=1
if no%b==0:
print(no * (10 ** (n-1)))
f=True
break
if not f:
print(-1)
```
| 0
|
|
52
|
A
|
123-sequence
|
PROGRAMMING
| 900
|
[
"implementation"
] |
A. 123-sequence
|
2
|
256
|
There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3).
|
Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal.
|
[
"9\n1 3 2 2 2 1 1 2 3\n"
] |
[
"5\n"
] |
In the example all the numbers equal to 1 and 3 should be replaced by 2.
| 500
|
[
{
"input": "9\n1 3 2 2 2 1 1 2 3",
"output": "5"
},
{
"input": "6\n3 3 2 2 1 3",
"output": "3"
},
{
"input": "12\n3 1 3 1 2 1 3 2 2 1 2 1",
"output": "7"
},
{
"input": "15\n3 2 1 1 1 1 3 2 2 3 3 1 2 3 2",
"output": "10"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n3 2",
"output": "1"
},
{
"input": "2\n3 1",
"output": "1"
},
{
"input": "18\n2 3 2 1 2 3 2 1 2 3 3 3 1 2 3 3 3 2",
"output": "10"
},
{
"input": "30\n2 1 3 2 3 2 2 2 2 3 2 2 3 2 1 1 3 1 3 2 1 2 3 1 1 3 3 1 3 1",
"output": "19"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
}
] | 1,673,819,007
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 23
| 186
| 7,782,400
|
n = int(input())
s = input()
frq = [0]*3
for i in s:
if i==' ':continue
frq[ord(i)-ord('1')] +=1
print(n-max(frq))
|
Title: 123-sequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3).
Output Specification:
Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal.
Demo Input:
['9\n1 3 2 2 2 1 1 2 3\n']
Demo Output:
['5\n']
Note:
In the example all the numbers equal to 1 and 3 should be replaced by 2.
|
```python
n = int(input())
s = input()
frq = [0]*3
for i in s:
if i==' ':continue
frq[ord(i)-ord('1')] +=1
print(n-max(frq))
```
| 3.939004
|
1
|
B
|
Spreadsheet
|
PROGRAMMING
| 1,600
|
[
"implementation",
"math"
] |
B. Spreadsheets
|
10
|
64
|
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second — number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 — AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc.
The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23.
Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example.
Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
|
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
|
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
|
[
"2\nR23C55\nBC23\n"
] |
[
"BC23\nR23C55\n"
] |
none
| 0
|
[
{
"input": "2\nR23C55\nBC23",
"output": "BC23\nR23C55"
},
{
"input": "1\nA1",
"output": "R1C1"
},
{
"input": "5\nR8C3\nD1\nR7C2\nR8C9\nR8C9",
"output": "C8\nR1C4\nB7\nI8\nI8"
},
{
"input": "4\nR4C25\nR90C35\nAP55\nX83",
"output": "Y4\nAI90\nR55C42\nR83C24"
},
{
"input": "10\nR50C12\nR23C47\nY96\nR44C13\nR19C21\nR95C73\nBK12\nR51C74\nAY34\nR63C25",
"output": "L50\nAU23\nR96C25\nM44\nU19\nBU95\nR12C63\nBV51\nR34C51\nY63"
}
] | 1,695,736,169
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 716,800
|
import re
n = int(input())
arr = []
for i in range(n):
s = input()
try:
row, column = re.match(r'R(\d+)C(\d+)', s).groups()
column_letters = ''
while column > 0:
column -= 1
column_letters = chr((column % 26) + 65) + column_letters
column //= 26
print(f'{column_letters}{row}')
except:
column, row = re.match(r'([A-Z]+)(\d+)', s).groups()
column_number = sum((ord(c) - 64) * (26 ** i) for i, c in enumerate(reversed(column)))
print(f'R{row}C{column_number}')
|
Title: Spreadsheet
Time Limit: 10 seconds
Memory Limit: 64 megabytes
Problem Description:
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second — number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 — AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc.
The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23.
Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example.
Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
Input Specification:
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
Output Specification:
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
Demo Input:
['2\nR23C55\nBC23\n']
Demo Output:
['BC23\nR23C55\n']
Note:
none
|
```python
import re
n = int(input())
arr = []
for i in range(n):
s = input()
try:
row, column = re.match(r'R(\d+)C(\d+)', s).groups()
column_letters = ''
while column > 0:
column -= 1
column_letters = chr((column % 26) + 65) + column_letters
column //= 26
print(f'{column_letters}{row}')
except:
column, row = re.match(r'([A-Z]+)(\d+)', s).groups()
column_number = sum((ord(c) - 64) * (26 ** i) for i, c in enumerate(reversed(column)))
print(f'R{row}C{column_number}')
```
| 0
|
318
|
B
|
Strings of Power
|
PROGRAMMING
| 1,300
|
[
"implementation",
"strings",
"two pointers"
] | null | null |
Volodya likes listening to heavy metal and (occasionally) reading. No wonder Volodya is especially interested in texts concerning his favourite music style.
Volodya calls a string powerful if it starts with "heavy" and ends with "metal". Finding all powerful substrings (by substring Volodya means a subsequence of consecutive characters in a string) in a given text makes our hero especially joyful. Recently he felt an enormous fit of energy while reading a certain text. So Volodya decided to count all powerful substrings in this text and brag about it all day long. Help him in this difficult task. Two substrings are considered different if they appear at the different positions in the text.
For simplicity, let us assume that Volodya's text can be represented as a single string.
|
Input contains a single non-empty string consisting of the lowercase Latin alphabet letters. Length of this string will not be greater than 106 characters.
|
Print exactly one number — the number of powerful substrings of the given string.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"heavymetalisheavymetal\n",
"heavymetalismetal\n",
"trueheavymetalissotruewellitisalsosoheavythatyoucanalmostfeeltheweightofmetalonyou\n"
] |
[
"3",
"2",
"3"
] |
In the first sample the string "heavymetalisheavymetal" contains powerful substring "heavymetal" twice, also the whole string "heavymetalisheavymetal" is certainly powerful.
In the second sample the string "heavymetalismetal" contains two powerful substrings: "heavymetal" and "heavymetalismetal".
| 500
|
[
{
"input": "heavymetalisheavymetal",
"output": "3"
},
{
"input": "heavymetalismetal",
"output": "2"
},
{
"input": "trueheavymetalissotruewellitisalsosoheavythatyoucanalmostfeeltheweightofmetalonyou",
"output": "3"
},
{
"input": "fpgzbvhheavymheheavyzmheavyavyebknkhheavyhsbqmmetheavyalmetalheavyyomtua",
"output": "5"
},
{
"input": "metametaheavyetalalmetalavylkeoheavyhemetaleavycdk",
"output": "3"
},
{
"input": "hg",
"output": "0"
}
] | 1,693,241,277
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 122
| 0
|
s = input()
n = len(s)
count = 0
left = 0
right = 0
while right < n:
if s[right:right+5] == "heavy":
while s[left:left+5] != "heavy":
left += 1
count += 1
left += 5
right += 1
print(count + 1)
|
Title: Strings of Power
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Volodya likes listening to heavy metal and (occasionally) reading. No wonder Volodya is especially interested in texts concerning his favourite music style.
Volodya calls a string powerful if it starts with "heavy" and ends with "metal". Finding all powerful substrings (by substring Volodya means a subsequence of consecutive characters in a string) in a given text makes our hero especially joyful. Recently he felt an enormous fit of energy while reading a certain text. So Volodya decided to count all powerful substrings in this text and brag about it all day long. Help him in this difficult task. Two substrings are considered different if they appear at the different positions in the text.
For simplicity, let us assume that Volodya's text can be represented as a single string.
Input Specification:
Input contains a single non-empty string consisting of the lowercase Latin alphabet letters. Length of this string will not be greater than 106 characters.
Output Specification:
Print exactly one number — the number of powerful substrings of the given string.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['heavymetalisheavymetal\n', 'heavymetalismetal\n', 'trueheavymetalissotruewellitisalsosoheavythatyoucanalmostfeeltheweightofmetalonyou\n']
Demo Output:
['3', '2', '3']
Note:
In the first sample the string "heavymetalisheavymetal" contains powerful substring "heavymetal" twice, also the whole string "heavymetalisheavymetal" is certainly powerful.
In the second sample the string "heavymetalismetal" contains two powerful substrings: "heavymetal" and "heavymetalismetal".
|
```python
s = input()
n = len(s)
count = 0
left = 0
right = 0
while right < n:
if s[right:right+5] == "heavy":
while s[left:left+5] != "heavy":
left += 1
count += 1
left += 5
right += 1
print(count + 1)
```
| 0
|
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,616,225,262
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 343
| 409,600
|
n=int(input())
for i in range(1,n+1):
if(i%4==1 or i%4==2):
print('a',end='')
elif(i%4==0 or i%4==3):
print('b',end='')
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
n=int(input())
for i in range(1,n+1):
if(i%4==1 or i%4==2):
print('a',end='')
elif(i%4==0 or i%4==3):
print('b',end='')
```
| 3
|
|
811
|
B
|
Vladik and Complicated Book
|
PROGRAMMING
| 1,200
|
[
"implementation",
"sortings"
] | null | null |
Vladik had started reading a complicated book about algorithms containing *n* pages. To improve understanding of what is written, his friends advised him to read pages in some order given by permutation *P*<==<=[*p*1,<=*p*2,<=...,<=*p**n*], where *p**i* denotes the number of page that should be read *i*-th in turn.
Sometimes Vladik’s mom sorted some subsegment of permutation *P* from position *l* to position *r* inclusive, because she loves the order. For every of such sorting Vladik knows number *x* — what index of page in permutation he should read. He is wondered if the page, which he will read after sorting, has changed. In other words, has *p**x* changed? After every sorting Vladik return permutation to initial state, so you can assume that each sorting is independent from each other.
|
First line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=104) — length of permutation and number of times Vladik's mom sorted some subsegment of the book.
Second line contains *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=*n*) — permutation *P*. Note that elements in permutation are distinct.
Each of the next *m* lines contains three space-separated integers *l**i*, *r**i*, *x**i* (1<=≤<=*l**i*<=≤<=*x**i*<=≤<=*r**i*<=≤<=*n*) — left and right borders of sorted subsegment in *i*-th sorting and position that is interesting to Vladik.
|
For each mom’s sorting on it’s own line print "Yes", if page which is interesting to Vladik hasn't changed, or "No" otherwise.
|
[
"5 5\n5 4 3 2 1\n1 5 3\n1 3 1\n2 4 3\n4 4 4\n2 5 3\n",
"6 5\n1 4 3 2 5 6\n2 4 3\n1 6 2\n4 5 4\n1 3 3\n2 6 3\n"
] |
[
"Yes\nNo\nYes\nYes\nNo\n",
"Yes\nNo\nYes\nNo\nYes\n"
] |
Explanation of first test case:
1. [1, 2, 3, 4, 5] — permutation after sorting, 3-rd element hasn’t changed, so answer is "Yes". 1. [3, 4, 5, 2, 1] — permutation after sorting, 1-st element has changed, so answer is "No". 1. [5, 2, 3, 4, 1] — permutation after sorting, 3-rd element hasn’t changed, so answer is "Yes". 1. [5, 4, 3, 2, 1] — permutation after sorting, 4-th element hasn’t changed, so answer is "Yes". 1. [5, 1, 2, 3, 4] — permutation after sorting, 3-rd element has changed, so answer is "No".
| 1,000
|
[
{
"input": "5 5\n5 4 3 2 1\n1 5 3\n1 3 1\n2 4 3\n4 4 4\n2 5 3",
"output": "Yes\nNo\nYes\nYes\nNo"
},
{
"input": "6 5\n1 4 3 2 5 6\n2 4 3\n1 6 2\n4 5 4\n1 3 3\n2 6 3",
"output": "Yes\nNo\nYes\nNo\nYes"
},
{
"input": "10 10\n10 1 6 7 9 8 4 3 5 2\n1 1 1\n4 4 4\n7 7 7\n3 3 3\n1 6 5\n2 6 2\n6 8 7\n1 1 1\n7 9 9\n2 9 4",
"output": "Yes\nYes\nYes\nYes\nYes\nYes\nYes\nYes\nYes\nNo"
},
{
"input": "20 20\n18 17 2 3 16 15 1 9 12 8 20 11 13 14 4 5 19 7 10 6\n13 15 15\n1 1 1\n2 2 2\n11 14 13\n10 11 10\n2 8 6\n12 18 16\n4 8 8\n2 2 2\n5 11 11\n4 9 9\n5 6 6\n3 20 12\n8 8 8\n6 16 11\n9 18 18\n8 18 17\n1 1 1\n2 6 5\n1 4 3",
"output": "No\nYes\nYes\nNo\nYes\nYes\nNo\nNo\nYes\nYes\nNo\nNo\nNo\nYes\nNo\nNo\nYes\nYes\nYes\nNo"
},
{
"input": "5 10\n5 4 3 2 1\n1 5 3\n1 3 1\n2 4 3\n4 4 4\n2 5 3\n1 5 3\n1 3 1\n2 4 3\n4 4 4\n2 5 3",
"output": "Yes\nNo\nYes\nYes\nNo\nYes\nNo\nYes\nYes\nNo"
}
] | 1,499,170,750
| 4,750
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 4,608,000
|
n, m = map(int, input().split())
val = list(map(int, input().split()))
pos = {}
for i in range(n):
pos[val[i]] = i+1
for i in range(m):
l, r, x = map(int, input().split())
count = 0
for j in range(l, r+1):
if j < x and pos[j] > pos[x]:
count += 1
elif j > x and pos[j] < pos[x]:
count -= 1
if count == 0:
print ("YES")
else:
print ("NO")
|
Title: Vladik and Complicated Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vladik had started reading a complicated book about algorithms containing *n* pages. To improve understanding of what is written, his friends advised him to read pages in some order given by permutation *P*<==<=[*p*1,<=*p*2,<=...,<=*p**n*], where *p**i* denotes the number of page that should be read *i*-th in turn.
Sometimes Vladik’s mom sorted some subsegment of permutation *P* from position *l* to position *r* inclusive, because she loves the order. For every of such sorting Vladik knows number *x* — what index of page in permutation he should read. He is wondered if the page, which he will read after sorting, has changed. In other words, has *p**x* changed? After every sorting Vladik return permutation to initial state, so you can assume that each sorting is independent from each other.
Input Specification:
First line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=104) — length of permutation and number of times Vladik's mom sorted some subsegment of the book.
Second line contains *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=*n*) — permutation *P*. Note that elements in permutation are distinct.
Each of the next *m* lines contains three space-separated integers *l**i*, *r**i*, *x**i* (1<=≤<=*l**i*<=≤<=*x**i*<=≤<=*r**i*<=≤<=*n*) — left and right borders of sorted subsegment in *i*-th sorting and position that is interesting to Vladik.
Output Specification:
For each mom’s sorting on it’s own line print "Yes", if page which is interesting to Vladik hasn't changed, or "No" otherwise.
Demo Input:
['5 5\n5 4 3 2 1\n1 5 3\n1 3 1\n2 4 3\n4 4 4\n2 5 3\n', '6 5\n1 4 3 2 5 6\n2 4 3\n1 6 2\n4 5 4\n1 3 3\n2 6 3\n']
Demo Output:
['Yes\nNo\nYes\nYes\nNo\n', 'Yes\nNo\nYes\nNo\nYes\n']
Note:
Explanation of first test case:
1. [1, 2, 3, 4, 5] — permutation after sorting, 3-rd element hasn’t changed, so answer is "Yes". 1. [3, 4, 5, 2, 1] — permutation after sorting, 1-st element has changed, so answer is "No". 1. [5, 2, 3, 4, 1] — permutation after sorting, 3-rd element hasn’t changed, so answer is "Yes". 1. [5, 4, 3, 2, 1] — permutation after sorting, 4-th element hasn’t changed, so answer is "Yes". 1. [5, 1, 2, 3, 4] — permutation after sorting, 3-rd element has changed, so answer is "No".
|
```python
n, m = map(int, input().split())
val = list(map(int, input().split()))
pos = {}
for i in range(n):
pos[val[i]] = i+1
for i in range(m):
l, r, x = map(int, input().split())
count = 0
for j in range(l, r+1):
if j < x and pos[j] > pos[x]:
count += 1
elif j > x and pos[j] < pos[x]:
count -= 1
if count == 0:
print ("YES")
else:
print ("NO")
```
| 0
|
|
656
|
E
|
Out of Controls
|
PROGRAMMING
| 2,000
|
[
"*special"
] | null | null |
You are given a complete undirected graph. For each pair of vertices you are given the length of the edge that connects them. Find the shortest paths between each pair of vertices in the graph and return the length of the longest of them.
|
The first line of the input contains a single integer *N* (3<=≤<=*N*<=≤<=10).
The following *N* lines each contain *N* space-separated integers. *j*th integer in *i*th line *a**ij* is the length of the edge that connects vertices *i* and *j*. *a**ij*<==<=*a**ji*, *a**ii*<==<=0, 1<=≤<=*a**ij*<=≤<=100 for *i*<=≠<=*j*.
|
Output the maximum length of the shortest path between any pair of vertices in the graph.
|
[
"3\n0 1 1\n1 0 4\n1 4 0\n",
"4\n0 1 2 3\n1 0 4 5\n2 4 0 6\n3 5 6 0\n"
] |
[
"2\n",
"5\n"
] |
You're running short of keywords, so you can't use some of them:
| 0
|
[
{
"input": "3\n0 1 1\n1 0 4\n1 4 0",
"output": "2"
},
{
"input": "4\n0 1 2 3\n1 0 4 5\n2 4 0 6\n3 5 6 0",
"output": "5"
},
{
"input": "10\n0 16 67 7 82 44 25 13 25 42\n16 0 24 37 63 20 19 87 55 99\n67 24 0 81 19 71 35 6 20 91\n7 37 81 0 82 89 34 80 7 32\n82 63 19 82 0 42 66 96 42 99\n44 20 71 89 42 0 65 94 24 45\n25 19 35 34 66 65 0 97 100 22\n13 87 6 80 96 94 97 0 10 58\n25 55 20 7 42 24 100 10 0 29\n42 99 91 32 99 45 22 58 29 0",
"output": "64"
},
{
"input": "10\n0 1 1 1 1 1 1 1 1 100\n1 0 1 1 1 1 1 1 1 1\n1 1 0 1 1 1 1 1 1 1\n1 1 1 0 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1\n1 1 1 1 1 0 1 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 1 0 1 1\n1 1 1 1 1 1 1 1 0 1\n100 1 1 1 1 1 1 1 1 0",
"output": "2"
},
{
"input": "10\n0 1 100 100 100 100 100 100 100 100\n1 0 1 100 100 100 100 100 100 100\n100 1 0 1 100 100 100 100 100 100\n100 100 1 0 1 100 100 100 100 100\n100 100 100 1 0 1 100 100 100 100\n100 100 100 100 1 0 1 100 100 100\n100 100 100 100 100 1 0 1 100 100\n100 100 100 100 100 100 1 0 1 100\n100 100 100 100 100 100 100 1 0 1\n100 100 100 100 100 100 100 100 1 0",
"output": "9"
},
{
"input": "3\n0 1 1\n1 0 1\n1 1 0",
"output": "1"
},
{
"input": "6\n0 74 60 92 18 86\n74 0 96 55 30 81\n60 96 0 6 28 30\n92 55 6 0 5 89\n18 30 28 5 0 11\n86 81 30 89 11 0",
"output": "48"
},
{
"input": "6\n0 92 9 24 50 94\n92 0 70 73 57 87\n9 70 0 31 14 100\n24 73 31 0 66 25\n50 57 14 66 0 81\n94 87 100 25 81 0",
"output": "87"
},
{
"input": "8\n0 6 39 40 67 19 77 93\n6 0 25 9 67 48 26 65\n39 25 0 72 62 45 26 88\n40 9 72 0 69 19 88 4\n67 67 62 69 0 2 51 1\n19 48 45 19 2 0 60 14\n77 26 26 88 51 60 0 1\n93 65 88 4 1 14 1 0",
"output": "31"
},
{
"input": "6\n0 67 17 21 20 86\n67 0 32 80 24 36\n17 32 0 20 37 90\n21 80 20 0 58 98\n20 24 37 58 0 22\n86 36 90 98 22 0",
"output": "63"
},
{
"input": "8\n0 12 11 41 75 73 22 1\n12 0 84 11 48 5 68 87\n11 84 0 85 87 64 14 5\n41 11 85 0 75 13 36 11\n75 48 87 75 0 41 15 14\n73 5 64 13 41 0 63 50\n22 68 14 36 15 63 0 90\n1 87 5 11 14 50 90 0",
"output": "37"
},
{
"input": "4\n0 98 25 16\n98 0 89 1\n25 89 0 2\n16 1 2 0",
"output": "18"
},
{
"input": "4\n0 59 70 47\n59 0 63 78\n70 63 0 93\n47 78 93 0",
"output": "93"
},
{
"input": "10\n0 62 27 62 65 11 82 74 46 40\n62 0 8 11 15 28 83 3 14 26\n27 8 0 21 14 12 69 52 26 41\n62 11 21 0 34 35 9 71 100 15\n65 15 14 34 0 95 13 69 20 65\n11 28 12 35 95 0 35 19 57 40\n82 83 69 9 13 35 0 21 97 12\n74 3 52 71 69 19 21 0 82 62\n46 14 26 100 20 57 97 82 0 96\n40 26 41 15 65 40 12 62 96 0",
"output": "46"
},
{
"input": "6\n0 45 91 95 34 82\n45 0 73 77 9 38\n91 73 0 61 74 71\n95 77 61 0 93 17\n34 9 74 93 0 73\n82 38 71 17 73 0",
"output": "95"
},
{
"input": "9\n0 62 15 44 79 3 30 46 49\n62 0 79 42 86 71 78 68 98\n15 79 0 2 34 34 97 71 76\n44 42 2 0 11 76 4 64 25\n79 86 34 11 0 45 48 75 81\n3 71 34 76 45 0 73 5 40\n30 78 97 4 48 73 0 50 16\n46 68 71 64 75 5 50 0 14\n49 98 76 25 81 40 16 14 0",
"output": "67"
},
{
"input": "9\n0 76 66 78 46 55 92 18 81\n76 0 99 62 23 53 45 41 10\n66 99 0 18 3 37 34 26 91\n78 62 18 0 98 36 59 5 27\n46 23 3 98 0 79 92 9 39\n55 53 37 36 79 0 89 60 25\n92 45 34 59 92 89 0 26 94\n18 41 26 5 9 60 26 0 19\n81 10 91 27 39 25 94 19 0",
"output": "67"
},
{
"input": "10\n0 27 56 32 37 99 71 93 98 50\n27 0 21 57 7 77 88 40 90 81\n56 21 0 20 45 98 82 69 15 23\n32 57 20 0 15 74 72 95 49 56\n37 7 45 15 0 25 17 60 7 80\n99 77 98 74 25 0 80 62 31 63\n71 88 82 72 17 80 0 38 43 9\n93 40 69 95 60 62 38 0 7 53\n98 90 15 49 7 31 43 7 0 48\n50 81 23 56 80 63 9 53 48 0",
"output": "59"
},
{
"input": "6\n0 41 81 77 80 79\n41 0 64 36 15 77\n81 64 0 36 89 40\n77 36 36 0 59 70\n80 15 89 59 0 90\n79 77 40 70 90 0",
"output": "90"
},
{
"input": "3\n0 35 50\n35 0 28\n50 28 0",
"output": "50"
},
{
"input": "8\n0 73 45 10 61 98 24 80\n73 0 47 29 65 96 46 36\n45 47 0 63 48 19 57 99\n10 29 63 0 11 13 79 84\n61 65 48 11 0 60 71 27\n98 96 19 13 60 0 41 44\n24 46 57 79 71 41 0 13\n80 36 99 84 27 44 13 0",
"output": "63"
},
{
"input": "3\n0 72 17\n72 0 8\n17 8 0",
"output": "25"
},
{
"input": "7\n0 50 95 10 100 75 71\n50 0 53 70 70 26 91\n95 53 0 16 33 90 98\n10 70 16 0 43 48 87\n100 70 33 43 0 63 34\n75 26 90 48 63 0 17\n71 91 98 87 34 17 0",
"output": "71"
},
{
"input": "3\n0 86 45\n86 0 54\n45 54 0",
"output": "86"
},
{
"input": "7\n0 67 86 9 33 16 99\n67 0 77 68 97 59 33\n86 77 0 37 11 83 99\n9 68 37 0 51 27 70\n33 97 11 51 0 32 91\n16 59 83 27 32 0 71\n99 33 99 70 91 71 0",
"output": "99"
},
{
"input": "6\n0 41 48 86 94 14\n41 0 1 30 59 39\n48 1 0 9 31 49\n86 30 9 0 48 30\n94 59 31 48 0 33\n14 39 49 30 33 0",
"output": "47"
},
{
"input": "6\n0 44 27 40 72 96\n44 0 87 1 83 45\n27 87 0 43 81 64\n40 1 43 0 89 90\n72 83 81 89 0 37\n96 45 64 90 37 0",
"output": "86"
},
{
"input": "9\n0 89 47 24 63 68 12 27 61\n89 0 48 62 96 82 74 99 47\n47 48 0 72 63 47 25 95 72\n24 62 72 0 54 93 10 95 88\n63 96 63 54 0 19 6 18 3\n68 82 47 93 19 0 68 98 30\n12 74 25 10 6 68 0 21 88\n27 99 95 95 18 98 21 0 3\n61 47 72 88 3 30 88 3 0",
"output": "69"
},
{
"input": "9\n0 83 88 2 30 55 89 28 96\n83 0 46 27 71 81 81 37 86\n88 46 0 11 28 55 7 71 31\n2 27 11 0 27 65 24 94 23\n30 71 28 27 0 16 57 18 88\n55 81 55 65 16 0 68 92 71\n89 81 7 24 57 68 0 29 70\n28 37 71 94 18 92 29 0 21\n96 86 31 23 88 71 70 21 0",
"output": "70"
},
{
"input": "9\n0 29 71 8 12 39 50 26 21\n29 0 76 87 29 91 99 94 57\n71 76 0 74 12 38 24 46 49\n8 87 74 0 62 22 23 44 25\n12 29 12 62 0 97 38 47 39\n39 91 38 22 97 0 69 62 50\n50 99 24 23 38 69 0 4 75\n26 94 46 44 47 62 4 0 100\n21 57 49 25 39 50 75 100 0",
"output": "59"
},
{
"input": "10\n0 65 97 17 34 86 3 22 92 98\n65 0 71 14 76 35 22 69 82 89\n97 71 0 58 6 62 45 100 76 14\n17 14 58 0 100 42 83 3 1 21\n34 76 6 100 0 15 90 77 69 32\n86 35 62 42 15 0 3 96 40 6\n3 22 45 83 90 3 0 65 28 87\n22 69 100 3 77 96 65 0 70 73\n92 82 76 1 69 40 28 70 0 39\n98 89 14 21 32 6 87 73 39 0",
"output": "45"
},
{
"input": "8\n0 24 87 58 2 2 69 62\n24 0 58 43 98 29 18 33\n87 58 0 71 43 37 4 31\n58 43 71 0 30 77 19 46\n2 98 43 30 0 48 18 64\n2 29 37 77 48 0 57 77\n69 18 4 19 18 57 0 52\n62 33 31 46 64 77 52 0",
"output": "57"
},
{
"input": "3\n0 99 73\n99 0 8\n73 8 0",
"output": "81"
},
{
"input": "7\n0 41 2 49 25 23 43\n41 0 21 3 1 35 74\n2 21 0 63 45 6 55\n49 3 63 0 90 92 9\n25 1 45 90 0 11 11\n23 35 6 92 11 0 77\n43 74 55 9 11 77 0",
"output": "30"
},
{
"input": "5\n0 92 34 49 44\n92 0 5 54 57\n34 5 0 8 24\n49 54 8 0 76\n44 57 24 76 0",
"output": "44"
},
{
"input": "8\n0 25 9 7 32 10 42 77\n25 0 18 90 53 83 1 50\n9 18 0 21 12 83 68 79\n7 90 21 0 97 67 51 16\n32 53 12 97 0 83 29 6\n10 83 83 67 83 0 50 69\n42 1 68 51 29 50 0 70\n77 50 79 16 6 69 70 0",
"output": "36"
},
{
"input": "5\n0 1 6 73 37\n1 0 4 29 76\n6 4 0 74 77\n73 29 74 0 45\n37 76 77 45 0",
"output": "45"
}
] | 1,459,533,109
| 6,709
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 4,915,200
|
eval("""n = int(input())
a = []
f"""+"""or i in range(n):
a.append(list(map(int, input().split())))
f"""+"""or k in range(n):
f"""+"""or in range(n):
f"""+"""or j in range(n):
a[i][j] = min(a[i][j], a[i][k] + a[k][j])
print(max([max(x) f"""+"""or x in a]))""")
|
Title: Out of Controls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a complete undirected graph. For each pair of vertices you are given the length of the edge that connects them. Find the shortest paths between each pair of vertices in the graph and return the length of the longest of them.
Input Specification:
The first line of the input contains a single integer *N* (3<=≤<=*N*<=≤<=10).
The following *N* lines each contain *N* space-separated integers. *j*th integer in *i*th line *a**ij* is the length of the edge that connects vertices *i* and *j*. *a**ij*<==<=*a**ji*, *a**ii*<==<=0, 1<=≤<=*a**ij*<=≤<=100 for *i*<=≠<=*j*.
Output Specification:
Output the maximum length of the shortest path between any pair of vertices in the graph.
Demo Input:
['3\n0 1 1\n1 0 4\n1 4 0\n', '4\n0 1 2 3\n1 0 4 5\n2 4 0 6\n3 5 6 0\n']
Demo Output:
['2\n', '5\n']
Note:
You're running short of keywords, so you can't use some of them:
|
```python
eval("""n = int(input())
a = []
f"""+"""or i in range(n):
a.append(list(map(int, input().split())))
f"""+"""or k in range(n):
f"""+"""or in range(n):
f"""+"""or j in range(n):
a[i][j] = min(a[i][j], a[i][k] + a[k][j])
print(max([max(x) f"""+"""or x in a]))""")
```
| -1
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,607,407,441
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 186
| 0
|
def iq_test(numbers):
div_arr = [int(i) % 2 for i in numbers.split()]
m = 0
if div_arr.count(1) > div_arr.count(0):
m = 0
else:
m = 1
return div_arr.index(m) + 1
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
def iq_test(numbers):
div_arr = [int(i) % 2 for i in numbers.split()]
m = 0
if div_arr.count(1) > div_arr.count(0):
m = 0
else:
m = 1
return div_arr.index(m) + 1
```
| 0
|
248
|
A
|
Cupboards
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
|
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
|
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
|
[
"5\n0 1\n1 0\n0 1\n1 1\n0 1\n"
] |
[
"3\n"
] |
none
| 500
|
[
{
"input": "5\n0 1\n1 0\n0 1\n1 1\n0 1",
"output": "3"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1\n1 1\n1 1",
"output": "1"
},
{
"input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0",
"output": "7"
},
{
"input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1",
"output": "6"
},
{
"input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "5\n1 0\n1 0\n1 0\n0 1\n0 1",
"output": "4"
}
] | 1,684,480,288
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
n = int(input())
lopen = 0
ropen = 0
ans = 0
for i in range(n):
cb = list(map(int,input().split()))
if cb[0]==1:
lopen+=1
if cb[1]==1:
ropen+=1
if lopen>ropen:
ans+=(ropen+n-lopen)
else:
ans+=(lopen+n-ropen)
print(ans)
|
Title: Cupboards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
Input Specification:
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
Output Specification:
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
Demo Input:
['5\n0 1\n1 0\n0 1\n1 1\n0 1\n']
Demo Output:
['3\n']
Note:
none
|
```python
n = int(input())
lopen = 0
ropen = 0
ans = 0
for i in range(n):
cb = list(map(int,input().split()))
if cb[0]==1:
lopen+=1
if cb[1]==1:
ropen+=1
if lopen>ropen:
ans+=(ropen+n-lopen)
else:
ans+=(lopen+n-ropen)
print(ans)
```
| 0
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,592,166,442
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 12
| 140
| 1,433,600
|
n = int(input())
l = []
for i in range(1, n//2+2):
s = ''
for x in range((n//2+1)-i):
s += '*'
for y in range(i*2-1):
s += 'D'
for z in range((n//2+1)-i):
s += '*'
l.append(s)
m = l[:len(l)-1]
m.reverse()
l += m
for j in l:
print(j)
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
n = int(input())
l = []
for i in range(1, n//2+2):
s = ''
for x in range((n//2+1)-i):
s += '*'
for y in range(i*2-1):
s += 'D'
for z in range((n//2+1)-i):
s += '*'
l.append(s)
m = l[:len(l)-1]
m.reverse()
l += m
for j in l:
print(j)
```
| 3
|
|
686
|
A
|
Free Ice Cream
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
|
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
|
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
|
[
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] |
[
"22 1\n",
"3 2\n"
] |
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
| 500
|
[
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,632,241,563
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 77
| 6,963,200
|
n,x = map(int, input().split())
tot = x
sad = 0
for i in range(n):
ice = input()
sign = ice[0]
number = int(ice[2:])
if sign == '+':
tot += number
elif sign == '-':
if(number > tot):
sad += 1
else:
tot -= number
print(tot, sad)
|
Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
|
```python
n,x = map(int, input().split())
tot = x
sad = 0
for i in range(n):
ice = input()
sign = ice[0]
number = int(ice[2:])
if sign == '+':
tot += number
elif sign == '-':
if(number > tot):
sad += 1
else:
tot -= number
print(tot, sad)
```
| 3
|
|
165
|
A
|
Supercentral Point
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*):
- point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=><=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=<<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=<<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=><=*y*
We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points.
Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
|
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
|
Print the only number — the number of supercentral points of the given set.
|
[
"8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n",
"5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n"
] |
[
"2\n",
"1\n"
] |
In the first sample the supercentral points are only points (1, 1) and (1, 2).
In the second sample there is one supercental point — point (0, 0).
| 500
|
[
{
"input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3",
"output": "2"
},
{
"input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0",
"output": "1"
},
{
"input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1",
"output": "1"
},
{
"input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808",
"output": "7"
},
{
"input": "1\n487 550",
"output": "0"
},
{
"input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676",
"output": "0"
},
{
"input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136",
"output": "8"
},
{
"input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188",
"output": "9"
},
{
"input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191",
"output": "5"
},
{
"input": "4\n1 0\n2 0\n1 1\n1 -1",
"output": "0"
}
] | 1,622,630,144
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 9
| 310
| 1,740,800
|
n=int(input())
mat=[]
for i in range(0,n):
lst = [int(i) for i in input().split()][:n]
mat.append(lst)
count=0
for i in range(0,n):
x,y=mat[i]
right=0
left=0
lower=0
upper=0
for j in range(0,n):
if((y in mat[j]) and (mat[j][0]>x)):
right+=1
if((y in mat[j]) and (mat[j][0]<x)):
left+=1
if((x in mat[j]) and (mat[j][1]<y)):
lower+=1
if((x in mat[j]) and (mat[j][1]>y)):
upper+=1
if(right>0 and left>0 and lower>0 and upper>0):
count=count+1
print(count)
|
Title: Supercentral Point
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*):
- point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=><=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=<<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=<<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=><=*y*
We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points.
Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
Input Specification:
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Output Specification:
Print the only number — the number of supercentral points of the given set.
Demo Input:
['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the supercentral points are only points (1, 1) and (1, 2).
In the second sample there is one supercental point — point (0, 0).
|
```python
n=int(input())
mat=[]
for i in range(0,n):
lst = [int(i) for i in input().split()][:n]
mat.append(lst)
count=0
for i in range(0,n):
x,y=mat[i]
right=0
left=0
lower=0
upper=0
for j in range(0,n):
if((y in mat[j]) and (mat[j][0]>x)):
right+=1
if((y in mat[j]) and (mat[j][0]<x)):
left+=1
if((x in mat[j]) and (mat[j][1]<y)):
lower+=1
if((x in mat[j]) and (mat[j][1]>y)):
upper+=1
if(right>0 and left>0 and lower>0 and upper>0):
count=count+1
print(count)
```
| 0
|
|
909
|
C
|
Python Indentation
|
PROGRAMMING
| 1,800
|
[
"dp"
] | null | null |
In Python, code blocks don't have explicit begin/end or curly braces to mark beginning and end of the block. Instead, code blocks are defined by indentation.
We will consider an extremely simplified subset of Python with only two types of statements.
Simple statements are written in a single line, one per line. An example of a simple statement is assignment.
For statements are compound statements: they contain one or several other statements. For statement consists of a header written in a separate line which starts with "for" prefix, and loop body. Loop body is a block of statements indented one level further than the header of the loop. Loop body can contain both types of statements. Loop body can't be empty.
You are given a sequence of statements without indentation. Find the number of ways in which the statements can be indented to form a valid Python program.
|
The first line contains a single integer *N* (1<=≤<=*N*<=≤<=5000) — the number of commands in the program. *N* lines of the program follow, each line describing a single command. Each command is either "f" (denoting "for statement") or "s" ("simple statement"). It is guaranteed that the last line is a simple statement.
|
Output one line containing an integer - the number of ways the given sequence of statements can be indented modulo 109<=+<=7.
|
[
"4\ns\nf\nf\ns\n",
"4\nf\ns\nf\ns\n"
] |
[
"1\n",
"2\n"
] |
In the first test case, there is only one way to indent the program: the second for statement must be part of the body of the first one.
In the second test case, there are two ways to indent the program: the second for statement can either be part of the first one's body or a separate statement following the first one.
or
| 1,500
|
[
{
"input": "4\ns\nf\nf\ns",
"output": "1"
},
{
"input": "4\nf\ns\nf\ns",
"output": "2"
},
{
"input": "156\nf\ns\nf\ns\nf\ns\ns\ns\ns\nf\ns\ns\nf\nf\ns\nf\nf\nf\nf\ns\ns\ns\nf\ns\ns\nf\nf\nf\nf\nf\nf\ns\ns\ns\ns\nf\ns\nf\ns\nf\ns\nf\nf\nf\nf\ns\ns\nf\nf\ns\ns\ns\ns\nf\ns\nf\ns\nf\ns\nf\ns\ns\ns\nf\ns\ns\nf\ns\nf\nf\ns\ns\ns\nf\nf\nf\nf\ns\ns\nf\nf\nf\nf\nf\nf\nf\ns\nf\ns\ns\ns\nf\nf\ns\ns\ns\ns\ns\nf\nf\nf\nf\ns\nf\nf\ns\nf\ns\ns\nf\nf\nf\ns\ns\ns\nf\ns\ns\nf\ns\nf\nf\nf\ns\nf\nf\ns\ns\nf\ns\nf\nf\ns\ns\ns\ns\nf\ns\nf\nf\ns\ns\nf\nf\nf\ns\ns\nf\nf\nf\ns\nf\ns\nf\nf\ns",
"output": "666443222"
},
{
"input": "4\nf\nf\ns\ns",
"output": "3"
},
{
"input": "2\nf\ns",
"output": "1"
},
{
"input": "1\ns",
"output": "1"
},
{
"input": "3\nf\nf\ns",
"output": "1"
},
{
"input": "2\ns\ns",
"output": "1"
},
{
"input": "156\ns\nf\ns\ns\ns\ns\nf\ns\ns\ns\nf\nf\ns\nf\nf\ns\nf\nf\nf\ns\nf\nf\ns\nf\nf\ns\ns\nf\nf\ns\nf\nf\nf\nf\nf\ns\ns\nf\ns\nf\nf\nf\ns\nf\nf\nf\ns\ns\ns\nf\ns\ns\nf\nf\ns\ns\nf\ns\nf\nf\ns\nf\nf\nf\ns\ns\nf\nf\ns\nf\ns\ns\ns\ns\ns\ns\ns\nf\ns\nf\nf\nf\ns\ns\ns\ns\nf\nf\ns\nf\nf\ns\ns\nf\ns\nf\ns\ns\nf\nf\nf\nf\nf\ns\nf\ns\ns\nf\nf\ns\nf\nf\ns\ns\ns\nf\ns\ns\ns\ns\nf\nf\ns\nf\nf\nf\nf\ns\nf\ns\ns\nf\nf\ns\nf\ns\nf\nf\nf\nf\ns\ns\nf\nf\nf\nf\ns\nf\ns\nf\ns\ns\ns\nf\nf\ns",
"output": "479461584"
},
{
"input": "66\ns\nf\ns\ns\nf\ns\ns\ns\ns\nf\ns\ns\nf\nf\ns\ns\nf\ns\ns\nf\ns\ns\nf\nf\ns\ns\nf\nf\ns\ns\nf\ns\ns\ns\ns\nf\nf\ns\ns\nf\nf\ns\ns\nf\ns\ns\nf\ns\ns\nf\ns\ns\nf\nf\ns\nf\ns\ns\nf\nf\ns\nf\ns\nf\nf\ns",
"output": "392847498"
}
] | 1,514,394,599
| 2,099
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 0
| 30
| 5,529,600
|
def buildConnectionString(params):
"""Build a connection string from a dictionary of parameters.
Returns string."""
return ";".join(["%s=%s" % (k, v) for k, v in params.items()])
|
Title: Python Indentation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Python, code blocks don't have explicit begin/end or curly braces to mark beginning and end of the block. Instead, code blocks are defined by indentation.
We will consider an extremely simplified subset of Python with only two types of statements.
Simple statements are written in a single line, one per line. An example of a simple statement is assignment.
For statements are compound statements: they contain one or several other statements. For statement consists of a header written in a separate line which starts with "for" prefix, and loop body. Loop body is a block of statements indented one level further than the header of the loop. Loop body can contain both types of statements. Loop body can't be empty.
You are given a sequence of statements without indentation. Find the number of ways in which the statements can be indented to form a valid Python program.
Input Specification:
The first line contains a single integer *N* (1<=≤<=*N*<=≤<=5000) — the number of commands in the program. *N* lines of the program follow, each line describing a single command. Each command is either "f" (denoting "for statement") or "s" ("simple statement"). It is guaranteed that the last line is a simple statement.
Output Specification:
Output one line containing an integer - the number of ways the given sequence of statements can be indented modulo 109<=+<=7.
Demo Input:
['4\ns\nf\nf\ns\n', '4\nf\ns\nf\ns\n']
Demo Output:
['1\n', '2\n']
Note:
In the first test case, there is only one way to indent the program: the second for statement must be part of the body of the first one.
In the second test case, there are two ways to indent the program: the second for statement can either be part of the first one's body or a separate statement following the first one.
or
|
```python
def buildConnectionString(params):
"""Build a connection string from a dictionary of parameters.
Returns string."""
return ";".join(["%s=%s" % (k, v) for k, v in params.items()])
```
| 0
|
|
984
|
A
|
Game
|
PROGRAMMING
| 800
|
[
"sortings"
] | null | null |
Two players play a game.
Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns.
The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it.
You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves.
|
The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$).
|
Print one number that will be left on the board.
|
[
"3\n2 1 3\n",
"3\n2 2 2\n"
] |
[
"2",
"2"
] |
In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board.
In the second sample, $2$ is left on the board regardless of the actions of the players.
| 500
|
[
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 2 2",
"output": "2"
},
{
"input": "9\n44 53 51 80 5 27 74 79 94",
"output": "53"
},
{
"input": "10\n38 82 23 37 96 4 81 60 67 86",
"output": "60"
},
{
"input": "10\n58 26 77 15 53 81 68 48 22 65",
"output": "53"
},
{
"input": "1\n124",
"output": "124"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 1 1000",
"output": "1"
},
{
"input": "2\n322 322",
"output": "322"
},
{
"input": "3\n9 92 12",
"output": "12"
},
{
"input": "3\n1 2 2",
"output": "2"
}
] | 1,608,969,359
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 109
| 307,200
|
n = int(input())
lst = sorted(list(map(int, input().split())))
print(lst[n // 2] if n % 2 != 0 else lst[n // 2 - 1])
|
Title: Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players play a game.
Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns.
The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it.
You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves.
Input Specification:
The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$).
Output Specification:
Print one number that will be left on the board.
Demo Input:
['3\n2 1 3\n', '3\n2 2 2\n']
Demo Output:
['2', '2']
Note:
In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board.
In the second sample, $2$ is left on the board regardless of the actions of the players.
|
```python
n = int(input())
lst = sorted(list(map(int, input().split())))
print(lst[n // 2] if n % 2 != 0 else lst[n // 2 - 1])
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,672,500,880
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
n = int(input())
sumx = 0
sumy = 0
sumz = 0
for i in range(n):
x, y, z=input().split()
x = int(x)
y = int(y)
z = int(z)
sumx += x
sumy += y
sumz += z
if sumx == 0 and sumy == 0 and sumz == 0:
print("yes")
else:
print("no")
#1
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n = int(input())
sumx = 0
sumy = 0
sumz = 0
for i in range(n):
x, y, z=input().split()
x = int(x)
y = int(y)
z = int(z)
sumx += x
sumy += y
sumz += z
if sumx == 0 and sumy == 0 and sumz == 0:
print("yes")
else:
print("no")
#1
```
| 0
|
814
|
C
|
An impassioned circulation of affection
|
PROGRAMMING
| 1,600
|
[
"brute force",
"dp",
"strings",
"two pointers"
] | null | null |
Nadeko's birthday is approaching! As she decorated the room for the party, a long garland of Dianthus-shaped paper pieces was placed on a prominent part of the wall. Brother Koyomi will like it!
Still unsatisfied with the garland, Nadeko decided to polish it again. The garland has *n* pieces numbered from 1 to *n* from left to right, and the *i*-th piece has a colour *s**i*, denoted by a lowercase English letter. Nadeko will repaint at most *m* of the pieces to give each of them an arbitrary new colour (still denoted by a lowercase English letter). After this work, she finds out all subsegments of the garland containing pieces of only colour *c* — Brother Koyomi's favourite one, and takes the length of the longest among them to be the Koyomity of the garland.
For instance, let's say the garland is represented by "kooomo", and Brother Koyomi's favourite colour is "o". Among all subsegments containing pieces of "o" only, "ooo" is the longest, with a length of 3. Thus the Koyomity of this garland equals 3.
But problem arises as Nadeko is unsure about Brother Koyomi's favourite colour, and has swaying ideas on the amount of work to do. She has *q* plans on this, each of which can be expressed as a pair of an integer *m**i* and a lowercase letter *c**i*, meanings of which are explained above. You are to find out the maximum Koyomity achievable after repainting the garland according to each plan.
|
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=1<=500) — the length of the garland.
The second line contains *n* lowercase English letters *s*1*s*2... *s**n* as a string — the initial colours of paper pieces on the garland.
The third line contains a positive integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of plans Nadeko has.
The next *q* lines describe one plan each: the *i*-th among them contains an integer *m**i* (1<=≤<=*m**i*<=≤<=*n*) — the maximum amount of pieces to repaint, followed by a space, then by a lowercase English letter *c**i* — Koyomi's possible favourite colour.
|
Output *q* lines: for each work plan, output one line containing an integer — the largest Koyomity achievable after repainting the garland according to it.
|
[
"6\nkoyomi\n3\n1 o\n4 o\n4 m\n",
"15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b\n",
"10\naaaaaaaaaa\n2\n10 b\n10 z\n"
] |
[
"3\n6\n5\n",
"3\n4\n5\n7\n8\n1\n2\n3\n4\n5\n",
"10\n10\n"
] |
In the first sample, there are three plans:
- In the first plan, at most 1 piece can be repainted. Repainting the "y" piece to become "o" results in "kooomi", whose Koyomity of 3 is the best achievable; - In the second plan, at most 4 pieces can be repainted, and "oooooo" results in a Koyomity of 6; - In the third plan, at most 4 pieces can be repainted, and "mmmmmi" and "kmmmmm" both result in a Koyomity of 5.
| 1,750
|
[
{
"input": "6\nkoyomi\n3\n1 o\n4 o\n4 m",
"output": "3\n6\n5"
},
{
"input": "15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b",
"output": "3\n4\n5\n7\n8\n1\n2\n3\n4\n5"
},
{
"input": "10\naaaaaaaaaa\n2\n10 b\n10 z",
"output": "10\n10"
},
{
"input": "1\nc\n4\n1 x\n1 a\n1 e\n1 t",
"output": "1\n1\n1\n1"
},
{
"input": "20\naaaaaaaaaaaaaaaaaaaa\n1\n11 a",
"output": "20"
},
{
"input": "4\ncbcc\n12\n4 b\n4 c\n1 b\n2 a\n3 b\n2 c\n4 a\n1 a\n2 b\n3 a\n1 c\n3 c",
"output": "4\n4\n2\n2\n4\n4\n4\n1\n3\n3\n4\n4"
},
{
"input": "4\nddbb\n16\n3 c\n3 b\n1 a\n1 b\n4 d\n4 a\n3 d\n2 a\n2 d\n4 c\n3 a\n2 c\n4 b\n1 c\n2 b\n1 d",
"output": "3\n4\n1\n3\n4\n4\n4\n2\n4\n4\n3\n2\n4\n1\n4\n3"
},
{
"input": "4\nabcc\n24\n1 c\n4 d\n3 c\n1 d\n1 c\n1 b\n3 b\n2 c\n3 d\n3 d\n4 c\n2 a\n4 d\n1 a\n1 b\n4 a\n4 d\n3 b\n4 b\n3 c\n3 a\n2 d\n1 a\n2 b",
"output": "3\n4\n4\n1\n3\n2\n4\n4\n3\n3\n4\n3\n4\n2\n2\n4\n4\n4\n4\n4\n4\n2\n2\n3"
},
{
"input": "40\ncbbcbcccccacccccbbacbaabccbbabbaaaaacccc\n10\n40 a\n28 c\n25 c\n21 a\n18 c\n27 a\n9 c\n37 c\n15 a\n18 b",
"output": "40\n40\n40\n31\n35\n37\n23\n40\n24\n27"
},
{
"input": "100\ndddddccccdddddaaaaabbbbbbbbbbbbbaaacdcabbacccacccccbdbbadddbbddddbdaaccacdddbbbaddddbbbbdcbbbdddddda\n50\n54 b\n48 d\n45 b\n52 c\n52 a\n48 a\n54 b\n45 a\n47 d\n50 d\n53 a\n34 a\n51 b\n48 d\n47 d\n47 a\n48 d\n53 b\n52 d\n54 d\n46 a\n38 a\n52 b\n49 a\n49 b\n46 c\n54 a\n45 b\n35 c\n55 c\n51 c\n46 d\n54 d\n50 a\n33 c\n46 a\n50 b\n50 a\n54 a\n32 b\n55 b\n49 c\n53 d\n49 a\n46 b\n48 c\n47 b\n47 b\n47 a\n46 b",
"output": "85\n72\n76\n69\n68\n63\n85\n60\n71\n74\n69\n46\n82\n72\n71\n62\n72\n84\n76\n78\n61\n50\n83\n64\n80\n60\n70\n76\n49\n72\n68\n70\n78\n66\n47\n61\n81\n66\n70\n53\n86\n63\n77\n64\n77\n62\n78\n78\n62\n77"
},
{
"input": "200\nddeecdbbbeeeeebbbbbaaaaaaaaaaaaaaaaaaaaaaabbcaacccbeeeeddddddddddddccccccdffeeeeecccccbbbbaaaaedfffffaadeeeeeeeedddddaaaaaaaaaaaaaabbbbbcaadddeefffbbbbcccccccccccbbbbbbeeeeeeeffffffdffffffffffffaaaaab\n10\n43 f\n118 d\n165 f\n72 f\n48 f\n2 a\n61 e\n94 d\n109 f\n16 a",
"output": "64\n144\n193\n98\n69\n25\n79\n117\n137\n41"
},
{
"input": "5\naaaaa\n1\n1 b",
"output": "1"
}
] | 1,496,843,787
| 6,087
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 9
| 2,000
| 13,721,600
|
from sys import stdin, stdout
n = int(stdin.readline().rstrip())
s = stdin.readline().rstrip()
q = int(stdin.readline().rstrip())
sSet = set(s)
plans = []
for _ in range(q):
m,c = stdin.readline().rstrip().split()
plans.append((int(m),c))
cDict = {}
for letter in sSet:
cDict[letter] = [n-s.count(letter),[-1] + [x for x in range(n) if s[x]!=letter] + [n]]
plansDict={}
for plan in plans:
if plan in plansDict:
print(plansDict[plan])
else:
m,c = plan
if c not in sSet:
plansDict[plan] = m
print(m)
else:
lCount = cDict[c][0]
if lCount<m:
plansDict[plan] = n
print(n)
else:
koyomity = []
cList = cDict[c][1]
for i in range(lCount+1-m):
koyomity.append(cList[i+1+m]-cList[i]-1)
maxK = max(koyomity)
plansDict[plan] = maxK
print(maxK)
|
Title: An impassioned circulation of affection
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nadeko's birthday is approaching! As she decorated the room for the party, a long garland of Dianthus-shaped paper pieces was placed on a prominent part of the wall. Brother Koyomi will like it!
Still unsatisfied with the garland, Nadeko decided to polish it again. The garland has *n* pieces numbered from 1 to *n* from left to right, and the *i*-th piece has a colour *s**i*, denoted by a lowercase English letter. Nadeko will repaint at most *m* of the pieces to give each of them an arbitrary new colour (still denoted by a lowercase English letter). After this work, she finds out all subsegments of the garland containing pieces of only colour *c* — Brother Koyomi's favourite one, and takes the length of the longest among them to be the Koyomity of the garland.
For instance, let's say the garland is represented by "kooomo", and Brother Koyomi's favourite colour is "o". Among all subsegments containing pieces of "o" only, "ooo" is the longest, with a length of 3. Thus the Koyomity of this garland equals 3.
But problem arises as Nadeko is unsure about Brother Koyomi's favourite colour, and has swaying ideas on the amount of work to do. She has *q* plans on this, each of which can be expressed as a pair of an integer *m**i* and a lowercase letter *c**i*, meanings of which are explained above. You are to find out the maximum Koyomity achievable after repainting the garland according to each plan.
Input Specification:
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=1<=500) — the length of the garland.
The second line contains *n* lowercase English letters *s*1*s*2... *s**n* as a string — the initial colours of paper pieces on the garland.
The third line contains a positive integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of plans Nadeko has.
The next *q* lines describe one plan each: the *i*-th among them contains an integer *m**i* (1<=≤<=*m**i*<=≤<=*n*) — the maximum amount of pieces to repaint, followed by a space, then by a lowercase English letter *c**i* — Koyomi's possible favourite colour.
Output Specification:
Output *q* lines: for each work plan, output one line containing an integer — the largest Koyomity achievable after repainting the garland according to it.
Demo Input:
['6\nkoyomi\n3\n1 o\n4 o\n4 m\n', '15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b\n', '10\naaaaaaaaaa\n2\n10 b\n10 z\n']
Demo Output:
['3\n6\n5\n', '3\n4\n5\n7\n8\n1\n2\n3\n4\n5\n', '10\n10\n']
Note:
In the first sample, there are three plans:
- In the first plan, at most 1 piece can be repainted. Repainting the "y" piece to become "o" results in "kooomi", whose Koyomity of 3 is the best achievable; - In the second plan, at most 4 pieces can be repainted, and "oooooo" results in a Koyomity of 6; - In the third plan, at most 4 pieces can be repainted, and "mmmmmi" and "kmmmmm" both result in a Koyomity of 5.
|
```python
from sys import stdin, stdout
n = int(stdin.readline().rstrip())
s = stdin.readline().rstrip()
q = int(stdin.readline().rstrip())
sSet = set(s)
plans = []
for _ in range(q):
m,c = stdin.readline().rstrip().split()
plans.append((int(m),c))
cDict = {}
for letter in sSet:
cDict[letter] = [n-s.count(letter),[-1] + [x for x in range(n) if s[x]!=letter] + [n]]
plansDict={}
for plan in plans:
if plan in plansDict:
print(plansDict[plan])
else:
m,c = plan
if c not in sSet:
plansDict[plan] = m
print(m)
else:
lCount = cDict[c][0]
if lCount<m:
plansDict[plan] = n
print(n)
else:
koyomity = []
cList = cDict[c][1]
for i in range(lCount+1-m):
koyomity.append(cList[i+1+m]-cList[i]-1)
maxK = max(koyomity)
plansDict[plan] = maxK
print(maxK)
```
| 0
|
|
952
|
A
|
Quirky Quantifiers
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1.
|
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
|
Output 0 or 1.
|
[
"13\n",
"927\n",
"48\n"
] |
[
"1\n",
"1\n",
"0\n"
] |
none
| 0
|
[
{
"input": "13",
"output": "1"
},
{
"input": "927",
"output": "1"
},
{
"input": "48",
"output": "0"
},
{
"input": "10",
"output": "0"
},
{
"input": "999",
"output": "1"
},
{
"input": "142",
"output": "0"
},
{
"input": "309",
"output": "1"
},
{
"input": "572",
"output": "0"
},
{
"input": "835",
"output": "1"
},
{
"input": "990",
"output": "0"
},
{
"input": "168",
"output": "0"
},
{
"input": "431",
"output": "1"
},
{
"input": "694",
"output": "0"
},
{
"input": "957",
"output": "1"
},
{
"input": "932",
"output": "0"
}
] | 1,646,077,979
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 15
| 46
| 0
|
if int(input()) % 2 == 0:
print(0)
else:
print(1)
|
Title: Quirky Quantifiers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1.
Input Specification:
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output Specification:
Output 0 or 1.
Demo Input:
['13\n', '927\n', '48\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
none
|
```python
if int(input()) % 2 == 0:
print(0)
else:
print(1)
```
| 3
|
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,623,912,681
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 92
| 0
|
n,m = map(int,input().split())
arr = list(map(int,input().split()))
arr.sort()
s = abs(sum(arr[0:m]))
print(s)
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
n,m = map(int,input().split())
arr = list(map(int,input().split()))
arr.sort()
s = abs(sum(arr[0:m]))
print(s)
```
| 0
|
474
|
B
|
Worms
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation"
] | null | null |
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
|
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
|
[
"5\n2 7 3 4 9\n3\n1 25 11\n"
] |
[
"1\n5\n3\n"
] |
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
| 1,000
|
[
{
"input": "5\n2 7 3 4 9\n3\n1 25 11",
"output": "1\n5\n3"
}
] | 1,680,499,170
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 405
| 14,336,000
|
n = int(input())
heaps = list(map(int, input().split()))
value = 0
up = int(input())
requests = list(map(int, input().split()))
answer = [-1]
value = 0
for i in heaps:
value += 1
for j in range(i):
answer.append(value)
for i in requests:
print(answer[i])
|
Title: Worms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Output Specification:
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
Demo Input:
['5\n2 7 3 4 9\n3\n1 25 11\n']
Demo Output:
['1\n5\n3\n']
Note:
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
|
```python
n = int(input())
heaps = list(map(int, input().split()))
value = 0
up = int(input())
requests = list(map(int, input().split()))
answer = [-1]
value = 0
for i in heaps:
value += 1
for j in range(i):
answer.append(value)
for i in requests:
print(answer[i])
```
| 3
|
|
545
|
D
|
Queue
|
PROGRAMMING
| 1,300
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Little girl Susie went shopping with her mom and she wondered how to improve service quality.
There are *n* people in the queue. For each person we know time *t**i* needed to serve him. A person will be disappointed if the time he waits is more than the time needed to serve him. The time a person waits is the total time when all the people who stand in the queue in front of him are served. Susie thought that if we swap some people in the queue, then we can decrease the number of people who are disappointed.
Help Susie find out what is the maximum number of not disappointed people can be achieved by swapping people in the queue.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105).
The next line contains *n* integers *t**i* (1<=≤<=*t**i*<=≤<=109), separated by spaces.
|
Print a single number — the maximum number of not disappointed people in the queue.
|
[
"5\n15 2 1 5 3\n"
] |
[
"4\n"
] |
Value 4 is achieved at such an arrangement, for example: 1, 2, 3, 5, 15. Thus, you can make everything feel not disappointed except for the person with time 5.
| 1,750
|
[
{
"input": "5\n15 2 1 5 3",
"output": "4"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "10\n13 2 5 55 21 34 1 8 1 3",
"output": "6"
},
{
"input": "10\n8 256 16 1 2 1 64 4 128 32",
"output": "10"
},
{
"input": "10\n10000 40000 10000 50000 20000 100000 10000 100 30000 500",
"output": "6"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "15\n9 11 45 86 52 65 35 3 93 7 21 45 15 11 39",
"output": "6"
},
{
"input": "20\n16839799 17525904 91276752 42650694 60106463 12243176 54892123 25142243 16015971 41250998 11150057 6994983 67700784 16562412 82163675 46178521 33914268 91966607 93976858 84100064",
"output": "5"
},
{
"input": "26\n1000 4110030 64221 131521030 942374833 1003 2055015 32110 513757 16440130 263042057 32880256 128439 557559573 16051 8220066 469240078 65760513 256878 790176315 4012 2005 1027508 928528684 8030 805074697",
"output": "21"
}
] | 1,698,310,155
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 1,000
| 2,560,000
|
n=int(input())
serve_time=list(map(int,input().split()))
serve_time.sort()
# print(serve_time)
sum_time=0
# sum_list=[]
ans=0
for i in range(n):
# print(sum_time)
if sum_time<=serve_time[i]:
ans+=1
sum_time += serve_time[i]
# sum_list.append(serve_time[i])
else:
for j in range(i,n):
if sum_time<=serve_time[j]:
serve_time[i],serve_time[j]=serve_time[j],serve_time[i]
ans+=1
sum_time += serve_time[i]
# sum_list.append(serve_time[i])
break
# print(serve_time)
print(ans)
|
Title: Queue
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Susie went shopping with her mom and she wondered how to improve service quality.
There are *n* people in the queue. For each person we know time *t**i* needed to serve him. A person will be disappointed if the time he waits is more than the time needed to serve him. The time a person waits is the total time when all the people who stand in the queue in front of him are served. Susie thought that if we swap some people in the queue, then we can decrease the number of people who are disappointed.
Help Susie find out what is the maximum number of not disappointed people can be achieved by swapping people in the queue.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105).
The next line contains *n* integers *t**i* (1<=≤<=*t**i*<=≤<=109), separated by spaces.
Output Specification:
Print a single number — the maximum number of not disappointed people in the queue.
Demo Input:
['5\n15 2 1 5 3\n']
Demo Output:
['4\n']
Note:
Value 4 is achieved at such an arrangement, for example: 1, 2, 3, 5, 15. Thus, you can make everything feel not disappointed except for the person with time 5.
|
```python
n=int(input())
serve_time=list(map(int,input().split()))
serve_time.sort()
# print(serve_time)
sum_time=0
# sum_list=[]
ans=0
for i in range(n):
# print(sum_time)
if sum_time<=serve_time[i]:
ans+=1
sum_time += serve_time[i]
# sum_list.append(serve_time[i])
else:
for j in range(i,n):
if sum_time<=serve_time[j]:
serve_time[i],serve_time[j]=serve_time[j],serve_time[i]
ans+=1
sum_time += serve_time[i]
# sum_list.append(serve_time[i])
break
# print(serve_time)
print(ans)
```
| 0
|
|
63
|
A
|
Sinking Ship
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings",
"strings"
] |
A. Sinking Ship
|
2
|
256
|
The ship crashed into a reef and is sinking. Now the entire crew must be evacuated. All *n* crew members have already lined up in a row (for convenience let's label them all from left to right with positive integers from 1 to *n*) and await further instructions. However, one should evacuate the crew properly, in a strict order. Specifically:
The first crew members to leave the ship are rats. Then women and children (both groups have the same priority) leave the ship. After that all men are evacuated from the ship. The captain leaves the sinking ship last.
If we cannot determine exactly who should leave the ship first for any two members of the crew by the rules from the previous paragraph, then the one who stands to the left in the line leaves the ship first (or in other words, the one whose number in the line is less).
For each crew member we know his status as a crew member, and also his name. All crew members have different names. Determine the order in which to evacuate the crew.
|
The first line contains an integer *n*, which is the number of people in the crew (1<=≤<=*n*<=≤<=100). Then follow *n* lines. The *i*-th of those lines contains two words — the name of the crew member who is *i*-th in line, and his status on the ship. The words are separated by exactly one space. There are no other spaces in the line. The names consist of Latin letters, the first letter is uppercase, the rest are lowercase. The length of any name is from 1 to 10 characters. The status can have the following values: rat for a rat, woman for a woman, child for a child, man for a man, captain for the captain. The crew contains exactly one captain.
|
Print *n* lines. The *i*-th of them should contain the name of the crew member who must be the *i*-th one to leave the ship.
|
[
"6\nJack captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman\n"
] |
[
"Teddy\nAlice\nBob\nJulia\nCharlie\nJack\n"
] |
none
| 500
|
[
{
"input": "6\nJack captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman",
"output": "Teddy\nAlice\nBob\nJulia\nCharlie\nJack"
},
{
"input": "1\nA captain",
"output": "A"
},
{
"input": "1\nAbcdefjhij captain",
"output": "Abcdefjhij"
},
{
"input": "5\nA captain\nB man\nD woman\nC child\nE rat",
"output": "E\nD\nC\nB\nA"
},
{
"input": "10\nCap captain\nD child\nC woman\nA woman\nE child\nMan man\nB child\nF woman\nRat rat\nRatt rat",
"output": "Rat\nRatt\nD\nC\nA\nE\nB\nF\nMan\nCap"
},
{
"input": "5\nJoyxnkypf captain\nDxssgr woman\nKeojmnpd rat\nGdv man\nHnw man",
"output": "Keojmnpd\nDxssgr\nGdv\nHnw\nJoyxnkypf"
},
{
"input": "11\nJue rat\nWyglbyphk rat\nGjlgu child\nGi man\nAttx rat\nTheorpkgx man\nYm rat\nX child\nB captain\nEnualf rat\nKktsgyuyv woman",
"output": "Jue\nWyglbyphk\nAttx\nYm\nEnualf\nGjlgu\nX\nKktsgyuyv\nGi\nTheorpkgx\nB"
},
{
"input": "22\nWswwcvvm woman\nBtmfats rat\nI rat\nOcmtsnwx man\nUrcqv rat\nYghnogt woman\nWtyfc man\nWqle child\nUjfrelpu rat\nDstixj man\nAhksnio woman\nKhkvaap woman\nSjppvwm rat\nEgdmsv rat\nDank rat\nNquicjnw rat\nLh captain\nTdyaqaqln rat\nQtj rat\nTfgwijvq rat\nNbiso child\nNqthvbf woman",
"output": "Btmfats\nI\nUrcqv\nUjfrelpu\nSjppvwm\nEgdmsv\nDank\nNquicjnw\nTdyaqaqln\nQtj\nTfgwijvq\nWswwcvvm\nYghnogt\nWqle\nAhksnio\nKhkvaap\nNbiso\nNqthvbf\nOcmtsnwx\nWtyfc\nDstixj\nLh"
},
{
"input": "36\nKqxmtwmsf child\nIze woman\nDlpr child\nK woman\nF captain\nRjwfeuhba rat\nBbv rat\nS rat\nMnmg woman\nSmzyx woman\nSr man\nQmhroracn rat\nSoqpuqock rat\nPibdq man\nIlrkrptx rat\nZaecfyqka man\nMmersfs child\nVvvocqi man\nHjeqxvq rat\nMpmb woman\nWmgu woman\nCerelmhoxi child\nA man\nDylv man\nXrdgmmtcpq woman\nXj woman\nCeh child\nOfccguo man\nNevr man\nAknkwdkq child\nBmo man\nLqo woman\nVej child\nT child\nRlijc man\nNsdtpdg woman",
"output": "Rjwfeuhba\nBbv\nS\nQmhroracn\nSoqpuqock\nIlrkrptx\nHjeqxvq\nKqxmtwmsf\nIze\nDlpr\nK\nMnmg\nSmzyx\nMmersfs\nMpmb\nWmgu\nCerelmhoxi\nXrdgmmtcpq\nXj\nCeh\nAknkwdkq\nLqo\nVej\nT\nNsdtpdg\nSr\nPibdq\nZaecfyqka\nVvvocqi\nA\nDylv\nOfccguo\nNevr\nBmo\nRlijc\nF"
},
{
"input": "2\nA captain\nB man",
"output": "B\nA"
},
{
"input": "2\nB woman\nA captain",
"output": "B\nA"
},
{
"input": "2\nX child\nY captain",
"output": "X\nY"
},
{
"input": "2\nX captain\nY rat",
"output": "Y\nX"
},
{
"input": "6\nAbdelrhman captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman",
"output": "Teddy\nAlice\nBob\nJulia\nCharlie\nAbdelrhman"
},
{
"input": "4\nAratos captain\nMind child\nAman woman\nCarrot man",
"output": "Mind\nAman\nCarrot\nAratos"
}
] | 1,591,085,971
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 218
| 307,200
|
t=int(input())
a=[]
b=[]
for i in range(t):
n,m=input().split()
a.append(n)
b.append(m)
for i in range(t):
if(b[i]=='rat'):
print(a[i])
for i in range(t):
if(b[i]=='woman' or b[i]=='child'):
print(a[i])
for i in range(t):
if(b[i]=='man'):
print(a[i])
if('captain' in b):
c=b.index('captain')
print(a[c])
|
Title: Sinking Ship
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The ship crashed into a reef and is sinking. Now the entire crew must be evacuated. All *n* crew members have already lined up in a row (for convenience let's label them all from left to right with positive integers from 1 to *n*) and await further instructions. However, one should evacuate the crew properly, in a strict order. Specifically:
The first crew members to leave the ship are rats. Then women and children (both groups have the same priority) leave the ship. After that all men are evacuated from the ship. The captain leaves the sinking ship last.
If we cannot determine exactly who should leave the ship first for any two members of the crew by the rules from the previous paragraph, then the one who stands to the left in the line leaves the ship first (or in other words, the one whose number in the line is less).
For each crew member we know his status as a crew member, and also his name. All crew members have different names. Determine the order in which to evacuate the crew.
Input Specification:
The first line contains an integer *n*, which is the number of people in the crew (1<=≤<=*n*<=≤<=100). Then follow *n* lines. The *i*-th of those lines contains two words — the name of the crew member who is *i*-th in line, and his status on the ship. The words are separated by exactly one space. There are no other spaces in the line. The names consist of Latin letters, the first letter is uppercase, the rest are lowercase. The length of any name is from 1 to 10 characters. The status can have the following values: rat for a rat, woman for a woman, child for a child, man for a man, captain for the captain. The crew contains exactly one captain.
Output Specification:
Print *n* lines. The *i*-th of them should contain the name of the crew member who must be the *i*-th one to leave the ship.
Demo Input:
['6\nJack captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman\n']
Demo Output:
['Teddy\nAlice\nBob\nJulia\nCharlie\nJack\n']
Note:
none
|
```python
t=int(input())
a=[]
b=[]
for i in range(t):
n,m=input().split()
a.append(n)
b.append(m)
for i in range(t):
if(b[i]=='rat'):
print(a[i])
for i in range(t):
if(b[i]=='woman' or b[i]=='child'):
print(a[i])
for i in range(t):
if(b[i]=='man'):
print(a[i])
if('captain' in b):
c=b.index('captain')
print(a[c])
```
| 3.944928
|
400
|
A
|
Inna and Choose Options
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
|
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
|
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
|
[
"4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n"
] |
[
"3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n"
] |
none
| 500
|
[
{
"input": "4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO",
"output": "3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0"
},
{
"input": "2\nOOOOOOOOOOOO\nXXXXXXXXXXXX",
"output": "0\n6 1x12 2x6 3x4 4x3 6x2 12x1"
},
{
"input": "13\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX",
"output": "6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1"
}
] | 1,517,956,277
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 5,632,000
|
t=eval(input())
c=1
s=[]
f=0
while (c<=t):
a=str(input())
if(a=="XXXXXXXXXXXX"):
print("6 1x12 2x6 3x4 4x3 6x2 12x1")
elif(a=="OOOOOOOOOOOOO"):
print (0)
else:
s=s+["1x12"]
i=0
while (i<6):
if (a[i]=="X"):
if (a[i+6]=="X"):
s=s+["2x6"]
if (i<4):
if (a[i+4]=="X")and (a[i+8]=="X"):
s=s+["3x4"]
if (i<3):
if (a[i+3]=="X") and (a[i+6]=="X") and a[i+9]=="X":
s=s+["4X3"]
if (i<2):
if (a[i+2]=="X") and (a[i+4]=="X") and (a[i+6]=="X") and (a[i+8]=="X") and (a[i+10]=="X"):
s=s+["6x12"]
i+=1
s=list(set(s))
print (len(s)," ".join(map(str,s)))
c+=1
|
Title: Inna and Choose Options
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
Input Specification:
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
Output Specification:
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
Demo Input:
['4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n']
Demo Output:
['3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n']
Note:
none
|
```python
t=eval(input())
c=1
s=[]
f=0
while (c<=t):
a=str(input())
if(a=="XXXXXXXXXXXX"):
print("6 1x12 2x6 3x4 4x3 6x2 12x1")
elif(a=="OOOOOOOOOOOOO"):
print (0)
else:
s=s+["1x12"]
i=0
while (i<6):
if (a[i]=="X"):
if (a[i+6]=="X"):
s=s+["2x6"]
if (i<4):
if (a[i+4]=="X")and (a[i+8]=="X"):
s=s+["3x4"]
if (i<3):
if (a[i+3]=="X") and (a[i+6]=="X") and a[i+9]=="X":
s=s+["4X3"]
if (i<2):
if (a[i+2]=="X") and (a[i+4]=="X") and (a[i+6]=="X") and (a[i+8]=="X") and (a[i+10]=="X"):
s=s+["6x12"]
i+=1
s=list(set(s))
print (len(s)," ".join(map(str,s)))
c+=1
```
| 0
|
|
996
|
A
|
Hit the Lottery
|
PROGRAMMING
| 800
|
[
"dp",
"greedy"
] | null | null |
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
|
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
|
Output the minimum number of bills that Allen could receive.
|
[
"125\n",
"43\n",
"1000000000\n"
] |
[
"3\n",
"5\n",
"10000000\n"
] |
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
| 500
|
[
{
"input": "125",
"output": "3"
},
{
"input": "43",
"output": "5"
},
{
"input": "1000000000",
"output": "10000000"
},
{
"input": "4",
"output": "4"
},
{
"input": "5",
"output": "1"
},
{
"input": "1",
"output": "1"
},
{
"input": "74",
"output": "8"
},
{
"input": "31",
"output": "3"
},
{
"input": "59",
"output": "8"
},
{
"input": "79",
"output": "9"
},
{
"input": "7",
"output": "3"
},
{
"input": "55",
"output": "4"
},
{
"input": "40",
"output": "2"
},
{
"input": "719",
"output": "13"
},
{
"input": "847",
"output": "13"
},
{
"input": "225",
"output": "4"
},
{
"input": "4704",
"output": "51"
},
{
"input": "1132",
"output": "15"
},
{
"input": "7811",
"output": "80"
},
{
"input": "7981",
"output": "84"
},
{
"input": "82655",
"output": "830"
},
{
"input": "6364",
"output": "70"
},
{
"input": "74611",
"output": "748"
},
{
"input": "45391",
"output": "459"
},
{
"input": "620448",
"output": "6210"
},
{
"input": "265145",
"output": "2654"
},
{
"input": "671704",
"output": "6721"
},
{
"input": "365173",
"output": "3658"
},
{
"input": "7130872",
"output": "71314"
},
{
"input": "9628747",
"output": "96292"
},
{
"input": "8898399",
"output": "88993"
},
{
"input": "9497953",
"output": "94985"
},
{
"input": "19070947",
"output": "190714"
},
{
"input": "20185520",
"output": "201856"
},
{
"input": "91402248",
"output": "914028"
},
{
"input": "27035533",
"output": "270360"
},
{
"input": "22717528",
"output": "227180"
},
{
"input": "24403439",
"output": "244041"
},
{
"input": "163565555",
"output": "1635659"
},
{
"input": "152541908",
"output": "1525423"
},
{
"input": "668439837",
"output": "6684403"
},
{
"input": "20",
"output": "1"
},
{
"input": "999999999",
"output": "10000009"
},
{
"input": "10",
"output": "1"
},
{
"input": "7",
"output": "3"
},
{
"input": "6",
"output": "2"
},
{
"input": "99999999",
"output": "1000009"
},
{
"input": "1000001",
"output": "10001"
},
{
"input": "2521",
"output": "27"
}
] | 1,697,142,907
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 6
| 61
| 0
|
n = int(input())
s = 0
if n // 100 > 0:
k = n // 100
s += k
n %= 100*k
if n // 50 > 0:
k = n // 50
s += k
n %= 50*k
if n // 20 > 0:
k = n // 20
s += k
n %= 20*k
if n // 5 > 0:
k = n // 5
s += k
n %= 5*k
if n > 0:
s += n
print(s)
|
Title: Hit the Lottery
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
Input Specification:
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output Specification:
Output the minimum number of bills that Allen could receive.
Demo Input:
['125\n', '43\n', '1000000000\n']
Demo Output:
['3\n', '5\n', '10000000\n']
Note:
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
|
```python
n = int(input())
s = 0
if n // 100 > 0:
k = n // 100
s += k
n %= 100*k
if n // 50 > 0:
k = n // 50
s += k
n %= 50*k
if n // 20 > 0:
k = n // 20
s += k
n %= 20*k
if n // 5 > 0:
k = n // 5
s += k
n %= 5*k
if n > 0:
s += n
print(s)
```
| 0
|
|
552
|
C
|
Vanya and Scales
|
PROGRAMMING
| 1,900
|
[
"brute force",
"dp",
"greedy",
"math",
"meet-in-the-middle",
"number theory"
] | null | null |
Vanya has a scales for weighing loads and weights of masses *w*0,<=*w*1,<=*w*2,<=...,<=*w*100 grams where *w* is some integer not less than 2 (exactly one weight of each nominal value). Vanya wonders whether he can weight an item with mass *m* using the given weights, if the weights can be put on both pans of the scales. Formally speaking, your task is to determine whether it is possible to place an item of mass *m* and some weights on the left pan of the scales, and some weights on the right pan of the scales so that the pans of the scales were in balance.
|
The first line contains two integers *w*,<=*m* (2<=≤<=*w*<=≤<=109, 1<=≤<=*m*<=≤<=109) — the number defining the masses of the weights and the mass of the item.
|
Print word 'YES' if the item can be weighted and 'NO' if it cannot.
|
[
"3 7\n",
"100 99\n",
"100 50\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
Note to the first sample test. One pan can have an item of mass 7 and a weight of mass 3, and the second pan can have two weights of masses 9 and 1, correspondingly. Then 7 + 3 = 9 + 1.
Note to the second sample test. One pan of the scales can have an item of mass 99 and the weight of mass 1, and the second pan can have the weight of mass 100.
Note to the third sample test. It is impossible to measure the weight of the item in the manner described in the input.
| 1,500
|
[
{
"input": "3 7",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "100 50",
"output": "NO"
},
{
"input": "1000000000 1",
"output": "YES"
},
{
"input": "100 10002",
"output": "NO"
},
{
"input": "4 7",
"output": "NO"
},
{
"input": "4 11",
"output": "YES"
},
{
"input": "5 781",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "5077 5988",
"output": "NO"
},
{
"input": "2 9596",
"output": "YES"
},
{
"input": "4 1069",
"output": "YES"
},
{
"input": "4 7134",
"output": "NO"
},
{
"input": "4 9083",
"output": "NO"
},
{
"input": "4 7927",
"output": "NO"
},
{
"input": "4 6772",
"output": "NO"
},
{
"input": "5 782",
"output": "NO"
},
{
"input": "4 1000000000",
"output": "NO"
},
{
"input": "4 357913941",
"output": "YES"
},
{
"input": "4 357918037",
"output": "NO"
},
{
"input": "5 12207031",
"output": "YES"
},
{
"input": "5 41503906",
"output": "YES"
},
{
"input": "5 90332031",
"output": "NO"
},
{
"input": "11 1786324",
"output": "YES"
},
{
"input": "10 999",
"output": "YES"
},
{
"input": "8 28087",
"output": "YES"
},
{
"input": "8 28598",
"output": "NO"
},
{
"input": "32 33586176",
"output": "YES"
},
{
"input": "87 56631258",
"output": "YES"
},
{
"input": "19 20",
"output": "YES"
},
{
"input": "58 11316496",
"output": "YES"
},
{
"input": "89 89",
"output": "YES"
},
{
"input": "21 85756882",
"output": "YES"
},
{
"input": "56 540897225",
"output": "YES"
},
{
"input": "91 8189",
"output": "YES"
},
{
"input": "27 14329927",
"output": "YES"
},
{
"input": "58 198535",
"output": "YES"
},
{
"input": "939 938",
"output": "YES"
},
{
"input": "27463 754243832",
"output": "YES"
},
{
"input": "21427 459137757",
"output": "YES"
},
{
"input": "26045 26045",
"output": "YES"
},
{
"input": "25336 25336",
"output": "YES"
},
{
"input": "24627 24626",
"output": "YES"
},
{
"input": "29245 855299270",
"output": "YES"
},
{
"input": "28536 814274759",
"output": "YES"
},
{
"input": "33154 33155",
"output": "YES"
},
{
"input": "27118 27119",
"output": "YES"
},
{
"input": "70 338171",
"output": "YES"
},
{
"input": "24 346226",
"output": "NO"
},
{
"input": "41 2966964",
"output": "NO"
},
{
"input": "31 29792",
"output": "YES"
},
{
"input": "48 2402",
"output": "NO"
},
{
"input": "65 4159",
"output": "YES"
},
{
"input": "20 67376840",
"output": "NO"
},
{
"input": "72 5111",
"output": "YES"
},
{
"input": "27 14349609",
"output": "YES"
},
{
"input": "44 89146",
"output": "NO"
},
{
"input": "22787 519292944",
"output": "NO"
},
{
"input": "24525 601475624",
"output": "YES"
},
{
"input": "3716 13816089",
"output": "NO"
},
{
"input": "4020 4020",
"output": "YES"
},
{
"input": "13766 13767",
"output": "YES"
},
{
"input": "23512 23511",
"output": "YES"
},
{
"input": "23816 567225671",
"output": "YES"
},
{
"input": "33562 33564",
"output": "NO"
},
{
"input": "33866 33866",
"output": "YES"
},
{
"input": "13057 13059",
"output": "NO"
},
{
"input": "441890232 441890232",
"output": "YES"
},
{
"input": "401739553 401739553",
"output": "YES"
},
{
"input": "285681920 285681919",
"output": "YES"
},
{
"input": "464591587 464591588",
"output": "YES"
},
{
"input": "703722884 703722884",
"output": "YES"
},
{
"input": "982276216 982276216",
"output": "YES"
},
{
"input": "867871061 867871062",
"output": "YES"
},
{
"input": "48433217 48433216",
"output": "YES"
},
{
"input": "8 324818663",
"output": "NO"
},
{
"input": "7 898367507",
"output": "NO"
},
{
"input": "6 471916351",
"output": "NO"
},
{
"input": "5 45465196",
"output": "NO"
},
{
"input": "9 768757144",
"output": "NO"
},
{
"input": "8 342305988",
"output": "NO"
},
{
"input": "6 114457122",
"output": "NO"
},
{
"input": "6 688005966",
"output": "NO"
},
{
"input": "4 556522107",
"output": "NO"
},
{
"input": "3 130070951",
"output": "YES"
},
{
"input": "6 558395604",
"output": "NO"
},
{
"input": "5 131944448",
"output": "NO"
},
{
"input": "2 1000000",
"output": "YES"
},
{
"input": "2 22222222",
"output": "YES"
},
{
"input": "3 100000000",
"output": "YES"
},
{
"input": "3 100000001",
"output": "YES"
},
{
"input": "3 100000002",
"output": "YES"
},
{
"input": "3 100000003",
"output": "YES"
},
{
"input": "3 100000004",
"output": "YES"
},
{
"input": "2 1",
"output": "YES"
},
{
"input": "2 1000000000",
"output": "YES"
},
{
"input": "3 1000000000",
"output": "YES"
},
{
"input": "99999 1000000000",
"output": "NO"
},
{
"input": "10 1000000000",
"output": "YES"
},
{
"input": "1000 1000000000",
"output": "YES"
},
{
"input": "10 999999999",
"output": "YES"
},
{
"input": "100 99999999",
"output": "YES"
},
{
"input": "1000 999999999",
"output": "YES"
},
{
"input": "1000 999999998",
"output": "NO"
},
{
"input": "2 536870912",
"output": "YES"
},
{
"input": "10 99",
"output": "YES"
},
{
"input": "10 8",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "3 26",
"output": "YES"
},
{
"input": "10 8888",
"output": "NO"
},
{
"input": "3 8",
"output": "YES"
},
{
"input": "3 984742145",
"output": "YES"
},
{
"input": "4 43",
"output": "YES"
},
{
"input": "1000000000 1000000000",
"output": "YES"
},
{
"input": "4194304 4194305",
"output": "YES"
},
{
"input": "10 899",
"output": "YES"
},
{
"input": "4 47",
"output": "YES"
},
{
"input": "4 822083581",
"output": "YES"
},
{
"input": "3 999987989",
"output": "YES"
},
{
"input": "4 31",
"output": "NO"
},
{
"input": "4 15",
"output": "YES"
},
{
"input": "100000000 100000001",
"output": "YES"
}
] | 1,698,956,768
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 122
| 77
| 0
|
w,m=map(int,input().split())
for i in range(33): m=min(m,abs(w**(32-i)-m))
print("NO" if m else "YES")
|
Title: Vanya and Scales
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya has a scales for weighing loads and weights of masses *w*0,<=*w*1,<=*w*2,<=...,<=*w*100 grams where *w* is some integer not less than 2 (exactly one weight of each nominal value). Vanya wonders whether he can weight an item with mass *m* using the given weights, if the weights can be put on both pans of the scales. Formally speaking, your task is to determine whether it is possible to place an item of mass *m* and some weights on the left pan of the scales, and some weights on the right pan of the scales so that the pans of the scales were in balance.
Input Specification:
The first line contains two integers *w*,<=*m* (2<=≤<=*w*<=≤<=109, 1<=≤<=*m*<=≤<=109) — the number defining the masses of the weights and the mass of the item.
Output Specification:
Print word 'YES' if the item can be weighted and 'NO' if it cannot.
Demo Input:
['3 7\n', '100 99\n', '100 50\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
Note to the first sample test. One pan can have an item of mass 7 and a weight of mass 3, and the second pan can have two weights of masses 9 and 1, correspondingly. Then 7 + 3 = 9 + 1.
Note to the second sample test. One pan of the scales can have an item of mass 99 and the weight of mass 1, and the second pan can have the weight of mass 100.
Note to the third sample test. It is impossible to measure the weight of the item in the manner described in the input.
|
```python
w,m=map(int,input().split())
for i in range(33): m=min(m,abs(w**(32-i)-m))
print("NO" if m else "YES")
```
| 3
|
|
460
|
A
|
Vasya and Socks
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
|
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
|
Print a single integer — the answer to the problem.
|
[
"2 2\n",
"9 3\n"
] |
[
"3\n",
"13\n"
] |
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
| 500
|
[
{
"input": "2 2",
"output": "3"
},
{
"input": "9 3",
"output": "13"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "1 99",
"output": "1"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "10 2",
"output": "19"
},
{
"input": "10 9",
"output": "11"
},
{
"input": "100 100",
"output": "101"
},
{
"input": "2 27",
"output": "2"
},
{
"input": "99 100",
"output": "99"
},
{
"input": "99 2",
"output": "197"
},
{
"input": "100 3",
"output": "149"
},
{
"input": "98 3",
"output": "146"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 2",
"output": "199"
},
{
"input": "62 4",
"output": "82"
},
{
"input": "99 10",
"output": "109"
},
{
"input": "100 5",
"output": "124"
},
{
"input": "80 80",
"output": "81"
},
{
"input": "95 16",
"output": "101"
},
{
"input": "75 16",
"output": "79"
},
{
"input": "99 74",
"output": "100"
},
{
"input": "20 21",
"output": "20"
},
{
"input": "52 96",
"output": "52"
},
{
"input": "24 5",
"output": "29"
}
] | 1,669,570,954
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 31
| 0
|
n = input()
hlt = [int(i) for i in n.split() if i.isdigit()]
p = hlt[0]
d = hlt[1]
total = 0
days = p
while (days != 0):
total = total + days
days = days//d
print(total)
|
Title: Vasya and Socks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
Input Specification:
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['2 2\n', '9 3\n']
Demo Output:
['3\n', '13\n']
Note:
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
|
```python
n = input()
hlt = [int(i) for i in n.split() if i.isdigit()]
p = hlt[0]
d = hlt[1]
total = 0
days = p
while (days != 0):
total = total + days
days = days//d
print(total)
```
| 0
|
|
46
|
A
|
Ball Game
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] |
A. Ball Game
|
2
|
256
|
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) which indicates the number of kids in the circle.
|
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
|
[
"10\n",
"3\n"
] |
[
"2 4 7 1 6 2 9 7 6\n",
"2 1\n"
] |
none
| 0
|
[
{
"input": "10",
"output": "2 4 7 1 6 2 9 7 6"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "4",
"output": "2 4 3"
},
{
"input": "5",
"output": "2 4 2 1"
},
{
"input": "6",
"output": "2 4 1 5 4"
},
{
"input": "7",
"output": "2 4 7 4 2 1"
},
{
"input": "8",
"output": "2 4 7 3 8 6 5"
},
{
"input": "9",
"output": "2 4 7 2 7 4 2 1"
},
{
"input": "2",
"output": "2"
},
{
"input": "11",
"output": "2 4 7 11 5 11 7 4 2 1"
},
{
"input": "12",
"output": "2 4 7 11 4 10 5 1 10 8 7"
},
{
"input": "13",
"output": "2 4 7 11 3 9 3 11 7 4 2 1"
},
{
"input": "20",
"output": "2 4 7 11 16 2 9 17 6 16 7 19 12 6 1 17 14 12 11"
},
{
"input": "25",
"output": "2 4 7 11 16 22 4 12 21 6 17 4 17 6 21 12 4 22 16 11 7 4 2 1"
},
{
"input": "30",
"output": "2 4 7 11 16 22 29 7 16 26 7 19 2 16 1 17 4 22 11 1 22 14 7 1 26 22 19 17 16"
},
{
"input": "35",
"output": "2 4 7 11 16 22 29 2 11 21 32 9 22 1 16 32 14 32 16 1 22 9 32 21 11 2 29 22 16 11 7 4 2 1"
},
{
"input": "40",
"output": "2 4 7 11 16 22 29 37 6 16 27 39 12 26 1 17 34 12 31 11 32 14 37 21 6 32 19 7 36 26 17 9 2 36 31 27 24 22 21"
},
{
"input": "45",
"output": "2 4 7 11 16 22 29 37 1 11 22 34 2 16 31 2 19 37 11 31 7 29 7 31 11 37 19 2 31 16 2 34 22 11 1 37 29 22 16 11 7 4 2 1"
},
{
"input": "50",
"output": "2 4 7 11 16 22 29 37 46 6 17 29 42 6 21 37 4 22 41 11 32 4 27 1 26 2 29 7 36 16 47 29 12 46 31 17 4 42 31 21 12 4 47 41 36 32 29 27 26"
},
{
"input": "55",
"output": "2 4 7 11 16 22 29 37 46 1 12 24 37 51 11 27 44 7 26 46 12 34 2 26 51 22 49 22 51 26 2 34 12 46 26 7 44 27 11 51 37 24 12 1 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "60",
"output": "2 4 7 11 16 22 29 37 46 56 7 19 32 46 1 17 34 52 11 31 52 14 37 1 26 52 19 47 16 46 17 49 22 56 31 7 44 22 1 41 22 4 47 31 16 2 49 37 26 16 7 59 52 46 41 37 34 32 31"
},
{
"input": "65",
"output": "2 4 7 11 16 22 29 37 46 56 2 14 27 41 56 7 24 42 61 16 37 59 17 41 1 27 54 17 46 11 42 9 42 11 46 17 54 27 1 41 17 59 37 16 61 42 24 7 56 41 27 14 2 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "70",
"output": "2 4 7 11 16 22 29 37 46 56 67 9 22 36 51 67 14 32 51 1 22 44 67 21 46 2 29 57 16 46 7 39 2 36 1 37 4 42 11 51 22 64 37 11 56 32 9 57 36 16 67 49 32 16 1 57 44 32 21 11 2 64 57 51 46 42 39 37 36"
},
{
"input": "75",
"output": "2 4 7 11 16 22 29 37 46 56 67 4 17 31 46 62 4 22 41 61 7 29 52 1 26 52 4 32 61 16 47 4 37 71 31 67 29 67 31 71 37 4 47 16 61 32 4 52 26 1 52 29 7 61 41 22 4 62 46 31 17 4 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "80",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 12 26 41 57 74 12 31 51 72 14 37 61 6 32 59 7 36 66 17 49 2 36 71 27 64 22 61 21 62 24 67 31 76 42 9 57 26 76 47 19 72 46 21 77 54 32 11 71 52 34 17 1 66 52 39 27 16 6 77 69 62 56 51 47 44 42 41"
},
{
"input": "85",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 7 21 36 52 69 2 21 41 62 84 22 46 71 12 39 67 11 41 72 19 52 1 36 72 24 62 16 56 12 54 12 56 16 62 24 72 36 1 52 19 72 41 11 67 39 12 71 46 22 84 62 41 21 2 69 52 36 21 7 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "90",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 2 16 31 47 64 82 11 31 52 74 7 31 56 82 19 47 76 16 47 79 22 56 1 37 74 22 61 11 52 4 47 1 46 2 49 7 56 16 67 29 82 46 11 67 34 2 61 31 2 64 37 11 76 52 29 7 76 56 37 19 2 76 61 47 34 22 11 1 82 74 67 61 56 52 49 47 46"
},
{
"input": "95",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 11 26 42 59 77 1 21 42 64 87 16 41 67 94 27 56 86 22 54 87 26 61 2 39 77 21 61 7 49 92 41 86 37 84 37 86 41 92 49 7 61 21 77 39 2 61 26 87 54 22 86 56 27 94 67 41 16 87 64 42 21 1 77 59 42 26 11 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "96",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 10 25 41 58 76 95 19 40 62 85 13 38 64 91 23 52 82 17 49 82 20 55 91 32 70 13 53 94 40 83 31 76 26 73 25 74 28 79 35 88 46 5 61 22 80 43 7 68 34 1 65 34 4 71 43 16 86 61 37 14 88 67 47 28 10 89 73 58 44 31 19 8 94 85 77 70 64 59 55 52 50 49"
},
{
"input": "97",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 9 24 40 57 75 94 17 38 60 83 10 35 61 88 19 48 78 12 44 77 14 49 85 25 63 5 45 86 31 74 21 66 15 62 13 62 15 66 21 74 31 86 45 5 63 25 85 49 14 77 44 12 78 48 19 88 61 35 10 83 60 38 17 94 75 57 40 24 9 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "98",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 8 23 39 56 74 93 15 36 58 81 7 32 58 85 15 44 74 7 39 72 8 43 79 18 56 95 37 78 22 65 11 56 4 51 1 50 2 53 7 60 16 71 29 86 46 7 67 30 92 57 23 88 56 25 93 64 36 9 81 56 32 9 85 64 44 25 7 88 72 57 43 30 18 7 95 86 78 71 65 60 56 53 51 50"
},
{
"input": "99",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 7 22 38 55 73 92 13 34 56 79 4 29 55 82 11 40 70 2 34 67 2 37 73 11 49 88 29 70 13 56 1 46 92 40 88 38 88 40 92 46 1 56 13 70 29 88 49 11 73 37 2 67 34 2 70 40 11 82 55 29 4 79 56 34 13 92 73 55 38 22 7 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "100",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 6 21 37 54 72 91 11 32 54 77 1 26 52 79 7 36 66 97 29 62 96 31 67 4 42 81 21 62 4 47 91 36 82 29 77 26 76 27 79 32 86 41 97 54 12 71 31 92 54 17 81 46 12 79 47 16 86 57 29 2 76 51 27 4 82 61 41 22 4 87 71 56 42 29 17 6 96 87 79 72 66 61 57 54 52 51"
}
] | 1,670,685,829
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 124
| 0
|
N=int(input())
ANS=[]
now=0
for i in range(1,N):
now+=i
now%=N
ANS.append(now)
print(*[a+1 for a in ANS])
|
Title: Ball Game
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) which indicates the number of kids in the circle.
Output Specification:
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
Demo Input:
['10\n', '3\n']
Demo Output:
['2 4 7 1 6 2 9 7 6\n', '2 1\n']
Note:
none
|
```python
N=int(input())
ANS=[]
now=0
for i in range(1,N):
now+=i
now%=N
ANS.append(now)
print(*[a+1 for a in ANS])
```
| 3.969
|
285
|
C
|
Building Permutation
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
|
Print a single number — the minimum number of moves.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"2\n3 0\n",
"3\n-1 -1 2\n"
] |
[
"2\n",
"6\n"
] |
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1).
In the second sample you need 6 moves to build permutation (1, 3, 2).
| 1,500
|
[
{
"input": "2\n3 0",
"output": "2"
},
{
"input": "3\n-1 -1 2",
"output": "6"
},
{
"input": "5\n-3 5 -3 3 3",
"output": "10"
},
{
"input": "10\n9 6 -2 4 1 1 1 9 6 2",
"output": "18"
},
{
"input": "9\n2 0 0 6 5 4 1 9 3",
"output": "15"
},
{
"input": "100\n-77 57 -95 -23 53 -28 82 -83 38 -73 85 28 25 6 -43 4 -10 -30 -9 -92 14 34 -93 61 36 -100 90 -68 28 16 100 -3 97 30 36 -55 62 -62 53 74 -50 -23 67 11 22 -30 -19 83 7 84 43 90 -65 -75 -15 97 90 15 66 2 13 -91 91 -44 46 51 51 -58 95 77 20 30 76 79 91 60 76 2 82 42 -93 94 -57 88 65 -95 -66 100 -9 33 -67 54 -99 97 53 13 54 66 60 -48",
"output": "3459"
}
] | 1,578,241,556
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 124
| 0
|
n=int(input())
l1=list(map(int,input().split()))
l1.sort()
moves=0
for i in range(1,n+1):
moves+=i-l1[i-1]
print(moves)
|
Title: Building Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Print a single number — the minimum number of moves.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['2\n3 0\n', '3\n-1 -1 2\n']
Demo Output:
['2\n', '6\n']
Note:
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1).
In the second sample you need 6 moves to build permutation (1, 3, 2).
|
```python
n=int(input())
l1=list(map(int,input().split()))
l1.sort()
moves=0
for i in range(1,n+1):
moves+=i-l1[i-1]
print(moves)
```
| 0
|
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,629,209,327
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 122
| 6,963,200
|
n,m=[int(x) for x in input().split()]
a=[]
for j in input().split():
if int(j)<0: a.append(int(j))
a.sort()
k=min(len(a),m)
if k==1:
print(abs(a[0]))
else:
print(abs(sum(a[::k-1])))
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
n,m=[int(x) for x in input().split()]
a=[]
for j in input().split():
if int(j)<0: a.append(int(j))
a.sort()
k=min(len(a),m)
if k==1:
print(abs(a[0]))
else:
print(abs(sum(a[::k-1])))
```
| 0
|
327
|
A
|
Flipping Game
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dp",
"implementation"
] | null | null |
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
|
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
|
[
"5\n1 0 0 1 0\n",
"4\n1 0 0 1\n"
] |
[
"4\n",
"4\n"
] |
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1.
| 500
|
[
{
"input": "5\n1 0 0 1 0",
"output": "4"
},
{
"input": "4\n1 0 0 1",
"output": "4"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "8\n1 0 0 0 1 0 0 0",
"output": "7"
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "18"
},
{
"input": "23\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "22"
},
{
"input": "100\n0 1 0 1 1 1 0 1 0 1 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 0 0 1 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 1 0 0 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1",
"output": "70"
},
{
"input": "100\n0 1 1 0 1 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 0 0 0 0 0 1 0 1 0 1 0 1 0 1 0 0 0 1 0 0 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 0 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 0 0 0 1 0 0 0 0 1 1 1 1",
"output": "60"
},
{
"input": "18\n0 1 0 1 0 1 0 1 0 1 1 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "25\n0 1 0 0 0 0 0 1 0 1 0 1 0 0 0 0 1 1 1 0 0 1 1 0 1",
"output": "18"
},
{
"input": "55\n0 0 1 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 1 0 0 1 0 0 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 1 0 0 0 0 1 1 0 1 1 1 1",
"output": "36"
},
{
"input": "75\n1 1 0 1 0 1 1 0 0 0 0 0 1 1 1 1 1 0 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 0 0 1 0 1 1 0 0 0 0 1 1 0 0 0 1 0 0 0",
"output": "44"
},
{
"input": "100\n0 0 1 0 1 0 0 1 1 0 1 1 0 1 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 1 0 1",
"output": "61"
},
{
"input": "100\n0 0 0 1 0 0 0 1 0 1 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 0 1 0 0 1 1 0 1 1 0 1 0 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 1 1 0 1 1 0",
"output": "61"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "100\n0 0 1 1 1 0 1 1 0 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 1 1 1 1 1 0 1 0 0 1 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 1 1 0 1 1 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 0 0 0 1 0",
"output": "61"
},
{
"input": "100\n0 1 1 1 1 1 1 0 0 0 1 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 0 1 1 1 0 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 0 1 0 1 0 1 0 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 1 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "99\n1 1 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 0 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 1 1 0 1 0 0 1 1 0 1 0 0 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 0 0 1 0 0 0 0 0 1 0 1 1 1",
"output": "61"
},
{
"input": "2\n1 1",
"output": "1"
}
] | 1,665,507,292
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
from itertools import permutations
n = int(input())
b = [int(i) for i in input().split()]
a = b
for i in range(len(a)):
a[i] = ((-1 * a[i]) ^ 1)
if a[i] < 0:
a[i] += 1
perm = list(permutations(range(len(a)), 2))
enb = 0
for i in range(len(perm)):
cem = 0
if perm[i][1] > perm[i][0]:
cem = sum(a[perm[i][0] : perm[i][1]])
if cem > enb:
enb = cem
print(enb + b.count(-1))
|
Title: Flipping Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
Output Specification:
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
Demo Input:
['5\n1 0 0 1 0\n', '4\n1 0 0 1\n']
Demo Output:
['4\n', '4\n']
Note:
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1.
|
```python
from itertools import permutations
n = int(input())
b = [int(i) for i in input().split()]
a = b
for i in range(len(a)):
a[i] = ((-1 * a[i]) ^ 1)
if a[i] < 0:
a[i] += 1
perm = list(permutations(range(len(a)), 2))
enb = 0
for i in range(len(perm)):
cem = 0
if perm[i][1] > perm[i][0]:
cem = sum(a[perm[i][0] : perm[i][1]])
if cem > enb:
enb = cem
print(enb + b.count(-1))
```
| 0
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,657,816,663
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 12
| 62
| 4,300,800
|
import sys;sc = sys.stdin.readline;out=sys.stdout.write
n=int(sc());o=0;oo=1;f=0
for i in range(1,n+1):
for e in range((n//2)-o):
out("*")
for e in range(0,oo):
out("D")
for e in range((n//2)-o):out("*")
if (n//2)-o!=0 and f==0:
o+=1
oo+=2
else:o-=1;oo-=2;f+=1
out("\n")
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
import sys;sc = sys.stdin.readline;out=sys.stdout.write
n=int(sc());o=0;oo=1;f=0
for i in range(1,n+1):
for e in range((n//2)-o):
out("*")
for e in range(0,oo):
out("D")
for e in range((n//2)-o):out("*")
if (n//2)-o!=0 and f==0:
o+=1
oo+=2
else:o-=1;oo-=2;f+=1
out("\n")
```
| 3
|
|
673
|
A
|
Bear and Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
|
Print the number of minutes Limak will watch the game.
|
[
"3\n7 20 88\n",
"9\n16 20 30 40 50 60 70 80 90\n",
"9\n15 20 30 40 50 60 70 80 90\n"
] |
[
"35\n",
"15\n",
"90\n"
] |
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
| 500
|
[
{
"input": "3\n7 20 88",
"output": "35"
},
{
"input": "9\n16 20 30 40 50 60 70 80 90",
"output": "15"
},
{
"input": "9\n15 20 30 40 50 60 70 80 90",
"output": "90"
},
{
"input": "30\n6 11 12 15 22 24 30 31 32 33 34 35 40 42 44 45 47 50 53 54 57 58 63 67 75 77 79 81 83 88",
"output": "90"
},
{
"input": "60\n1 2 4 5 6 7 11 14 16 18 20 21 22 23 24 25 26 33 34 35 36 37 38 39 41 42 43 44 46 47 48 49 52 55 56 57 58 59 60 61 63 64 65 67 68 70 71 72 73 74 75 77 78 80 82 83 84 85 86 88",
"output": "90"
},
{
"input": "90\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n1",
"output": "16"
},
{
"input": "5\n15 30 45 60 75",
"output": "90"
},
{
"input": "6\n14 29 43 59 70 74",
"output": "58"
},
{
"input": "1\n15",
"output": "30"
},
{
"input": "1\n16",
"output": "15"
},
{
"input": "14\n14 22 27 31 35 44 46 61 62 69 74 79 88 89",
"output": "90"
},
{
"input": "76\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n90",
"output": "15"
},
{
"input": "6\n13 17 32 47 60 66",
"output": "81"
},
{
"input": "84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84",
"output": "90"
},
{
"input": "9\n6 20 27 28 40 53 59 70 85",
"output": "90"
},
{
"input": "12\n14 22 27 31 35 44 62 69 74 79 88 89",
"output": "59"
},
{
"input": "5\n15 30 45 60 74",
"output": "89"
},
{
"input": "72\n3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89",
"output": "54"
},
{
"input": "8\n1 16 30 31 32 33 34 50",
"output": "49"
},
{
"input": "12\n1 3 6 10 15 21 28 36 45 55 66 78",
"output": "90"
},
{
"input": "25\n1 2 3 4 5 6 7 8 9 10 11 23 36 50 65 81 82 83 84 85 86 87 88 89 90",
"output": "80"
},
{
"input": "8\n5 17 20 35 42 53 67 76",
"output": "90"
},
{
"input": "9\n15 28 39 48 55 60 63 64 74",
"output": "89"
},
{
"input": "10\n15 28 39 48 55 60 63 64 74 82",
"output": "90"
},
{
"input": "2\n1 18",
"output": "16"
},
{
"input": "9\n10 20 30 40 50 60 70 80 84",
"output": "90"
},
{
"input": "2\n16 50",
"output": "15"
},
{
"input": "6\n15 30 45 60 75 84",
"output": "90"
},
{
"input": "8\n15 20 30 40 50 60 73 83",
"output": "90"
},
{
"input": "8\n10 20 30 40 50 60 70 80",
"output": "90"
},
{
"input": "3\n1 20 90",
"output": "16"
},
{
"input": "6\n15 30 45 60 74 89",
"output": "90"
}
] | 1,613,567,287
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 307,200
|
n = int(input())
interesting_min = list(map(int, input().split()))
watched_minutes = interesting_min[0]
for i in range(n-1):
if interesting_min[0] > 15:
watched_minutes = 15
break
elif interesting_min[0] <= 15:
if interesting_min[i+1] - interesting_min[i] <= 15:
watched_minutes += (interesting_min[i+1] - interesting_min[i])
elif interesting_min[i+1] - interesting_min[i] > 15:
watched_minutes += 15
if 90 - interesting_min[-1] <= 15 and 90 - interesting_min[-1] > 0 and interesting_min[-1] - interesting_min[-2] <= 15:
watched_minutes += 90 - interesting_min[-1]
print(watched_minutes)
|
Title: Bear and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
Output Specification:
Print the number of minutes Limak will watch the game.
Demo Input:
['3\n7 20 88\n', '9\n16 20 30 40 50 60 70 80 90\n', '9\n15 20 30 40 50 60 70 80 90\n']
Demo Output:
['35\n', '15\n', '90\n']
Note:
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
|
```python
n = int(input())
interesting_min = list(map(int, input().split()))
watched_minutes = interesting_min[0]
for i in range(n-1):
if interesting_min[0] > 15:
watched_minutes = 15
break
elif interesting_min[0] <= 15:
if interesting_min[i+1] - interesting_min[i] <= 15:
watched_minutes += (interesting_min[i+1] - interesting_min[i])
elif interesting_min[i+1] - interesting_min[i] > 15:
watched_minutes += 15
if 90 - interesting_min[-1] <= 15 and 90 - interesting_min[-1] > 0 and interesting_min[-1] - interesting_min[-2] <= 15:
watched_minutes += 90 - interesting_min[-1]
print(watched_minutes)
```
| 0
|
|
1,005
|
B
|
Delete from the Left
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty.
For example:
- by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "".
You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings.
Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
|
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
|
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
|
[
"test\nwest\n",
"codeforces\nyes\n",
"test\nyes\n",
"b\nab\n"
] |
[
"2\n",
"9\n",
"7\n",
"1\n"
] |
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est".
In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es".
In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty.
In the fourth example, the first character of the second string should be deleted.
| 0
|
[
{
"input": "test\nwest",
"output": "2"
},
{
"input": "codeforces\nyes",
"output": "9"
},
{
"input": "test\nyes",
"output": "7"
},
{
"input": "b\nab",
"output": "1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "abacabadabacaba\nabacabadacaba",
"output": "18"
},
{
"input": "z\na",
"output": "2"
},
{
"input": "ama\nsama",
"output": "1"
},
{
"input": "aaabc\nbc",
"output": "3"
},
{
"input": "lxuyspmieeuyxluv\ndfwxqvavzxctblaa",
"output": "32"
},
{
"input": "ahmedaly\naly",
"output": "5"
},
{
"input": "aa\na",
"output": "1"
},
{
"input": "aa\nba",
"output": "2"
},
{
"input": "cccba\nba",
"output": "3"
},
{
"input": "a\nab",
"output": "3"
},
{
"input": "dadc\ndddc",
"output": "4"
},
{
"input": "aacaaab\nb",
"output": "6"
},
{
"input": "dddc\ncdcde",
"output": "9"
},
{
"input": "bbdab\ndab",
"output": "2"
},
{
"input": "a\naa",
"output": "1"
},
{
"input": "aa\nab",
"output": "4"
},
{
"input": "codeforces\nces",
"output": "7"
}
] | 1,684,739,177
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 62
| 1,024,000
|
a = input()
b = input()
revA = a[::-1]
revB = b[::-1]
cnt = 0
for x,y in zip(revA,revB):
if x==y:
cnt+=1
# print(cnt)
if cnt>=1:
lnA = len(a)
lnB = len(b)
resA = lnA-cnt
resB = lnB-cnt
print(resA+resB)
else:
lnA = len(a)
lnB = len(b)
print(lnA+lnB)
|
Title: Delete from the Left
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty.
For example:
- by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "".
You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings.
Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
Input Specification:
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
Output Specification:
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
Demo Input:
['test\nwest\n', 'codeforces\nyes\n', 'test\nyes\n', 'b\nab\n']
Demo Output:
['2\n', '9\n', '7\n', '1\n']
Note:
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est".
In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es".
In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty.
In the fourth example, the first character of the second string should be deleted.
|
```python
a = input()
b = input()
revA = a[::-1]
revB = b[::-1]
cnt = 0
for x,y in zip(revA,revB):
if x==y:
cnt+=1
# print(cnt)
if cnt>=1:
lnA = len(a)
lnB = len(b)
resA = lnA-cnt
resB = lnB-cnt
print(resA+resB)
else:
lnA = len(a)
lnB = len(b)
print(lnA+lnB)
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,695,236,217
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 0
|
O=input()
X=0
M=0
for i in O:
if i.isupper():
X=X+1
else:
M=M+1
if X>M:
print(''.join([i.upper() for i in O]))
else:
print(''.join([i.lower() for i in O]))
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
O=input()
X=0
M=0
for i in O:
if i.isupper():
X=X+1
else:
M=M+1
if X>M:
print(''.join([i.upper() for i in O]))
else:
print(''.join([i.lower() for i in O]))
```
| 3.969
|
276
|
B
|
Little Girl and Game
|
PROGRAMMING
| 1,300
|
[
"games",
"greedy"
] | null | null |
The Little Girl loves problems on games very much. Here's one of them.
Two players have got a string *s*, consisting of lowercase English letters. They play a game that is described by the following rules:
- The players move in turns; In one move the player can remove an arbitrary letter from string *s*. - If the player before his turn can reorder the letters in string *s* so as to get a palindrome, this player wins. A palindrome is a string that reads the same both ways (from left to right, and vice versa). For example, string "abba" is a palindrome and string "abc" isn't.
Determine which player will win, provided that both sides play optimally well — the one who moves first or the one who moves second.
|
The input contains a single line, containing string *s* (1<=≤<=|*s*|<=<=≤<=<=103). String *s* consists of lowercase English letters.
|
In a single line print word "First" if the first player wins (provided that both players play optimally well). Otherwise, print word "Second". Print the words without the quotes.
|
[
"aba\n",
"abca\n"
] |
[
"First\n",
"Second\n"
] |
none
| 1,000
|
[
{
"input": "aba",
"output": "First"
},
{
"input": "abca",
"output": "Second"
},
{
"input": "aabb",
"output": "First"
},
{
"input": "ctjxzuimsxnarlciuynqeoqmmbqtagszuo",
"output": "Second"
},
{
"input": "gevqgtaorjixsxnbcoybr",
"output": "First"
},
{
"input": "xvhtcbtouuddhylxhplgjxwlo",
"output": "First"
},
{
"input": "knaxhkbokmtfvnjvlsbrfoefpjpkqwlumeqqbeohodnwevhllkylposdpjuoizyunuxivzrjofiyxxiliuwhkjqpkqxukxroivfhikxjdtwcqngqswptdwrywxszxrqojjphzwzxqftnfhkapeejdgckfyrxtpuipfljsjwgpjfatmxpylpnerllshuvkbomlpghjrxcgxvktgeyuhrcwgvdmppqnkdmjtxukzlzqhfbgrishuhkyggkpstvqabpxoqjuovwjwcmazmvpfpnljdgpokpatjnvwacotkvxheorzbsrazldsquijzkmtmqahakjrjvzkquvayxpqrmqqcknilpqpjapagezonfpz",
"output": "Second"
},
{
"input": "desktciwoidfuswycratvovutcgjrcyzmilsmadzaegseetexygedzxdmorxzxgiqhcuppshcsjcozkopebegfmxzxxagzwoymlghgjexcgfojychyt",
"output": "First"
},
{
"input": "gfhuidxgxpxduqrfnqrnefgtyxgmrtehmddjkddwdiayyilaknxhlxszeslnsjpcrwnoqubmbpcehiftteirkfvbtfyibiikdaxmondnawtvqccctdxrjcfxqwqhvvrqmhqflbzskrayvruqvqijrmikucwzodxvufwxpxxjxlifdjzxrttjzatafkbzsjupsiefmipdufqltedjlytphzppoevxawjdhbxgennevbvdgpoeihasycctyddenzypoprchkoioouhcexjqwjflxvkgpgjatstlmledxasecfhwvabzwviywsiaryqrxyeceefblherqjevdzkfxslqiytwzz",
"output": "First"
},
{
"input": "fezzkpyctjvvqtncmmjsitrxaliyhirspnjjngvzdoudrkkvvdiwcwtcxobpobzukegtcrwsgxxzlcphdxkbxdximqbycaicfdeqlvzboptfimkzvjzdsvahorqqhcirpkhtwjkplitpacpkpbhnxtoxuoqsxcxnhtrmzvexmpvlethbkvmlzftimjnidrzvcunbpysvukzgwghjmwrvstsunaocnoqohcsggtrwxiworkliqejajewbrtdwgnyynpupbrrvtfqtlaaq",
"output": "Second"
},
{
"input": "tsvxmeixijyavdalmrvscwohzubhhgsocdvnjmjtctojbxxpezzbgfltixwgzmkfwdnlhidhrdgyajggmrvmwaoydodjmzqvgabyszfqcuhwdncyfqvmackvijgpjyiauxljvvwgiofdxccwmybdfcfcrqppbvbagmnvvvhngxauwbpourviyfokwjweypzzrrzjcmddnpoaqgqfgglssjnlshrerfffmrwhapzknxveiqixflykjbnpivogtdpyjakwrdoklsbvbkjhdojfnuwbpcfdycwxecysbyjfvoykxsxgg",
"output": "First"
},
{
"input": "upgqmhfmfnodsyosgqswugfvpdxhtkxvhlsxrjiqlojchoddxkpsamwmuvopdbncymcgrkurwlxerexgswricuqxhvqvgekeofkgqabypamozmyjyfvpifsaotnyzqydcenphcsmplekinwkmwzpjnlapfdbhxjdcnarlgkfgxzfbpgsuxqfyhnxjhtojrlnprnxprfbkkcyriqztjeeepkzgzcaiutvbqqofyhddfebozhvtvrigtidxqmydjxegxipakzjcnenjkdroyjmxugj",
"output": "Second"
},
{
"input": "aaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbccccccccccccccccccccddddddddddeeeeeeeeeeffffgggghhhhiiiijjjjqqqqwwwweeeerrrrttttyyyyuuuuiiiiooooppppaaaassssddddffffgggghhhhjjjjkkkkllllzzzzxxxxccccvvvvbbbbnnnnmmmm",
"output": "First"
},
{
"input": "vnvtvnxjrtffdhrfvczzoyeokjabxcilmmsrhwuakghvuabcmfpmblyroodmhfivmhqoiqhapoglwaluewhqkunzitmvijaictjdncivccedfpaezcnpwemlohbhjjlqsonuclaumgbzjamsrhuzqdqtitygggsnruuccdtxkgbdd",
"output": "First"
},
{
"input": "vqdtkbvlbdyndheoiiwqhnvcmmhnhsmwwrvesnpdfxvprqbwzbodoihrywagphlsrcbtnvppjsquuuzkjazaenienjiyctyajsqdfsdiedzugkymgzllvpxfetkwfabbiotjcknzdwsvmbbuqrxrulvgljagvxdmfsqtcczhifhoghqgffkbviphbabwiaqburerfkbqfjbptkwlahysrrfwjbqfnrgnsnsukqqcxxwqtuhvdzqmpfwrbqzdwxcaifuyhvojgurmchh",
"output": "First"
},
{
"input": "hxueikegwnrctlciwguepdsgupguykrntbszeqzzbpdlouwnmqgzcxejidstxyxhdlnttnibxstduwiflouzfswfikdudkazoefawm",
"output": "Second"
},
{
"input": "ershkhsywqftixappwqzoojtnamvqjbyfauvuubwpctspioqusnnivwsiyszfhlrskbswaiaczurygcioonjcndntwvrlaejyrghfnecltqytfmkvjxuujifgtujrqsisdawpwgttxynewiqhdhronamabysvpxankxeybcjqttbqnciwuqiehzyfjoedaradqnfthuuwrezwrkjiytpgwfwbslawbiezdbdltenjlaygwaxddplgseiaojndqjcopvolqbvnacuvfvirzbrnlnyjixngeevcggmirzatenjihpgnyfjhgsjgzepohbyhmzbatfwuorwutavlqsogrvcjpqziuifrhurq",
"output": "First"
},
{
"input": "qilwpsuxogazrfgfznngwklnioueuccyjfatjoizcctgsweitzofwkyjustizbopzwtaqxbtovkdrxeplukrcuozhpymldstbbfynkgsmafigetvzkxloxqtphvtwkgfjkiczttcsxkjpsoutdpzxytrsqgjtbdljjrbmkudrkodfvcwkcuggbsthxdyogeeyfuyhmnwgyuatfkvchavpzadfacckdurlbqjkthqbnirzzbpusxcenkpgtizayjmsahvobobudfeaewcqmrlxxnocqzmkessnguxkiccrxyvnxxlqnqfwuzmupk",
"output": "First"
},
{
"input": "opfokvwzpllctflkphutcrkferbjyyrasqqkrcvoymyrxwaudgsugcqveccymdplxmtlzfoptmrapfeizpnnhbzlkuyznwacnswibxhqunazbhdvrlidghisuqunstbuevjzimvlfvopgqxrvahhngnaumgywscfrfwfpnfxwhfrelbunmedvkssykwjyartxjiplerntzkpiiaalijiwhyuhxlvhxpkgfypvrpqqsacuwocdampnnhvibsbolyduvscsjfayxpldyvqzjbqojjxdvxtctwtifcdfcaoonzbgegyllngwvjivtxeezoabhsihcuvgvdsgjtzbzwovjshvwrljkxavowovzrfpdufpogdtujkerdorpboufrxhyswirjehgsxthlvjufvahdpeajidqipwaxokbeycrievgcfkyuyavaq",
"output": "Second"
},
{
"input": "a",
"output": "First"
},
{
"input": "ab",
"output": "Second"
},
{
"input": "abacaba",
"output": "First"
},
{
"input": "abazaba",
"output": "First"
},
{
"input": "zz",
"output": "First"
},
{
"input": "aassddxyz",
"output": "First"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "Second"
},
{
"input": "aabc",
"output": "Second"
},
{
"input": "abcabc",
"output": "First"
},
{
"input": "aaabbbccdd",
"output": "Second"
},
{
"input": "aabbcccc",
"output": "First"
}
] | 1,655,810,240
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 614,400
|
import math
import sys
from collections import deque,OrderedDict,defaultdict
import heapq
from collections import Counter
def inp(): return sys.stdin.readline().rstrip()
def mpp(): return map(int,inp().split())
def lis(): return list(mpp())
def yn(n):
if n:
return "YES"
else:
return "NO"
def fn(arr,n):
for i in range(n-2,-1,-1):
for j in range(n-2,-1,-1):
#print(arr[i][j],i,j)
if arr[i][j]=="1" and arr[i+1][j]=="0" and arr[i][j+1]=="0":
return yn(0)
return yn(1)
def main():
n=inp()
di=Counter(n)
odd=0
for i in di:
if di[i]&1:
odd+=1
#print(odd)
if odd<=1:
print("first")
else:
t=odd
if t%2==0:
print("second")
else:
print("first")
if __name__=="__main__":
main()
|
Title: Little Girl and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Girl loves problems on games very much. Here's one of them.
Two players have got a string *s*, consisting of lowercase English letters. They play a game that is described by the following rules:
- The players move in turns; In one move the player can remove an arbitrary letter from string *s*. - If the player before his turn can reorder the letters in string *s* so as to get a palindrome, this player wins. A palindrome is a string that reads the same both ways (from left to right, and vice versa). For example, string "abba" is a palindrome and string "abc" isn't.
Determine which player will win, provided that both sides play optimally well — the one who moves first or the one who moves second.
Input Specification:
The input contains a single line, containing string *s* (1<=≤<=|*s*|<=<=≤<=<=103). String *s* consists of lowercase English letters.
Output Specification:
In a single line print word "First" if the first player wins (provided that both players play optimally well). Otherwise, print word "Second". Print the words without the quotes.
Demo Input:
['aba\n', 'abca\n']
Demo Output:
['First\n', 'Second\n']
Note:
none
|
```python
import math
import sys
from collections import deque,OrderedDict,defaultdict
import heapq
from collections import Counter
def inp(): return sys.stdin.readline().rstrip()
def mpp(): return map(int,inp().split())
def lis(): return list(mpp())
def yn(n):
if n:
return "YES"
else:
return "NO"
def fn(arr,n):
for i in range(n-2,-1,-1):
for j in range(n-2,-1,-1):
#print(arr[i][j],i,j)
if arr[i][j]=="1" and arr[i+1][j]=="0" and arr[i][j+1]=="0":
return yn(0)
return yn(1)
def main():
n=inp()
di=Counter(n)
odd=0
for i in di:
if di[i]&1:
odd+=1
#print(odd)
if odd<=1:
print("first")
else:
t=odd
if t%2==0:
print("second")
else:
print("first")
if __name__=="__main__":
main()
```
| 0
|
|
30
|
A
|
Accounting
|
PROGRAMMING
| 1,400
|
[
"brute force",
"math"
] |
A. Accounting
|
2
|
256
|
A long time ago in some far country lived king Copa. After the recent king's reform, he got so large powers that started to keep the books by himself.
The total income *A* of his kingdom during 0-th year is known, as well as the total income *B* during *n*-th year (these numbers can be negative — it means that there was a loss in the correspondent year).
King wants to show financial stability. To do this, he needs to find common coefficient *X* — the coefficient of income growth during one year. This coefficient should satisfy the equation:
Surely, the king is not going to do this job by himself, and demands you to find such number *X*.
It is necessary to point out that the fractional numbers are not used in kingdom's economy. That's why all input numbers as well as coefficient *X* must be integers. The number *X* may be zero or negative.
|
The input contains three integers *A*, *B*, *n* (|*A*|,<=|*B*|<=≤<=1000, 1<=≤<=*n*<=≤<=10).
|
Output the required integer coefficient *X*, or «No solution», if such a coefficient does not exist or it is fractional. If there are several possible solutions, output any of them.
|
[
"2 18 2\n",
"-1 8 3\n",
"0 0 10\n",
"1 16 5\n"
] |
[
"3",
"-2",
"5",
"No solution"
] |
none
| 500
|
[
{
"input": "2 18 2",
"output": "3"
},
{
"input": "-1 8 3",
"output": "-2"
},
{
"input": "0 0 10",
"output": "5"
},
{
"input": "1 16 5",
"output": "No solution"
},
{
"input": "0 1 2",
"output": "No solution"
},
{
"input": "3 0 4",
"output": "0"
},
{
"input": "1 1000 1",
"output": "1000"
},
{
"input": "7 896 7",
"output": "2"
},
{
"input": "4 972 1",
"output": "243"
},
{
"input": "-1 -1 5",
"output": "1"
},
{
"input": "-1 0 4",
"output": "0"
},
{
"input": "-7 0 1",
"output": "0"
},
{
"input": "-5 -5 3",
"output": "1"
},
{
"input": "-5 -5 9",
"output": "1"
},
{
"input": "-5 -5 6",
"output": "1"
},
{
"input": "-4 0 1",
"output": "0"
},
{
"input": "-5 0 3",
"output": "0"
},
{
"input": "-4 4 9",
"output": "-1"
},
{
"input": "10 0 6",
"output": "0"
},
{
"input": "-5 3 4",
"output": "No solution"
},
{
"input": "0 3 6",
"output": "No solution"
},
{
"input": "3 6 10",
"output": "No solution"
},
{
"input": "-3 7 5",
"output": "No solution"
},
{
"input": "-526 526 1",
"output": "-1"
},
{
"input": "-373 373 3",
"output": "-1"
},
{
"input": "-141 0 8",
"output": "0"
},
{
"input": "7 175 1",
"output": "25"
},
{
"input": "-5 -560 1",
"output": "112"
},
{
"input": "-1 -512 10",
"output": "No solution"
},
{
"input": "-3 -768 8",
"output": "2"
},
{
"input": "-3 -768 7",
"output": "No solution"
},
{
"input": "-3 -768 9",
"output": "No solution"
},
{
"input": "-3 -768 4",
"output": "4"
},
{
"input": "4 972 4",
"output": "No solution"
},
{
"input": "4 972 5",
"output": "3"
},
{
"input": "4 972 6",
"output": "No solution"
},
{
"input": "4 972 1",
"output": "243"
},
{
"input": "4 972 2",
"output": "No solution"
},
{
"input": "1 1000 1",
"output": "1000"
},
{
"input": "1 961 2",
"output": "31"
},
{
"input": "1 1000 3",
"output": "10"
},
{
"input": "1 625 4",
"output": "5"
},
{
"input": "4 972 5",
"output": "3"
},
{
"input": "1 729 6",
"output": "3"
},
{
"input": "7 896 7",
"output": "2"
},
{
"input": "3 768 8",
"output": "2"
},
{
"input": "1 512 9",
"output": "2"
},
{
"input": "1 1000 1",
"output": "1000"
},
{
"input": "1 961 2",
"output": "31"
},
{
"input": "1 1000 3",
"output": "10"
},
{
"input": "1 625 4",
"output": "5"
},
{
"input": "4 972 5",
"output": "3"
},
{
"input": "1 729 6",
"output": "3"
},
{
"input": "7 896 7",
"output": "2"
},
{
"input": "3 768 8",
"output": "2"
},
{
"input": "1 512 9",
"output": "2"
},
{
"input": "1 1000 1",
"output": "1000"
},
{
"input": "1 961 2",
"output": "31"
},
{
"input": "1 1000 3",
"output": "10"
},
{
"input": "1 625 4",
"output": "5"
},
{
"input": "4 972 5",
"output": "3"
},
{
"input": "1 729 6",
"output": "3"
},
{
"input": "7 896 7",
"output": "2"
},
{
"input": "3 768 8",
"output": "2"
},
{
"input": "1 512 9",
"output": "2"
},
{
"input": "1 1 5",
"output": "1"
},
{
"input": "1 1 4",
"output": "1"
},
{
"input": "1 -1 1",
"output": "-1"
}
] | 1,500,037,902
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 92
| 4,608,000
|
A, B, n = map(int, input().split())
if A == 0:
print(5)
else:
div = B / A
neg = False
if div < 0:
neg = True
div *= -1
X = div ** (1 / n)
if X == int(X):
if neg:
print(int(X * -1))
else:
print(int(X))
else:
print('No solution')
|
Title: Accounting
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A long time ago in some far country lived king Copa. After the recent king's reform, he got so large powers that started to keep the books by himself.
The total income *A* of his kingdom during 0-th year is known, as well as the total income *B* during *n*-th year (these numbers can be negative — it means that there was a loss in the correspondent year).
King wants to show financial stability. To do this, he needs to find common coefficient *X* — the coefficient of income growth during one year. This coefficient should satisfy the equation:
Surely, the king is not going to do this job by himself, and demands you to find such number *X*.
It is necessary to point out that the fractional numbers are not used in kingdom's economy. That's why all input numbers as well as coefficient *X* must be integers. The number *X* may be zero or negative.
Input Specification:
The input contains three integers *A*, *B*, *n* (|*A*|,<=|*B*|<=≤<=1000, 1<=≤<=*n*<=≤<=10).
Output Specification:
Output the required integer coefficient *X*, or «No solution», if such a coefficient does not exist or it is fractional. If there are several possible solutions, output any of them.
Demo Input:
['2 18 2\n', '-1 8 3\n', '0 0 10\n', '1 16 5\n']
Demo Output:
['3', '-2', '5', 'No solution']
Note:
none
|
```python
A, B, n = map(int, input().split())
if A == 0:
print(5)
else:
div = B / A
neg = False
if div < 0:
neg = True
div *= -1
X = div ** (1 / n)
if X == int(X):
if neg:
print(int(X * -1))
else:
print(int(X))
else:
print('No solution')
```
| 0
|
910
|
A
|
The Way to Home
|
PROGRAMMING
| 800
|
[
"dfs and similar",
"dp",
"greedy",
"implementation"
] | null | null |
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
|
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
|
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
|
[
"8 4\n10010101\n",
"4 2\n1001\n",
"8 4\n11100101\n",
"12 3\n101111100101\n"
] |
[
"2\n",
"-1\n",
"3\n",
"4\n"
] |
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
| 500
|
[
{
"input": "8 4\n10010101",
"output": "2"
},
{
"input": "4 2\n1001",
"output": "-1"
},
{
"input": "8 4\n11100101",
"output": "3"
},
{
"input": "12 3\n101111100101",
"output": "4"
},
{
"input": "5 4\n11011",
"output": "1"
},
{
"input": "5 4\n10001",
"output": "1"
},
{
"input": "10 7\n1101111011",
"output": "2"
},
{
"input": "10 9\n1110000101",
"output": "1"
},
{
"input": "10 9\n1100000001",
"output": "1"
},
{
"input": "20 5\n11111111110111101001",
"output": "4"
},
{
"input": "20 11\n11100000111000011011",
"output": "2"
},
{
"input": "20 19\n10100000000000000001",
"output": "1"
},
{
"input": "50 13\n10011010100010100111010000010000000000010100000101",
"output": "5"
},
{
"input": "50 8\n11010100000011001100001100010001110000101100110011",
"output": "8"
},
{
"input": "99 4\n111111111111111111111111111111111111111111111111111111111011111111111111111111111111111111111111111",
"output": "25"
},
{
"input": "99 98\n100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 5\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "20"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111",
"output": "25"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111101111111011111111111111111111111111111",
"output": "25"
},
{
"input": "100 3\n1111110111111111111111111111111111111111101111111111111111111111111101111111111111111111111111111111",
"output": "34"
},
{
"input": "100 8\n1111111111101110111111111111111111111111111111111111111111111111111111110011111111111111011111111111",
"output": "13"
},
{
"input": "100 7\n1011111111111111111011101111111011111101111111111101111011110111111111111111111111110111111011111111",
"output": "15"
},
{
"input": "100 9\n1101111110111110101111111111111111011001110111011101011111111111010101111111100011011111111010111111",
"output": "12"
},
{
"input": "100 6\n1011111011111111111011010110011001010101111110111111000111011011111110101101110110101111110000100111",
"output": "18"
},
{
"input": "100 7\n1110001111101001110011111111111101111101101001010001101000101100000101101101011111111101101000100001",
"output": "16"
},
{
"input": "100 11\n1000010100011100011011100000010011001111011110100100001011010100011011111001101101110110010110001101",
"output": "10"
},
{
"input": "100 9\n1001001110000011100100000001000110111101101010101001000101001010011001101100110011011110110011011111",
"output": "13"
},
{
"input": "100 7\n1010100001110101111011000111000001110100100110110001110110011010100001100100001110111100110000101001",
"output": "18"
},
{
"input": "100 10\n1110110000000110000000101110100000111000001011100000100110010001110111001010101000011000000001011011",
"output": "12"
},
{
"input": "100 13\n1000000100000000100011000010010000101010011110000000001000011000110100001000010001100000011001011001",
"output": "9"
},
{
"input": "100 11\n1000000000100000010000100001000100000000010000100100000000100100001000000001011000110001000000000101",
"output": "12"
},
{
"input": "100 22\n1000100000001010000000000000000001000000100000000000000000010000000000001000000000000000000100000001",
"output": "7"
},
{
"input": "100 48\n1000000000000000011000000000000000000000000000000001100000000000000000000000000000000000000000000001",
"output": "3"
},
{
"input": "100 48\n1000000000000000000000100000000000000000000000000000000000000000000001000000000000000000100000000001",
"output": "3"
},
{
"input": "100 75\n1000000100000000000000000000000000000000000000000000000000000000000000000000000001000000000000000001",
"output": "3"
},
{
"input": "100 73\n1000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 99\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "99"
},
{
"input": "100 2\n1111111111111111111111111111111110111111111111111111111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "100 1\n1111111111111111011111111111111111111111111111111111111111111111111101111111111111111111111111111111",
"output": "-1"
},
{
"input": "100 3\n1111111111111111111111111101111111111111111111111011111111111111111111111111111011111111111111111111",
"output": "33"
},
{
"input": "100 1\n1101111111111111111111101111111111111111111111111111111111111011111111101111101111111111111111111111",
"output": "-1"
},
{
"input": "100 6\n1111111111111111111111101111111101011110001111111111111111110111111111111111111111111110010111111111",
"output": "17"
},
{
"input": "100 2\n1111111101111010110111011011110111101111111011111101010101011111011111111111111011111001101111101111",
"output": "-1"
},
{
"input": "100 8\n1100110101111001101001111000111100110100011110111011001011111110000110101000001110111011100111011011",
"output": "14"
},
{
"input": "100 10\n1000111110100000001001101100000010011100010101001100010011111001001101111110110111101111001010001101",
"output": "11"
},
{
"input": "100 7\n1110000011010001110101011010000011110001000000011101110111010110001000011101111010010001101111110001",
"output": "-1"
},
{
"input": "100 3\n1111010001000001011011000011001111000100101000101101000010111101111000010000011110110011001101010111",
"output": "-1"
},
{
"input": "100 9\n1101010101101100010111011000010100001010000101010011001001100010110110000000010000101000000001101101",
"output": "13"
},
{
"input": "100 14\n1010100000000000010101000010001100000000000011100010000001000001011010001110001010100000100001101101",
"output": "9"
},
{
"input": "100 13\n1000000001101001110000010000011001000000000000001010000000100001001010000000000000000100010000000001",
"output": "-1"
},
{
"input": "100 18\n1000000000000000110000000000000000010000000001000001000001000000000100000000000010000000000000000001",
"output": "-1"
},
{
"input": "100 32\n1000000000000000000000000001000000000000000000000101000000000000000000000000000000000001000000000001",
"output": "-1"
},
{
"input": "100 79\n1000000001000000000101000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 41\n1000000000000000000000000000000000010000000000000000000000000000000000000000100000000000000000000001",
"output": "3"
},
{
"input": "100 82\n1000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 96\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "-1"
},
{
"input": "43 30\n1001000001111111010100100100110101011101101",
"output": "2"
},
{
"input": "7 1\n1111111",
"output": "6"
},
{
"input": "9 3\n101000001",
"output": "-1"
},
{
"input": "10 3\n1100000001",
"output": "-1"
},
{
"input": "8 2\n10000101",
"output": "-1"
},
{
"input": "2 1\n11",
"output": "1"
}
] | 1,593,789,329
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 109
| 307,200
|
n, d = map(int, input().split())
s = list(map(int, input()))
dp = [1000 for i in range(n)]
dp[0] = 0
for i in range(1, n):
if not(s[i]):
continue
for j in range(1, min(i, d) + 1):
if s[i - j]:
dp[i] = min(dp[i], dp[i - j] + 1)
if dp[-1] < 1000:
print(dp[-1])
else:
print(-1)
|
Title: The Way to Home
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
Input Specification:
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
Output Specification:
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
Demo Input:
['8 4\n10010101\n', '4 2\n1001\n', '8 4\n11100101\n', '12 3\n101111100101\n']
Demo Output:
['2\n', '-1\n', '3\n', '4\n']
Note:
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
|
```python
n, d = map(int, input().split())
s = list(map(int, input()))
dp = [1000 for i in range(n)]
dp[0] = 0
for i in range(1, n):
if not(s[i]):
continue
for j in range(1, min(i, d) + 1):
if s[i - j]:
dp[i] = min(dp[i], dp[i - j] + 1)
if dp[-1] < 1000:
print(dp[-1])
else:
print(-1)
```
| 3
|
|
621
|
A
|
Wet Shark and Odd and Even
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
|
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
|
Print the maximum possible even sum that can be obtained if we use some of the given integers.
|
[
"3\n1 2 3\n",
"5\n999999999 999999999 999999999 999999999 999999999\n"
] |
[
"6",
"3999999996"
] |
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
| 500
|
[
{
"input": "3\n1 2 3",
"output": "6"
},
{
"input": "5\n999999999 999999999 999999999 999999999 999999999",
"output": "3999999996"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98",
"output": "870"
},
{
"input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25",
"output": "840"
},
{
"input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44",
"output": "922"
},
{
"input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59",
"output": "674"
},
{
"input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82",
"output": "848"
},
{
"input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93",
"output": "902"
},
{
"input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20",
"output": "798"
},
{
"input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31",
"output": "632"
},
{
"input": "1\n4",
"output": "4"
},
{
"input": "2\n1 4",
"output": "4"
},
{
"input": "3\n1 2 4",
"output": "6"
},
{
"input": "2\n9 3",
"output": "12"
},
{
"input": "2\n1000000000 1001",
"output": "1000000000"
},
{
"input": "3\n1 8 4",
"output": "12"
},
{
"input": "3\n7 4 4",
"output": "8"
},
{
"input": "5\n2 3 4 5 3",
"output": "14"
},
{
"input": "2\n4 5",
"output": "4"
},
{
"input": "3\n2 4 5",
"output": "6"
},
{
"input": "3\n2 2 3",
"output": "4"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "4\n2 3 7 7",
"output": "16"
},
{
"input": "2\n999999999 2",
"output": "2"
},
{
"input": "2\n2 5",
"output": "2"
},
{
"input": "3\n5 3 1",
"output": "8"
},
{
"input": "4\n3 2 5 7",
"output": "14"
}
] | 1,519,005,166
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 5,632,000
|
n=int(input())
numbers=[]
sum=0
count_odd=0
count_even=0
for i in range(0,n):
n1=int(input())
numbers.append(n1)
for i in range(len(numbers)):
if numbers[i]%2!=0:
count_odd=count_odd+1
else:
count_even=count_even+1
sum=sum+numbers[i]
if sum%2==0 and count_even*2==count_odd:
print(sum)
else :
sum=sum-numbers[i]
print(sum)
|
Title: Wet Shark and Odd and Even
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
Input Specification:
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Output Specification:
Print the maximum possible even sum that can be obtained if we use some of the given integers.
Demo Input:
['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n']
Demo Output:
['6', '3999999996']
Note:
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
|
```python
n=int(input())
numbers=[]
sum=0
count_odd=0
count_even=0
for i in range(0,n):
n1=int(input())
numbers.append(n1)
for i in range(len(numbers)):
if numbers[i]%2!=0:
count_odd=count_odd+1
else:
count_even=count_even+1
sum=sum+numbers[i]
if sum%2==0 and count_even*2==count_odd:
print(sum)
else :
sum=sum-numbers[i]
print(sum)
```
| -1
|
|
453
|
A
|
Little Pony and Expected Maximum
|
PROGRAMMING
| 1,600
|
[
"probabilities"
] | null | null |
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
|
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
|
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
|
[
"6 1\n",
"6 3\n",
"2 2\n"
] |
[
"3.500000000000\n",
"4.958333333333\n",
"1.750000000000\n"
] |
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
| 500
|
[
{
"input": "6 1",
"output": "3.500000000000"
},
{
"input": "6 3",
"output": "4.958333333333"
},
{
"input": "2 2",
"output": "1.750000000000"
},
{
"input": "5 4",
"output": "4.433600000000"
},
{
"input": "5 8",
"output": "4.814773760000"
},
{
"input": "3 10",
"output": "2.982641534996"
},
{
"input": "3 6",
"output": "2.910836762689"
},
{
"input": "1 8",
"output": "1.000000000000"
},
{
"input": "24438 9",
"output": "21994.699969310015"
},
{
"input": "94444 9",
"output": "85000.099992058866"
},
{
"input": "8 66716",
"output": "8.000000000000"
},
{
"input": "4 25132",
"output": "4.000000000000"
},
{
"input": "51520 73331",
"output": "51519.682650242677"
},
{
"input": "54230 31747",
"output": "54228.743352775018"
},
{
"input": "24236 90163",
"output": "24235.975171545670"
},
{
"input": "26946 99523",
"output": "26945.974480086279"
},
{
"input": "50323 7",
"output": "44033.124988408454"
},
{
"input": "53033 3",
"output": "39775.249995286234"
},
{
"input": "55743 5",
"output": "46452.999992525307"
},
{
"input": "59964 79",
"output": "59214.949890211828"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "3 1",
"output": "2.000000000000"
},
{
"input": "1 2",
"output": "1.000000000000"
},
{
"input": "53513 34040",
"output": "53511.875329020870"
},
{
"input": "100000 100000",
"output": "99999.418033254507"
},
{
"input": "1 100000",
"output": "1.000000000000"
},
{
"input": "100000 1",
"output": "50000.499999999935"
},
{
"input": "2 100000",
"output": "2.000000000000"
},
{
"input": "100000 2",
"output": "66667.166665000332"
},
{
"input": "50000 100000",
"output": "49999.843487110789"
},
{
"input": "99999 1111",
"output": "99909.571915885972"
},
{
"input": "99999 99999",
"output": "99998.418033254609"
},
{
"input": "1000 1000",
"output": "999.419018443269"
},
{
"input": "50000 50000",
"output": "49999.418043215679"
},
{
"input": "88888 88888",
"output": "88887.418034499773"
},
{
"input": "99999 100000",
"output": "99998.418042461126"
},
{
"input": "100000 555",
"output": "99820.643422392372"
},
{
"input": "10000 10000",
"output": "9999.418122897887"
},
{
"input": "100000 5001",
"output": "99980.503829474910"
},
{
"input": "100000 1000",
"output": "99900.599066768002"
}
] | 1,608,237,788
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 187
| 0
|
def main():
args=input().split()
m=int(args[0])
n=int(args[1])
res=0
for i in range(1,m+1):
res+=i*((i/m)**n-((i-1)/m)**n)
print(res)
main()
|
Title: Little Pony and Expected Maximum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
Input Specification:
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
Output Specification:
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
Demo Input:
['6 1\n', '6 3\n', '2 2\n']
Demo Output:
['3.500000000000\n', '4.958333333333\n', '1.750000000000\n']
Note:
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
|
```python
def main():
args=input().split()
m=int(args[0])
n=int(args[1])
res=0
for i in range(1,m+1):
res+=i*((i/m)**n-((i-1)/m)**n)
print(res)
main()
```
| 3
|
|
412
|
C
|
Pattern
|
PROGRAMMING
| 1,200
|
[
"implementation",
"strings"
] | null | null |
Developers often face with regular expression patterns. A pattern is usually defined as a string consisting of characters and metacharacters that sets the rules for your search. These patterns are most often used to check whether a particular string meets the certain rules.
In this task, a pattern will be a string consisting of small English letters and question marks ('?'). The question mark in the pattern is a metacharacter that denotes an arbitrary small letter of the English alphabet. We will assume that a string matches the pattern if we can transform the string into the pattern by replacing the question marks by the appropriate characters. For example, string aba matches patterns: ???, ??a, a?a, aba.
Programmers that work for the R1 company love puzzling each other (and themselves) with riddles. One of them is as follows: you are given *n* patterns of the same length, you need to find a pattern that contains as few question marks as possible, and intersects with each of the given patterns. Two patterns intersect if there is a string that matches both the first and the second pattern. Can you solve this riddle?
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of patterns. Next *n* lines contain the patterns.
It is guaranteed that the patterns can only consist of small English letters and symbols '?'. All patterns are non-empty and have the same length. The total length of all the patterns does not exceed 105 characters.
|
In a single line print the answer to the problem — the pattern with the minimal number of signs '?', which intersects with each of the given ones. If there are several answers, print any of them.
|
[
"2\n?ab\n??b\n",
"2\na\nb\n",
"1\n?a?b\n"
] |
[
"xab\n",
"?\n",
"cacb\n"
] |
Consider the first example. Pattern xab intersects with each of the given patterns. Pattern ??? also intersects with each of the given patterns, but it contains more question signs, hence it is not an optimal answer. Clearly, xab is the optimal answer, because it doesn't contain any question sign. There are a lot of other optimal answers, for example: aab, bab, cab, dab and so on.
| 1,500
|
[
{
"input": "2\n?ab\n??b",
"output": "xab"
},
{
"input": "2\na\nb",
"output": "?"
},
{
"input": "1\n?a?b",
"output": "cacb"
},
{
"input": "1\n?",
"output": "x"
},
{
"input": "3\nabacaba\nabacaba\nabacaba",
"output": "abacaba"
},
{
"input": "3\nabc?t\n?bc?z\nab??t",
"output": "abcx?"
},
{
"input": "4\nabc\ndef\n???\nxyz",
"output": "???"
},
{
"input": "2\n?????\n?????",
"output": "xxxxx"
},
{
"input": "2\na\na",
"output": "a"
},
{
"input": "3\nabc\n???\naxc",
"output": "a?c"
},
{
"input": "1\n?m??x?xxexxx?xxmxx??",
"output": "cmccxcxxexxxcxxmxxcc"
},
{
"input": "2\nhszhh?zszs\nhhzhz?zzhs",
"output": "h?zh?cz??s"
},
{
"input": "3\neddzde\needded\nzdde?z",
"output": "??d???"
},
{
"input": "4\nff?o?\nfk?of\nk?kof\nfk?oo",
"output": "??ko?"
},
{
"input": "5\nyigi\ne?gi\niig?\n?eg?\n??gi",
"output": "??gi"
},
{
"input": "100\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz\nz",
"output": "z"
},
{
"input": "100\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?\nb?",
"output": "bc"
},
{
"input": "1\nq",
"output": "q"
},
{
"input": "2\n?\n?",
"output": "x"
},
{
"input": "2\n?\na",
"output": "a"
},
{
"input": "2\n?\nb",
"output": "b"
},
{
"input": "3\n?\na\na",
"output": "a"
},
{
"input": "3\na\n?\na",
"output": "a"
},
{
"input": "3\na\nb\n?",
"output": "?"
},
{
"input": "3\n?\na\nb",
"output": "?"
},
{
"input": "3\nb\n?\na",
"output": "?"
},
{
"input": "2\n???\naaa",
"output": "aaa"
},
{
"input": "2\n??\nss",
"output": "ss"
}
] | 1,580,637,994
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 93
| 0
|
n,m=map(int,input().split())
s=input()
t=input()
if s==t:
print("YES")
elif "*" in s:
i=s.index("*")
print(i,s[:i],t[:i],t[m-(n-i)+1:],s[i+1:])
if n<=m+1 and s[:i]==t[:i] and s[i+1:]==t[m-(n-i)+1:]:
print("YES")
else:
print("NO")
else:
print("NO")
|
Title: Pattern
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Developers often face with regular expression patterns. A pattern is usually defined as a string consisting of characters and metacharacters that sets the rules for your search. These patterns are most often used to check whether a particular string meets the certain rules.
In this task, a pattern will be a string consisting of small English letters and question marks ('?'). The question mark in the pattern is a metacharacter that denotes an arbitrary small letter of the English alphabet. We will assume that a string matches the pattern if we can transform the string into the pattern by replacing the question marks by the appropriate characters. For example, string aba matches patterns: ???, ??a, a?a, aba.
Programmers that work for the R1 company love puzzling each other (and themselves) with riddles. One of them is as follows: you are given *n* patterns of the same length, you need to find a pattern that contains as few question marks as possible, and intersects with each of the given patterns. Two patterns intersect if there is a string that matches both the first and the second pattern. Can you solve this riddle?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of patterns. Next *n* lines contain the patterns.
It is guaranteed that the patterns can only consist of small English letters and symbols '?'. All patterns are non-empty and have the same length. The total length of all the patterns does not exceed 105 characters.
Output Specification:
In a single line print the answer to the problem — the pattern with the minimal number of signs '?', which intersects with each of the given ones. If there are several answers, print any of them.
Demo Input:
['2\n?ab\n??b\n', '2\na\nb\n', '1\n?a?b\n']
Demo Output:
['xab\n', '?\n', 'cacb\n']
Note:
Consider the first example. Pattern xab intersects with each of the given patterns. Pattern ??? also intersects with each of the given patterns, but it contains more question signs, hence it is not an optimal answer. Clearly, xab is the optimal answer, because it doesn't contain any question sign. There are a lot of other optimal answers, for example: aab, bab, cab, dab and so on.
|
```python
n,m=map(int,input().split())
s=input()
t=input()
if s==t:
print("YES")
elif "*" in s:
i=s.index("*")
print(i,s[:i],t[:i],t[m-(n-i)+1:],s[i+1:])
if n<=m+1 and s[:i]==t[:i] and s[i+1:]==t[m-(n-i)+1:]:
print("YES")
else:
print("NO")
else:
print("NO")
```
| -1
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
You've gotten an *n*<=×<=*m* sheet of squared paper. Some of its squares are painted. Let's mark the set of all painted squares as *A*. Set *A* is connected. Your task is to find the minimum number of squares that we can delete from set *A* to make it not connected.
A set of painted squares is called connected, if for every two squares *a* and *b* from this set there is a sequence of squares from the set, beginning in *a* and ending in *b*, such that in this sequence any square, except for the last one, shares a common side with the square that follows next in the sequence. An empty set and a set consisting of exactly one square are connected by definition.
|
The first input line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the sizes of the sheet of paper.
Each of the next *n* lines contains *m* characters — the description of the sheet of paper: the *j*-th character of the *i*-th line equals either "#", if the corresponding square is painted (belongs to set *A*), or equals "." if the corresponding square is not painted (does not belong to set *A*). It is guaranteed that the set of all painted squares *A* is connected and isn't empty.
|
On the first line print the minimum number of squares that need to be deleted to make set *A* not connected. If it is impossible, print -1.
|
[
"5 4\n####\n#..#\n#..#\n#..#\n####\n",
"5 5\n#####\n#...#\n#####\n#...#\n#####\n"
] |
[
"2\n",
"2\n"
] |
In the first sample you can delete any two squares that do not share a side. After that the set of painted squares is not connected anymore.
The note to the second sample is shown on the figure below. To the left there is a picture of the initial set of squares. To the right there is a set with deleted squares. The deleted squares are marked with crosses.
| 0
|
[
{
"input": "5 4\n####\n#..#\n#..#\n#..#\n####",
"output": "2"
},
{
"input": "5 5\n#####\n#...#\n#####\n#...#\n#####",
"output": "2"
},
{
"input": "1 10\n.########.",
"output": "1"
},
{
"input": "1 1\n#",
"output": "-1"
},
{
"input": "3 3\n.#.\n###\n.#.",
"output": "1"
},
{
"input": "1 2\n##",
"output": "-1"
},
{
"input": "2 1\n#\n#",
"output": "-1"
},
{
"input": "3 3\n###\n#.#\n###",
"output": "2"
},
{
"input": "2 2\n##\n#.",
"output": "1"
},
{
"input": "2 2\n##\n##",
"output": "2"
},
{
"input": "2 2\n.#\n##",
"output": "1"
},
{
"input": "2 2\n.#\n.#",
"output": "-1"
},
{
"input": "9 9\n#########\n#.......#\n#.#####.#\n#.#.#.#.#\n#.#.#.#.#\n#.#.#.#.#\n#.#####.#\n#...#...#\n#########",
"output": "1"
},
{
"input": "50 1\n#\n#\n#\n#\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "1"
},
{
"input": "3 50\n....##############################################\n....#.......#...#..#....#..............#.........#\n....##############################################",
"output": "2"
},
{
"input": "2 2\n##\n..",
"output": "-1"
},
{
"input": "5 5\n#####\n#####\n#....\n#####\n#####",
"output": "1"
},
{
"input": "3 5\n##.##\n#####\n##.##",
"output": "1"
},
{
"input": "4 4\n####\n####\n####\n####",
"output": "2"
},
{
"input": "5 7\n.#####.\n.#...#.\n###.###\n#.#.#.#\n###.###",
"output": "1"
},
{
"input": "2 5\n#####\n##.##",
"output": "1"
},
{
"input": "6 2\n##\n##\n#.\n##\n##\n##",
"output": "1"
},
{
"input": "2 5\n##.##\n#####",
"output": "1"
},
{
"input": "5 5\n#####\n#####\n##.##\n##.##\n##.##",
"output": "2"
},
{
"input": "5 3\n###\n###\n.#.\n###\n###",
"output": "1"
},
{
"input": "5 5\n###..\n###..\n#..##\n#####\n#####",
"output": "1"
}
] | 1,594,297,901
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 17
| 2,000
| 30,515,200
|
from collections import deque
# input = raw_input
n, m = map(int, input().split())
mat = [list(input()) for _ in range(n)]
valid = lambda x, y: 0 <= x < n and 0 <= y < m
dir = [(0, 1), (1, 0), (0, -1), (-1, 0)]
def dfs(x, y):
visit[x][y], stack, cur = c, deque(), 1
for dx, dy in dir:
x1, y1 = x + dx, y + dy
if valid(x1, y1) and mat[x1][y1] == '#':
stack.append((x1, y1))
break
while stack:
x, y = stack.pop()
visit[x][y] = c
cur += 1
for dx, dy in dir:
x1, y1 = x + dx, y + dy
if valid(x1, y1) and mat[x1][y1] == '#' and visit[x1][y1] == c - 1:
stack.append((x1, y1))
return cur
ans, c, mi = 2, 0, float('inf')
visit = [[0 for _ in range(m)] for _ in range(n)]
for i in range(n):
for j in range(m):
if mat[i][j] == '#':
c += 1
val = dfs(i, j)
mi = min(val, mi)
if mi < c:
ans = 1
print(-1 if c < 3 else ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've gotten an *n*<=×<=*m* sheet of squared paper. Some of its squares are painted. Let's mark the set of all painted squares as *A*. Set *A* is connected. Your task is to find the minimum number of squares that we can delete from set *A* to make it not connected.
A set of painted squares is called connected, if for every two squares *a* and *b* from this set there is a sequence of squares from the set, beginning in *a* and ending in *b*, such that in this sequence any square, except for the last one, shares a common side with the square that follows next in the sequence. An empty set and a set consisting of exactly one square are connected by definition.
Input Specification:
The first input line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the sizes of the sheet of paper.
Each of the next *n* lines contains *m* characters — the description of the sheet of paper: the *j*-th character of the *i*-th line equals either "#", if the corresponding square is painted (belongs to set *A*), or equals "." if the corresponding square is not painted (does not belong to set *A*). It is guaranteed that the set of all painted squares *A* is connected and isn't empty.
Output Specification:
On the first line print the minimum number of squares that need to be deleted to make set *A* not connected. If it is impossible, print -1.
Demo Input:
['5 4\n####\n#..#\n#..#\n#..#\n####\n', '5 5\n#####\n#...#\n#####\n#...#\n#####\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you can delete any two squares that do not share a side. After that the set of painted squares is not connected anymore.
The note to the second sample is shown on the figure below. To the left there is a picture of the initial set of squares. To the right there is a set with deleted squares. The deleted squares are marked with crosses.
|
```python
from collections import deque
# input = raw_input
n, m = map(int, input().split())
mat = [list(input()) for _ in range(n)]
valid = lambda x, y: 0 <= x < n and 0 <= y < m
dir = [(0, 1), (1, 0), (0, -1), (-1, 0)]
def dfs(x, y):
visit[x][y], stack, cur = c, deque(), 1
for dx, dy in dir:
x1, y1 = x + dx, y + dy
if valid(x1, y1) and mat[x1][y1] == '#':
stack.append((x1, y1))
break
while stack:
x, y = stack.pop()
visit[x][y] = c
cur += 1
for dx, dy in dir:
x1, y1 = x + dx, y + dy
if valid(x1, y1) and mat[x1][y1] == '#' and visit[x1][y1] == c - 1:
stack.append((x1, y1))
return cur
ans, c, mi = 2, 0, float('inf')
visit = [[0 for _ in range(m)] for _ in range(n)]
for i in range(n):
for j in range(m):
if mat[i][j] == '#':
c += 1
val = dfs(i, j)
mi = min(val, mi)
if mi < c:
ans = 1
print(-1 if c < 3 else ans)
```
| 0
|
|
955
|
B
|
Not simply beatiful strings
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Let's call a string adorable if its letters can be realigned in such a way that they form two consequent groups of equal symbols (note that different groups must contain different symbols). For example, ababa is adorable (you can transform it to aaabb, where the first three letters form a group of *a*-s and others — a group of *b*-s), but cccc is not since in each possible consequent partition letters in these two groups coincide.
You're given a string *s*. Check whether it can be split into two non-empty subsequences such that the strings formed by these subsequences are adorable. Here a subsequence is an arbitrary set of indexes of the string.
|
The only line contains *s* (1<=≤<=|*s*|<=≤<=105) consisting of lowercase latin letters.
|
Print «Yes» if the string can be split according to the criteria above or «No» otherwise.
Each letter can be printed in arbitrary case.
|
[
"ababa\n",
"zzcxx\n",
"yeee\n"
] |
[
"Yes\n",
"Yes\n",
"No\n"
] |
In sample case two zzcxx can be split into subsequences zc and zxx each of which is adorable.
There's no suitable partition in sample case three.
| 1,000
|
[
{
"input": "ababa",
"output": "Yes"
},
{
"input": "zzcxx",
"output": "Yes"
},
{
"input": "yeee",
"output": "No"
},
{
"input": "a",
"output": "No"
},
{
"input": "bbab",
"output": "No"
},
{
"input": "abcd",
"output": "Yes"
},
{
"input": "abc",
"output": "No"
},
{
"input": "abcdaaaa",
"output": "Yes"
},
{
"input": "aaaaaaaaaaaaaaa",
"output": "No"
},
{
"input": "adb",
"output": "No"
},
{
"input": "dcccbad",
"output": "Yes"
},
{
"input": "bcbccccccca",
"output": "Yes"
},
{
"input": "abcdefgh",
"output": "No"
},
{
"input": "aabcdef",
"output": "No"
},
{
"input": "aabc",
"output": "Yes"
},
{
"input": "ssab",
"output": "Yes"
},
{
"input": "ccdd",
"output": "Yes"
},
{
"input": "abcc",
"output": "Yes"
},
{
"input": "ab",
"output": "No"
},
{
"input": "abcde",
"output": "No"
},
{
"input": "aa",
"output": "No"
},
{
"input": "aaabbb",
"output": "Yes"
},
{
"input": "bbbba",
"output": "No"
},
{
"input": "abbbc",
"output": "Yes"
},
{
"input": "baabaa",
"output": "Yes"
},
{
"input": "abacabadde",
"output": "No"
},
{
"input": "aabbcc",
"output": "Yes"
},
{
"input": "abbc",
"output": "Yes"
},
{
"input": "aaaaaaabbbbbbcder",
"output": "No"
},
{
"input": "aabb",
"output": "Yes"
},
{
"input": "aabbccddee",
"output": "No"
},
{
"input": "abca",
"output": "Yes"
},
{
"input": "aaabbbccc",
"output": "Yes"
}
] | 1,568,463,139
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 670
| 307,200
|
ab = 'abcdefghijklmnopqrstuvwxyz'
ab_ = [0] * 26
string = str(input())
if len(string) < 4:
print('No')
exit(0)
k = 0
for i in range(len(string)):
for j in range(26):
if string[i] == ab[j]:
ab_[j] += 1
for i in range(26):
if ab_[i] > 0:
k += 1
if k > 4:
print('No')
exit(0)
if k == 1:
print('No')
exit(0)
if k == 2:
for i in range(26):
if ab_[i] == 1:
print('No')
exit(0)
print('Yes')
|
Title: Not simply beatiful strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a string adorable if its letters can be realigned in such a way that they form two consequent groups of equal symbols (note that different groups must contain different symbols). For example, ababa is adorable (you can transform it to aaabb, where the first three letters form a group of *a*-s and others — a group of *b*-s), but cccc is not since in each possible consequent partition letters in these two groups coincide.
You're given a string *s*. Check whether it can be split into two non-empty subsequences such that the strings formed by these subsequences are adorable. Here a subsequence is an arbitrary set of indexes of the string.
Input Specification:
The only line contains *s* (1<=≤<=|*s*|<=≤<=105) consisting of lowercase latin letters.
Output Specification:
Print «Yes» if the string can be split according to the criteria above or «No» otherwise.
Each letter can be printed in arbitrary case.
Demo Input:
['ababa\n', 'zzcxx\n', 'yeee\n']
Demo Output:
['Yes\n', 'Yes\n', 'No\n']
Note:
In sample case two zzcxx can be split into subsequences zc and zxx each of which is adorable.
There's no suitable partition in sample case three.
|
```python
ab = 'abcdefghijklmnopqrstuvwxyz'
ab_ = [0] * 26
string = str(input())
if len(string) < 4:
print('No')
exit(0)
k = 0
for i in range(len(string)):
for j in range(26):
if string[i] == ab[j]:
ab_[j] += 1
for i in range(26):
if ab_[i] > 0:
k += 1
if k > 4:
print('No')
exit(0)
if k == 1:
print('No')
exit(0)
if k == 2:
for i in range(26):
if ab_[i] == 1:
print('No')
exit(0)
print('Yes')
```
| 3
|
|
768
|
E
|
Game of Stones
|
PROGRAMMING
| 2,100
|
[
"bitmasks",
"dp",
"games"
] | null | null |
Sam has been teaching Jon the Game of Stones to sharpen his mind and help him devise a strategy to fight the white walkers. The rules of this game are quite simple:
- The game starts with *n* piles of stones indexed from 1 to *n*. The *i*-th pile contains *s**i* stones.- The players make their moves alternatively. A move is considered as removal of some number of stones from a pile. Removal of 0 stones does not count as a move.- The player who is unable to make a move loses.
Now Jon believes that he is ready for battle, but Sam does not think so. To prove his argument, Sam suggested that they play a modified version of the game.
In this modified version, no move can be made more than once on a pile. For example, if 4 stones are removed from a pile, 4 stones cannot be removed from that pile again.
Sam sets up the game and makes the first move. Jon believes that Sam is just trying to prevent him from going to battle. Jon wants to know if he can win if both play optimally.
|
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=106) — the number of piles.
Each of next *n* lines contains an integer *s**i* (1<=≤<=*s**i*<=≤<=60) — the number of stones in *i*-th pile.
|
Print a single line containing "YES" (without quotes) if Jon wins, otherwise print "NO" (without quotes)
|
[
"1\n5\n",
"2\n1\n2\n"
] |
[
"NO",
"YES"
] |
In the first case, Sam removes all the stones and Jon loses.
In second case, the following moves are possible by Sam: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/53b9c060b675da85f39a960b8ab29df7fe51f6e3.png" style="max-width: 100.0%;max-height: 100.0%;"/>
In each of these cases, last move can be made by Jon to win the game as follows: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5089ff5bcdbeb10a07b0bf16566d6f4703e99334.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 2,000
|
[
{
"input": "1\n5",
"output": "NO"
},
{
"input": "2\n1\n2",
"output": "YES"
},
{
"input": "3\n34\n44\n21",
"output": "NO"
},
{
"input": "6\n34\n44\n21\n55\n1\n36",
"output": "NO"
},
{
"input": "14\n34\n44\n21\n55\n1\n36\n53\n31\n58\n59\n11\n40\n20\n32",
"output": "NO"
},
{
"input": "10\n34\n44\n21\n55\n1\n36\n53\n31\n58\n59",
"output": "NO"
},
{
"input": "12\n34\n44\n21\n55\n1\n36\n53\n31\n58\n59\n11\n40",
"output": "NO"
},
{
"input": "118\n34\n44\n21\n55\n1\n36\n53\n31\n58\n59\n11\n40\n20\n32\n43\n48\n16\n5\n35\n20\n21\n36\n15\n2\n11\n56\n58\n2\n40\n47\n29\n21\n4\n21\n1\n25\n51\n55\n17\n40\n56\n35\n51\n1\n34\n18\n54\n44\n1\n43\n16\n28\n21\n14\n57\n53\n29\n44\n59\n54\n47\n21\n43\n41\n11\n37\n30\n4\n39\n47\n40\n50\n52\n9\n32\n1\n19\n30\n20\n6\n25\n42\n34\n38\n42\n46\n35\n28\n20\n47\n60\n46\n35\n59\n24\n11\n25\n27\n9\n51\n39\n35\n22\n24\n10\n48\n6\n30\n10\n33\n51\n45\n38\n8\n51\n8\n7\n46",
"output": "NO"
},
{
"input": "124\n34\n44\n21\n55\n1\n36\n53\n31\n58\n59\n11\n40\n20\n32\n43\n48\n16\n5\n35\n20\n21\n36\n15\n2\n11\n56\n58\n2\n40\n47\n29\n21\n4\n21\n1\n25\n51\n55\n17\n40\n56\n35\n51\n1\n34\n18\n54\n44\n1\n43\n16\n28\n21\n14\n57\n53\n29\n44\n59\n54\n47\n21\n43\n41\n11\n37\n30\n4\n39\n47\n40\n50\n52\n9\n32\n1\n19\n30\n20\n6\n25\n42\n34\n38\n42\n46\n35\n28\n20\n47\n60\n46\n35\n59\n24\n11\n25\n27\n9\n51\n39\n35\n22\n24\n10\n48\n6\n30\n10\n33\n51\n45\n38\n8\n51\n8\n7\n46\n49\n27\n16\n13\n4\n54",
"output": "NO"
},
{
"input": "15\n34\n44\n21\n55\n1\n36\n53\n31\n58\n59\n11\n40\n20\n32\n43",
"output": "NO"
},
{
"input": "2\n34\n44",
"output": "NO"
}
] | 1,660,077,956
| 2,147,483,647
|
PyPy 3-64
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 3,000
| 10,956,800
|
import sys
readline=sys.stdin.readline
from collections import Counter
N=int(readline())
def grundy(s,bit):
if s==0:
return 0
se=set()
for i in range(1,min(60,s)+1):
if bit&1<<i:
continue
se.add(grundy(s-i,bit|1<<i))
g=0
while g in se:
g+=1
return g
g=0
for s,c in Counter([int(readline()) for i in range(N)]).items():
if c%2:
g^=grundy(s,0)
if g:
ans="NO"
else:
ans="YES"
print(ans)
|
Title: Game of Stones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sam has been teaching Jon the Game of Stones to sharpen his mind and help him devise a strategy to fight the white walkers. The rules of this game are quite simple:
- The game starts with *n* piles of stones indexed from 1 to *n*. The *i*-th pile contains *s**i* stones.- The players make their moves alternatively. A move is considered as removal of some number of stones from a pile. Removal of 0 stones does not count as a move.- The player who is unable to make a move loses.
Now Jon believes that he is ready for battle, but Sam does not think so. To prove his argument, Sam suggested that they play a modified version of the game.
In this modified version, no move can be made more than once on a pile. For example, if 4 stones are removed from a pile, 4 stones cannot be removed from that pile again.
Sam sets up the game and makes the first move. Jon believes that Sam is just trying to prevent him from going to battle. Jon wants to know if he can win if both play optimally.
Input Specification:
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=106) — the number of piles.
Each of next *n* lines contains an integer *s**i* (1<=≤<=*s**i*<=≤<=60) — the number of stones in *i*-th pile.
Output Specification:
Print a single line containing "YES" (without quotes) if Jon wins, otherwise print "NO" (without quotes)
Demo Input:
['1\n5\n', '2\n1\n2\n']
Demo Output:
['NO', 'YES']
Note:
In the first case, Sam removes all the stones and Jon loses.
In second case, the following moves are possible by Sam: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/53b9c060b675da85f39a960b8ab29df7fe51f6e3.png" style="max-width: 100.0%;max-height: 100.0%;"/>
In each of these cases, last move can be made by Jon to win the game as follows: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5089ff5bcdbeb10a07b0bf16566d6f4703e99334.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
import sys
readline=sys.stdin.readline
from collections import Counter
N=int(readline())
def grundy(s,bit):
if s==0:
return 0
se=set()
for i in range(1,min(60,s)+1):
if bit&1<<i:
continue
se.add(grundy(s-i,bit|1<<i))
g=0
while g in se:
g+=1
return g
g=0
for s,c in Counter([int(readline()) for i in range(N)]).items():
if c%2:
g^=grundy(s,0)
if g:
ans="NO"
else:
ans="YES"
print(ans)
```
| 0
|
|
678
|
A
|
Johny Likes Numbers
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
|
Print the smallest integer *x*<=><=*n*, so it is divisible by the number *k*.
|
[
"5 3\n",
"25 13\n",
"26 13\n"
] |
[
"6\n",
"26\n",
"39\n"
] |
none
| 0
|
[
{
"input": "5 3",
"output": "6"
},
{
"input": "25 13",
"output": "26"
},
{
"input": "26 13",
"output": "39"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "8 8",
"output": "16"
},
{
"input": "14 15",
"output": "15"
},
{
"input": "197 894",
"output": "894"
},
{
"input": "6058 8581",
"output": "8581"
},
{
"input": "97259 41764",
"output": "125292"
},
{
"input": "453145 333625",
"output": "667250"
},
{
"input": "2233224 4394826",
"output": "4394826"
},
{
"input": "76770926 13350712",
"output": "80104272"
},
{
"input": "687355301 142098087",
"output": "710490435"
},
{
"input": "1000000000 999999999",
"output": "1999999998"
},
{
"input": "1000000000 1000000000",
"output": "2000000000"
},
{
"input": "999999999 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 1",
"output": "1000000001"
},
{
"input": "1000000000 2",
"output": "1000000002"
},
{
"input": "999999999 1",
"output": "1000000000"
},
{
"input": "100000000 1",
"output": "100000001"
},
{
"input": "999999999 500000000",
"output": "1000000000"
},
{
"input": "999999990 10",
"output": "1000000000"
},
{
"input": "1000000000 999999997",
"output": "1999999994"
},
{
"input": "999999999 2",
"output": "1000000000"
},
{
"input": "999999984 1",
"output": "999999985"
},
{
"input": "999999983 1",
"output": "999999984"
},
{
"input": "666666666 1",
"output": "666666667"
},
{
"input": "1000000000 990000000",
"output": "1980000000"
},
{
"input": "41 48",
"output": "48"
},
{
"input": "123456 2",
"output": "123458"
},
{
"input": "111 111",
"output": "222"
},
{
"input": "878787 1",
"output": "878788"
},
{
"input": "121 1",
"output": "122"
},
{
"input": "114514 114514",
"output": "229028"
},
{
"input": "500000001 1000000000",
"output": "1000000000"
},
{
"input": "999999997 1",
"output": "999999998"
},
{
"input": "100000000 10",
"output": "100000010"
}
] | 1,662,842,946
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 0
|
n, k = map(int, input().split())
if n % k == 0:
print(k * (n // k + 1))
else:
print(k * (n // k + 1))
|
Title: Johny Likes Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
Output Specification:
Print the smallest integer *x*<=><=*n*, so it is divisible by the number *k*.
Demo Input:
['5 3\n', '25 13\n', '26 13\n']
Demo Output:
['6\n', '26\n', '39\n']
Note:
none
|
```python
n, k = map(int, input().split())
if n % k == 0:
print(k * (n // k + 1))
else:
print(k * (n // k + 1))
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,665,661,504
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
n = int(input())
arr = list(map(int,input().split()))
s =sum(arr)
ans = 0
for i in range(1,6):
if((s+i)%(n+1) != 1): ans+=1
print(ans)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
n = int(input())
arr = list(map(int,input().split()))
s =sum(arr)
ans = 0
for i in range(1,6):
if((s+i)%(n+1) != 1): ans+=1
print(ans)
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,694,518,260
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 1,000
| 0
|
x=input().split()
n=int(x[0])
m=int(x[1])
a=int(x[2])
l=0
w=0
while n>0:
l+=1
n-=a
while m>0:
w+=1
m-=a
print(l*w)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
x=input().split()
n=int(x[0])
m=int(x[1])
a=int(x[2])
l=0
w=0
while n>0:
l+=1
n-=a
while m>0:
w+=1
m-=a
print(l*w)
```
| 0
|
820
|
A
|
Mister B and Book Reading
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Mister B once received a gift: it was a book about aliens, which he started read immediately. This book had *c* pages.
At first day Mister B read *v*0 pages, but after that he started to speed up. Every day, starting from the second, he read *a* pages more than on the previous day (at first day he read *v*0 pages, at second — *v*0<=+<=*a* pages, at third — *v*0<=+<=2*a* pages, and so on). But Mister B is just a human, so he physically wasn't able to read more than *v*1 pages per day.
Also, to refresh his memory, every day, starting from the second, Mister B had to reread last *l* pages he read on the previous day. Mister B finished the book when he read the last page for the first time.
Help Mister B to calculate how many days he needed to finish the book.
|
First and only line contains five space-separated integers: *c*, *v*0, *v*1, *a* and *l* (1<=≤<=*c*<=≤<=1000, 0<=≤<=*l*<=<<=*v*0<=≤<=*v*1<=≤<=1000, 0<=≤<=*a*<=≤<=1000) — the length of the book in pages, the initial reading speed, the maximum reading speed, the acceleration in reading speed and the number of pages for rereading.
|
Print one integer — the number of days Mister B needed to finish the book.
|
[
"5 5 10 5 4\n",
"12 4 12 4 1\n",
"15 1 100 0 0\n"
] |
[
"1\n",
"3\n",
"15\n"
] |
In the first sample test the book contains 5 pages, so Mister B read it right at the first day.
In the second sample test at first day Mister B read pages number 1 - 4, at second day — 4 - 11, at third day — 11 - 12 and finished the book.
In third sample test every day Mister B read 1 page of the book, so he finished in 15 days.
| 500
|
[
{
"input": "5 5 10 5 4",
"output": "1"
},
{
"input": "12 4 12 4 1",
"output": "3"
},
{
"input": "15 1 100 0 0",
"output": "15"
},
{
"input": "1 1 1 0 0",
"output": "1"
},
{
"input": "1000 999 1000 1000 998",
"output": "2"
},
{
"input": "1000 2 2 5 1",
"output": "999"
},
{
"input": "1000 1 1 1000 0",
"output": "1000"
},
{
"input": "737 41 74 12 11",
"output": "13"
},
{
"input": "1000 1000 1000 0 999",
"output": "1"
},
{
"input": "765 12 105 5 7",
"output": "17"
},
{
"input": "15 2 2 1000 0",
"output": "8"
},
{
"input": "1000 1 1000 1000 0",
"output": "2"
},
{
"input": "20 3 7 1 2",
"output": "6"
},
{
"input": "1000 500 500 1000 499",
"output": "501"
},
{
"input": "1 1000 1000 1000 0",
"output": "1"
},
{
"input": "1000 2 1000 56 0",
"output": "7"
},
{
"input": "1000 2 1000 802 0",
"output": "3"
},
{
"input": "16 1 8 2 0",
"output": "4"
},
{
"input": "20 6 10 2 2",
"output": "3"
},
{
"input": "8 2 12 4 1",
"output": "3"
},
{
"input": "8 6 13 2 5",
"output": "2"
},
{
"input": "70 4 20 87 0",
"output": "5"
},
{
"input": "97 8 13 234 5",
"output": "13"
},
{
"input": "16 4 23 8 3",
"output": "3"
},
{
"input": "65 7 22 7 4",
"output": "5"
},
{
"input": "93 10 18 11 7",
"output": "9"
},
{
"input": "86 13 19 15 9",
"output": "9"
},
{
"input": "333 17 50 10 16",
"output": "12"
},
{
"input": "881 16 55 10 12",
"output": "23"
},
{
"input": "528 11 84 3 9",
"output": "19"
},
{
"input": "896 2 184 8 1",
"output": "16"
},
{
"input": "236 10 930 9 8",
"output": "8"
},
{
"input": "784 1 550 14 0",
"output": "12"
},
{
"input": "506 1 10 4 0",
"output": "53"
},
{
"input": "460 1 3 2 0",
"output": "154"
},
{
"input": "701 1 3 1 0",
"output": "235"
},
{
"input": "100 49 50 1000 2",
"output": "3"
},
{
"input": "100 1 100 100 0",
"output": "2"
},
{
"input": "12 1 4 2 0",
"output": "4"
},
{
"input": "22 10 12 0 0",
"output": "3"
},
{
"input": "20 10 15 1 4",
"output": "3"
},
{
"input": "1000 5 10 1 4",
"output": "169"
},
{
"input": "1000 1 1000 1 0",
"output": "45"
},
{
"input": "4 1 2 2 0",
"output": "3"
},
{
"input": "1 5 5 1 1",
"output": "1"
},
{
"input": "19 10 11 0 2",
"output": "3"
},
{
"input": "1 2 3 0 0",
"output": "1"
},
{
"input": "10 1 4 10 0",
"output": "4"
},
{
"input": "20 3 100 1 1",
"output": "5"
},
{
"input": "1000 5 9 5 0",
"output": "112"
},
{
"input": "1 11 12 0 10",
"output": "1"
},
{
"input": "1 1 1 1 0",
"output": "1"
},
{
"input": "1000 1 20 1 0",
"output": "60"
},
{
"input": "9 1 4 2 0",
"output": "4"
},
{
"input": "129 2 3 4 0",
"output": "44"
},
{
"input": "4 2 2 0 1",
"output": "3"
},
{
"input": "1000 1 10 100 0",
"output": "101"
},
{
"input": "100 1 100 1 0",
"output": "14"
},
{
"input": "8 3 4 2 0",
"output": "3"
},
{
"input": "20 1 6 4 0",
"output": "5"
},
{
"input": "8 2 4 2 0",
"output": "3"
},
{
"input": "11 5 6 7 2",
"output": "3"
},
{
"input": "100 120 130 120 0",
"output": "1"
},
{
"input": "7 1 4 1 0",
"output": "4"
},
{
"input": "5 3 10 0 2",
"output": "3"
},
{
"input": "5 2 2 0 0",
"output": "3"
},
{
"input": "1000 10 1000 10 0",
"output": "14"
},
{
"input": "25 3 50 4 2",
"output": "4"
},
{
"input": "9 10 10 10 9",
"output": "1"
},
{
"input": "17 10 12 6 5",
"output": "2"
},
{
"input": "15 5 10 3 0",
"output": "3"
},
{
"input": "8 3 5 1 0",
"output": "3"
},
{
"input": "19 1 12 5 0",
"output": "4"
},
{
"input": "1000 10 1000 1 0",
"output": "37"
},
{
"input": "100 1 2 1000 0",
"output": "51"
},
{
"input": "20 10 11 1000 9",
"output": "6"
},
{
"input": "16 2 100 1 1",
"output": "5"
},
{
"input": "18 10 13 2 5",
"output": "3"
},
{
"input": "12 3 5 3 1",
"output": "4"
},
{
"input": "17 3 11 2 0",
"output": "4"
},
{
"input": "4 2 100 1 1",
"output": "2"
},
{
"input": "7 4 5 2 3",
"output": "3"
},
{
"input": "100 1 2 2 0",
"output": "51"
},
{
"input": "50 4 5 5 0",
"output": "11"
},
{
"input": "1 2 2 0 1",
"output": "1"
},
{
"input": "1000 2 3 10 1",
"output": "500"
},
{
"input": "500 10 500 1000 0",
"output": "2"
},
{
"input": "1000 4 12 1 0",
"output": "87"
},
{
"input": "18 10 13 1 5",
"output": "3"
},
{
"input": "7 3 6 2 2",
"output": "3"
},
{
"input": "15 5 100 1 2",
"output": "4"
},
{
"input": "100 1 10 1 0",
"output": "15"
},
{
"input": "8 2 7 5 1",
"output": "2"
},
{
"input": "11 2 4 1 1",
"output": "5"
},
{
"input": "1000 500 900 100 300",
"output": "3"
},
{
"input": "7 1 2 5 0",
"output": "4"
},
{
"input": "7 3 5 3 2",
"output": "3"
},
{
"input": "7 3 10 2 1",
"output": "2"
},
{
"input": "1000 501 510 1 499",
"output": "50"
},
{
"input": "1000 1 1000 2 0",
"output": "32"
},
{
"input": "1 5 5 0 0",
"output": "1"
},
{
"input": "18 10 15 1 5",
"output": "3"
},
{
"input": "100 4 1000 1 2",
"output": "13"
},
{
"input": "20 2 40 1 1",
"output": "6"
},
{
"input": "1 11 1000 100 1",
"output": "1"
},
{
"input": "6 4 4 1 2",
"output": "2"
},
{
"input": "8 3 5 3 1",
"output": "3"
},
{
"input": "10 5 7 1 2",
"output": "3"
},
{
"input": "400 100 198 1 99",
"output": "25"
},
{
"input": "3 1 2 5 0",
"output": "2"
}
] | 1,498,576,755
| 2,655
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 7
| 61
| 5,529,600
|
c, v0, v1, a, l = map(int, input().split())
days = 1
pages = v0
dp = v0
while pages < c:
if dp+a <= v1: dp += a
pages += dp - l
days += 1
print(days)
|
Title: Mister B and Book Reading
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mister B once received a gift: it was a book about aliens, which he started read immediately. This book had *c* pages.
At first day Mister B read *v*0 pages, but after that he started to speed up. Every day, starting from the second, he read *a* pages more than on the previous day (at first day he read *v*0 pages, at second — *v*0<=+<=*a* pages, at third — *v*0<=+<=2*a* pages, and so on). But Mister B is just a human, so he physically wasn't able to read more than *v*1 pages per day.
Also, to refresh his memory, every day, starting from the second, Mister B had to reread last *l* pages he read on the previous day. Mister B finished the book when he read the last page for the first time.
Help Mister B to calculate how many days he needed to finish the book.
Input Specification:
First and only line contains five space-separated integers: *c*, *v*0, *v*1, *a* and *l* (1<=≤<=*c*<=≤<=1000, 0<=≤<=*l*<=<<=*v*0<=≤<=*v*1<=≤<=1000, 0<=≤<=*a*<=≤<=1000) — the length of the book in pages, the initial reading speed, the maximum reading speed, the acceleration in reading speed and the number of pages for rereading.
Output Specification:
Print one integer — the number of days Mister B needed to finish the book.
Demo Input:
['5 5 10 5 4\n', '12 4 12 4 1\n', '15 1 100 0 0\n']
Demo Output:
['1\n', '3\n', '15\n']
Note:
In the first sample test the book contains 5 pages, so Mister B read it right at the first day.
In the second sample test at first day Mister B read pages number 1 - 4, at second day — 4 - 11, at third day — 11 - 12 and finished the book.
In third sample test every day Mister B read 1 page of the book, so he finished in 15 days.
|
```python
c, v0, v1, a, l = map(int, input().split())
days = 1
pages = v0
dp = v0
while pages < c:
if dp+a <= v1: dp += a
pages += dp - l
days += 1
print(days)
```
| 0
|
|
558
|
B
|
Amr and The Large Array
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Amr has got a large array of size *n*. Amr doesn't like large arrays so he intends to make it smaller.
Amr doesn't care about anything in the array except the beauty of it. The beauty of the array is defined to be the maximum number of times that some number occurs in this array. He wants to choose the smallest subsegment of this array such that the beauty of it will be the same as the original array.
Help Amr by choosing the smallest subsegment possible.
|
The first line contains one number *n* (1<=≤<=*n*<=≤<=105), the size of the array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106), representing elements of the array.
|
Output two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), the beginning and the end of the subsegment chosen respectively.
If there are several possible answers you may output any of them.
|
[
"5\n1 1 2 2 1\n",
"5\n1 2 2 3 1\n",
"6\n1 2 2 1 1 2\n"
] |
[
"1 5",
"2 3",
"1 5"
] |
A subsegment *B* of an array *A* from *l* to *r* is an array of size *r* - *l* + 1 where *B*<sub class="lower-index">*i*</sub> = *A*<sub class="lower-index">*l* + *i* - 1</sub> for all 1 ≤ *i* ≤ *r* - *l* + 1
| 1,000
|
[
{
"input": "5\n1 1 2 2 1",
"output": "1 5"
},
{
"input": "5\n1 2 2 3 1",
"output": "2 3"
},
{
"input": "6\n1 2 2 1 1 2",
"output": "1 5"
},
{
"input": "10\n1 1000000 2 1000000 3 2 1000000 1 2 1",
"output": "2 7"
},
{
"input": "10\n1 2 3 4 5 5 1 2 3 4",
"output": "5 6"
},
{
"input": "10\n1 1 2 1 1 2 2 1 2 3",
"output": "1 8"
},
{
"input": "10\n5 4 3 2 1 1 2 3 4 5",
"output": "5 6"
},
{
"input": "10\n1 10 100 1000 10000 1 10 100 1000 10000",
"output": "1 6"
},
{
"input": "10\n9 9 9 9 8 9 8 8 8 8",
"output": "1 6"
},
{
"input": "10\n1 11 111 1111 1 11 11 1 1111 1111",
"output": "2 7"
}
] | 1,567,874,646
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 108
| 0
|
n = int(input())
x = list(map(int, input().split()))
a = n * [0]
sett = list(set(x))
for i in range(len(sett)):
a[x.index(sett[i])] = x.count(sett[i])
index_max = a.index(max(a))
k = max(a)
ans = n + 1
ans2 = 0
for j in range(n):
if a[j] != k:
continue
else:
if n - x[::-1].index(x[j]) + x.index(x[j]) <= ans:
ans = n - x[::-1].index(x[j])
ans2 = x.index(x[j]) + 1
print(ans2, ans)
|
Title: Amr and The Large Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr has got a large array of size *n*. Amr doesn't like large arrays so he intends to make it smaller.
Amr doesn't care about anything in the array except the beauty of it. The beauty of the array is defined to be the maximum number of times that some number occurs in this array. He wants to choose the smallest subsegment of this array such that the beauty of it will be the same as the original array.
Help Amr by choosing the smallest subsegment possible.
Input Specification:
The first line contains one number *n* (1<=≤<=*n*<=≤<=105), the size of the array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106), representing elements of the array.
Output Specification:
Output two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), the beginning and the end of the subsegment chosen respectively.
If there are several possible answers you may output any of them.
Demo Input:
['5\n1 1 2 2 1\n', '5\n1 2 2 3 1\n', '6\n1 2 2 1 1 2\n']
Demo Output:
['1 5', '2 3', '1 5']
Note:
A subsegment *B* of an array *A* from *l* to *r* is an array of size *r* - *l* + 1 where *B*<sub class="lower-index">*i*</sub> = *A*<sub class="lower-index">*l* + *i* - 1</sub> for all 1 ≤ *i* ≤ *r* - *l* + 1
|
```python
n = int(input())
x = list(map(int, input().split()))
a = n * [0]
sett = list(set(x))
for i in range(len(sett)):
a[x.index(sett[i])] = x.count(sett[i])
index_max = a.index(max(a))
k = max(a)
ans = n + 1
ans2 = 0
for j in range(n):
if a[j] != k:
continue
else:
if n - x[::-1].index(x[j]) + x.index(x[j]) <= ans:
ans = n - x[::-1].index(x[j])
ans2 = x.index(x[j]) + 1
print(ans2, ans)
```
| 0
|
|
967
|
B
|
Watering System
|
PROGRAMMING
| 1,000
|
[
"math",
"sortings"
] | null | null |
Arkady wants to water his only flower. Unfortunately, he has a very poor watering system that was designed for $n$ flowers and so it looks like a pipe with $n$ holes. Arkady can only use the water that flows from the first hole.
Arkady can block some of the holes, and then pour $A$ liters of water into the pipe. After that, the water will flow out from the non-blocked holes proportionally to their sizes $s_1, s_2, \ldots, s_n$. In other words, if the sum of sizes of non-blocked holes is $S$, and the $i$-th hole is not blocked, $\frac{s_i \cdot A}{S}$ liters of water will flow out of it.
What is the minimum number of holes Arkady should block to make at least $B$ liters of water flow out of the first hole?
|
The first line contains three integers $n$, $A$, $B$ ($1 \le n \le 100\,000$, $1 \le B \le A \le 10^4$) — the number of holes, the volume of water Arkady will pour into the system, and the volume he wants to get out of the first hole.
The second line contains $n$ integers $s_1, s_2, \ldots, s_n$ ($1 \le s_i \le 10^4$) — the sizes of the holes.
|
Print a single integer — the number of holes Arkady should block.
|
[
"4 10 3\n2 2 2 2\n",
"4 80 20\n3 2 1 4\n",
"5 10 10\n1000 1 1 1 1\n"
] |
[
"1\n",
"0\n",
"4\n"
] |
In the first example Arkady should block at least one hole. After that, $\frac{10 \cdot 2}{6} \approx 3.333$ liters of water will flow out of the first hole, and that suits Arkady.
In the second example even without blocking any hole, $\frac{80 \cdot 3}{10} = 24$ liters will flow out of the first hole, that is not less than $20$.
In the third example Arkady has to block all holes except the first to make all water flow out of the first hole.
| 1,000
|
[
{
"input": "4 10 3\n2 2 2 2",
"output": "1"
},
{
"input": "4 80 20\n3 2 1 4",
"output": "0"
},
{
"input": "5 10 10\n1000 1 1 1 1",
"output": "4"
},
{
"input": "10 300 100\n20 1 3 10 8 5 3 6 4 3",
"output": "1"
},
{
"input": "10 300 100\n20 25 68 40 60 37 44 85 23 96",
"output": "8"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 2 1\n1",
"output": "0"
},
{
"input": "2 2 2\n1 10000",
"output": "1"
},
{
"input": "2 10000 1\n1 9999",
"output": "0"
}
] | 1,588,206,502
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 15
| 187
| 9,113,600
|
import math
n, a, b = map(int, input().split())
s = list(map(int, input().split()))
c = 0
x = math.ceil((a * s[0]) / b)
y = s[0]
f = 0
su = 0
for i in s:
su += i
s.sort()
i = n - 1
while su > x:
if s[i] == y and f == 0:
f = 1
i -= 1
continue
su -= s[i]
c += 1
i -= 1
print(c)
|
Title: Watering System
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arkady wants to water his only flower. Unfortunately, he has a very poor watering system that was designed for $n$ flowers and so it looks like a pipe with $n$ holes. Arkady can only use the water that flows from the first hole.
Arkady can block some of the holes, and then pour $A$ liters of water into the pipe. After that, the water will flow out from the non-blocked holes proportionally to their sizes $s_1, s_2, \ldots, s_n$. In other words, if the sum of sizes of non-blocked holes is $S$, and the $i$-th hole is not blocked, $\frac{s_i \cdot A}{S}$ liters of water will flow out of it.
What is the minimum number of holes Arkady should block to make at least $B$ liters of water flow out of the first hole?
Input Specification:
The first line contains three integers $n$, $A$, $B$ ($1 \le n \le 100\,000$, $1 \le B \le A \le 10^4$) — the number of holes, the volume of water Arkady will pour into the system, and the volume he wants to get out of the first hole.
The second line contains $n$ integers $s_1, s_2, \ldots, s_n$ ($1 \le s_i \le 10^4$) — the sizes of the holes.
Output Specification:
Print a single integer — the number of holes Arkady should block.
Demo Input:
['4 10 3\n2 2 2 2\n', '4 80 20\n3 2 1 4\n', '5 10 10\n1000 1 1 1 1\n']
Demo Output:
['1\n', '0\n', '4\n']
Note:
In the first example Arkady should block at least one hole. After that, $\frac{10 \cdot 2}{6} \approx 3.333$ liters of water will flow out of the first hole, and that suits Arkady.
In the second example even without blocking any hole, $\frac{80 \cdot 3}{10} = 24$ liters will flow out of the first hole, that is not less than $20$.
In the third example Arkady has to block all holes except the first to make all water flow out of the first hole.
|
```python
import math
n, a, b = map(int, input().split())
s = list(map(int, input().split()))
c = 0
x = math.ceil((a * s[0]) / b)
y = s[0]
f = 0
su = 0
for i in s:
su += i
s.sort()
i = n - 1
while su > x:
if s[i] == y and f == 0:
f = 1
i -= 1
continue
su -= s[i]
c += 1
i -= 1
print(c)
```
| 0
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,689,411,438
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 46
| 0
|
n, k = map(int, input().split())
a = list(map(int, input().split()))
count = 0
for i in range(n):
if 5 - a[i] >= k:
count += 1
print(count // 3)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
n, k = map(int, input().split())
a = list(map(int, input().split()))
count = 0
for i in range(n):
if 5 - a[i] >= k:
count += 1
print(count // 3)
```
| 3
|
|
158
|
A
|
Next Round
|
PROGRAMMING
| 800
|
[
"*special",
"implementation"
] | null | null |
"Contestant who earns a score equal to or greater than the *k*-th place finisher's score will advance to the next round, as long as the contestant earns a positive score..." — an excerpt from contest rules.
A total of *n* participants took part in the contest (*n*<=≥<=*k*), and you already know their scores. Calculate how many participants will advance to the next round.
|
The first line of the input contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50) separated by a single space.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100), where *a**i* is the score earned by the participant who got the *i*-th place. The given sequence is non-increasing (that is, for all *i* from 1 to *n*<=-<=1 the following condition is fulfilled: *a**i*<=≥<=*a**i*<=+<=1).
|
Output the number of participants who advance to the next round.
|
[
"8 5\n10 9 8 7 7 7 5 5\n",
"4 2\n0 0 0 0\n"
] |
[
"6\n",
"0\n"
] |
In the first example the participant on the 5th place earned 7 points. As the participant on the 6th place also earned 7 points, there are 6 advancers.
In the second example nobody got a positive score.
| 500
|
[
{
"input": "8 5\n10 9 8 7 7 7 5 5",
"output": "6"
},
{
"input": "4 2\n0 0 0 0",
"output": "0"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "1 1\n10",
"output": "1"
},
{
"input": "17 14\n16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0",
"output": "14"
},
{
"input": "5 5\n3 2 1 0 0",
"output": "3"
},
{
"input": "8 6\n10 9 8 7 7 7 5 5",
"output": "6"
},
{
"input": "8 7\n10 9 8 7 7 7 5 5",
"output": "8"
},
{
"input": "8 4\n10 9 8 7 7 7 5 5",
"output": "6"
},
{
"input": "8 3\n10 9 8 7 7 7 5 5",
"output": "3"
},
{
"input": "8 1\n10 9 8 7 7 7 5 5",
"output": "1"
},
{
"input": "8 2\n10 9 8 7 7 7 5 5",
"output": "2"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "50 25\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "50 25\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "50 25\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "26"
},
{
"input": "50 25\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "11 5\n100 99 98 97 96 95 94 93 92 91 90",
"output": "5"
},
{
"input": "10 4\n100 81 70 69 64 43 34 29 15 3",
"output": "4"
},
{
"input": "11 6\n87 71 62 52 46 46 43 35 32 25 12",
"output": "6"
},
{
"input": "17 12\n99 88 86 82 75 75 74 65 58 52 45 30 21 16 7 2 2",
"output": "12"
},
{
"input": "20 3\n98 98 96 89 87 82 82 80 76 74 74 68 61 60 43 32 30 22 4 2",
"output": "3"
},
{
"input": "36 12\n90 87 86 85 83 80 79 78 76 70 69 69 61 61 59 58 56 48 45 44 42 41 33 31 27 25 23 21 20 19 15 14 12 7 5 5",
"output": "12"
},
{
"input": "49 8\n99 98 98 96 92 92 90 89 89 86 86 85 83 80 79 76 74 69 67 67 58 56 55 51 49 47 47 46 45 41 41 40 39 34 34 33 25 23 18 15 13 13 11 9 5 4 3 3 1",
"output": "9"
},
{
"input": "49 29\n100 98 98 96 96 96 95 87 85 84 81 76 74 70 63 63 63 62 57 57 56 54 53 52 50 47 45 41 41 39 38 31 30 28 27 26 23 22 20 15 15 11 7 6 6 4 2 1 0",
"output": "29"
},
{
"input": "49 34\n99 98 96 96 93 92 90 89 88 86 85 85 82 76 73 69 66 64 63 63 60 59 57 57 56 55 54 54 51 48 47 44 42 42 40 39 38 36 33 26 24 23 19 17 17 14 12 7 4",
"output": "34"
},
{
"input": "50 44\n100 100 99 97 95 91 91 84 83 83 79 71 70 69 69 62 61 60 59 59 58 58 58 55 55 54 52 48 47 45 44 44 38 36 32 31 28 28 25 25 24 24 24 22 17 15 14 13 12 4",
"output": "44"
},
{
"input": "50 13\n99 95 94 94 88 87 81 79 78 76 74 72 72 69 68 67 67 67 66 63 62 61 58 57 55 55 54 51 50 50 48 48 42 41 38 35 34 32 31 30 26 24 13 13 12 6 5 4 3 3",
"output": "13"
},
{
"input": "50 30\n100 98 96 94 91 89 88 81 81 81 81 81 76 73 72 71 70 69 66 64 61 59 59 56 52 50 49 48 43 39 36 35 34 34 31 29 27 26 24 22 16 16 15 14 14 14 9 7 4 3",
"output": "30"
},
{
"input": "2 1\n10 10",
"output": "2"
},
{
"input": "2 2\n10 10",
"output": "2"
},
{
"input": "2 2\n10 0",
"output": "1"
},
{
"input": "2 2\n10 1",
"output": "2"
},
{
"input": "2 1\n10 0",
"output": "1"
},
{
"input": "2 1\n10 2",
"output": "1"
},
{
"input": "50 13\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "50 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "50 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "10 1\n5 5 5 3 3 3 0 0 0 0",
"output": "3"
},
{
"input": "10 2\n5 5 5 3 3 3 0 0 0 0",
"output": "3"
},
{
"input": "10 3\n5 5 5 3 3 3 0 0 0 0",
"output": "3"
},
{
"input": "10 4\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 5\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 6\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 7\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 8\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 9\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 10\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
}
] | 1,697,317,115
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 50
| 154
| 0
|
lst = list(map(int, input().split()))
n,k = lst[0],lst[1]
lst = list(map(int, input().split()))
scK = lst[k-1]
if max(lst) == 0:
print(0)
else:
co = 0
for s in lst:
if s >= scK and s != 0:
co+=1
print(co)
|
Title: Next Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Contestant who earns a score equal to or greater than the *k*-th place finisher's score will advance to the next round, as long as the contestant earns a positive score..." — an excerpt from contest rules.
A total of *n* participants took part in the contest (*n*<=≥<=*k*), and you already know their scores. Calculate how many participants will advance to the next round.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50) separated by a single space.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100), where *a**i* is the score earned by the participant who got the *i*-th place. The given sequence is non-increasing (that is, for all *i* from 1 to *n*<=-<=1 the following condition is fulfilled: *a**i*<=≥<=*a**i*<=+<=1).
Output Specification:
Output the number of participants who advance to the next round.
Demo Input:
['8 5\n10 9 8 7 7 7 5 5\n', '4 2\n0 0 0 0\n']
Demo Output:
['6\n', '0\n']
Note:
In the first example the participant on the 5th place earned 7 points. As the participant on the 6th place also earned 7 points, there are 6 advancers.
In the second example nobody got a positive score.
|
```python
lst = list(map(int, input().split()))
n,k = lst[0],lst[1]
lst = list(map(int, input().split()))
scK = lst[k-1]
if max(lst) == 0:
print(0)
else:
co = 0
for s in lst:
if s >= scK and s != 0:
co+=1
print(co)
```
| 3
|
|
651
|
B
|
Beautiful Paintings
|
PROGRAMMING
| 1,200
|
[
"greedy",
"sortings"
] | null | null |
There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one.
We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≤<=*i*<=≤<=*n*<=-<=1), such that *a**i*<=+<=1<=><=*a**i*.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of painting.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where *a**i* means the beauty of the *i*-th painting.
|
Print one integer — the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=><=*a**i*, after the optimal rearrangement.
|
[
"5\n20 30 10 50 40\n",
"4\n200 100 100 200\n"
] |
[
"4\n",
"2\n"
] |
In the first sample, the optimal order is: 10, 20, 30, 40, 50.
In the second sample, the optimal order is: 100, 200, 100, 200.
| 1,000
|
[
{
"input": "5\n20 30 10 50 40",
"output": "4"
},
{
"input": "4\n200 100 100 200",
"output": "2"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 2",
"output": "0"
},
{
"input": "1\n1000",
"output": "0"
},
{
"input": "2\n444 333",
"output": "1"
},
{
"input": "100\n9 9 72 55 14 8 55 58 35 67 3 18 73 92 41 49 15 60 18 66 9 26 97 47 43 88 71 97 19 34 48 96 79 53 8 24 69 49 12 23 77 12 21 88 66 9 29 13 61 69 54 77 41 13 4 68 37 74 7 6 29 76 55 72 89 4 78 27 29 82 18 83 12 4 32 69 89 85 66 13 92 54 38 5 26 56 17 55 29 4 17 39 29 94 3 67 85 98 21 14",
"output": "95"
},
{
"input": "1\n995",
"output": "0"
},
{
"input": "10\n103 101 103 103 101 102 100 100 101 104",
"output": "7"
},
{
"input": "20\n102 100 102 104 102 101 104 103 100 103 105 105 100 105 100 100 101 105 105 102",
"output": "15"
},
{
"input": "20\n990 994 996 999 997 994 990 992 990 993 992 990 999 999 992 994 997 990 993 998",
"output": "15"
},
{
"input": "100\n1 8 3 8 10 8 5 3 10 3 5 8 4 5 5 5 10 3 6 6 6 6 6 7 2 7 2 4 7 8 3 8 7 2 5 6 1 5 5 7 9 7 6 9 1 8 1 3 6 5 1 3 6 9 5 6 8 4 8 6 10 9 2 9 3 8 7 5 2 10 2 10 3 6 5 5 3 5 10 2 3 7 10 8 8 4 3 4 9 6 10 7 6 6 6 4 9 9 8 9",
"output": "84"
}
] | 1,587,017,676
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 202
| 2,252,800
|
o += 1
|
Title: Beautiful Paintings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one.
We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≤<=*i*<=≤<=*n*<=-<=1), such that *a**i*<=+<=1<=><=*a**i*.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of painting.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where *a**i* means the beauty of the *i*-th painting.
Output Specification:
Print one integer — the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=><=*a**i*, after the optimal rearrangement.
Demo Input:
['5\n20 30 10 50 40\n', '4\n200 100 100 200\n']
Demo Output:
['4\n', '2\n']
Note:
In the first sample, the optimal order is: 10, 20, 30, 40, 50.
In the second sample, the optimal order is: 100, 200, 100, 200.
|
```python
o += 1
```
| -1
|
|
16
|
A
|
Flag
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Flag
|
2
|
64
|
According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard.
|
The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square.
|
Output YES, if the flag meets the new ISO standard, and NO otherwise.
|
[
"3 3\n000\n111\n222\n",
"3 3\n000\n000\n111\n",
"3 3\n000\n111\n002\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 0
|
[
{
"input": "3 3\n000\n111\n222",
"output": "YES"
},
{
"input": "3 3\n000\n000\n111",
"output": "NO"
},
{
"input": "3 3\n000\n111\n002",
"output": "NO"
},
{
"input": "10 10\n2222222222\n5555555555\n0000000000\n4444444444\n1111111111\n3333333393\n3333333333\n5555555555\n0000000000\n8888888888",
"output": "NO"
},
{
"input": "10 13\n4442444444444\n8888888888888\n6666666666666\n0000000000000\n3333333333333\n4444444444444\n7777777777777\n8388888888888\n1111111111111\n5555555555555",
"output": "NO"
},
{
"input": "10 8\n33333333\n44444444\n11111115\n81888888\n44444444\n11111111\n66666666\n33330333\n33333333\n33333333",
"output": "NO"
},
{
"input": "5 5\n88888\n44444\n66666\n55555\n88888",
"output": "YES"
},
{
"input": "20 19\n1111111111111111111\n5555555555555555555\n0000000000000000000\n3333333333333333333\n1111111111111111111\n2222222222222222222\n4444444444444444444\n5555555555555555555\n0000000000000000000\n4444444444444444444\n0000000000000000000\n5555555555555555555\n7777777777777777777\n9999999999999999999\n2222222222222222222\n4444444444444444444\n1111111111111111111\n6666666666666666666\n7777777777777777777\n2222222222222222222",
"output": "YES"
},
{
"input": "1 100\n8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888",
"output": "YES"
},
{
"input": "100 1\n5\n7\n9\n4\n7\n2\n5\n1\n6\n7\n2\n7\n6\n8\n7\n4\n0\n2\n9\n8\n9\n1\n6\n4\n3\n4\n7\n1\n9\n3\n0\n8\n3\n1\n7\n5\n3\n9\n5\n1\n3\n5\n8\n1\n9\n3\n9\n0\n6\n0\n7\n6\n5\n2\n8\n3\n7\n6\n5\n1\n8\n3\n6\n9\n6\n0\n5\n8\n5\n2\n9\n1\n0\n1\n8\n3\n2\n1\n0\n3\n9\n0\n5\n1\n0\n4\n9\n3\n0\n4\n8\n4\n8\n6\n3\n0\n4\n6\n8\n4",
"output": "YES"
},
{
"input": "1 1\n2",
"output": "YES"
},
{
"input": "1 100\n1111111111111111111111111111111111111111111111111111111111111111111111111111181111111111111111111111",
"output": "NO"
},
{
"input": "100 1\n3\n6\n4\n3\n0\n2\n8\n7\n3\n2\n1\n7\n1\n3\n2\n3\n6\n9\n0\n8\n5\n9\n7\n9\n2\n1\n4\n5\n1\n9\n2\n5\n1\n4\n6\n4\n9\n1\n0\n2\n1\n4\n7\n1\n4\n8\n0\n9\n2\n1\n6\n2\n8\n6\n9\n5\n8\n6\n4\n5\n9\n2\n7\n4\n1\n5\n8\n0\n9\n5\n4\n6\n5\n0\n6\n3\n6\n9\n7\n2\n0\n9\n7\n3\n2\n4\n9\n4\n7\n1\n2\n3\n1\n7\n9\n1\n9\n0\n4\n0",
"output": "YES"
}
] | 1,676,620,615
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 35
| 124
| 0
|
n, m = map(int, input().split())
ok, prev = True, 'X'
for _ in range(n):
row = input()
if row != row[0] * m or row[0] == prev:
ok = False
break
else:
prev = row[0]
print(["NO","YES"][ok])
|
Title: Flag
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard.
Input Specification:
The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square.
Output Specification:
Output YES, if the flag meets the new ISO standard, and NO otherwise.
Demo Input:
['3 3\n000\n111\n222\n', '3 3\n000\n000\n111\n', '3 3\n000\n111\n002\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
n, m = map(int, input().split())
ok, prev = True, 'X'
for _ in range(n):
row = input()
if row != row[0] * m or row[0] == prev:
ok = False
break
else:
prev = row[0]
print(["NO","YES"][ok])
```
| 3.969
|
467
|
A
|
George and Accommodation
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
|
Print a single integer — the number of rooms where George and Alex can move in.
|
[
"3\n1 1\n2 2\n3 3\n",
"3\n1 10\n0 10\n10 10\n"
] |
[
"0\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "0"
},
{
"input": "3\n1 10\n0 10\n10 10",
"output": "2"
},
{
"input": "2\n36 67\n61 69",
"output": "2"
},
{
"input": "3\n21 71\n10 88\n43 62",
"output": "3"
},
{
"input": "3\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100",
"output": "10"
},
{
"input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9",
"output": "4"
},
{
"input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54",
"output": "12"
},
{
"input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68",
"output": "10"
},
{
"input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30",
"output": "8"
},
{
"input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14",
"output": "7"
},
{
"input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28",
"output": "22"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "0"
},
{
"input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2",
"output": "68"
},
{
"input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8",
"output": "5"
},
{
"input": "1\n0 0",
"output": "0"
},
{
"input": "1\n100 100",
"output": "0"
},
{
"input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73",
"output": "42"
},
{
"input": "3\n1 3\n2 7\n8 9",
"output": "2"
},
{
"input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53",
"output": "0"
},
{
"input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54",
"output": "0"
},
{
"input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60",
"output": "12"
},
{
"input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3",
"output": "8"
}
] | 1,699,189,299
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 4
| 46
| 0
|
n=int(input())
count=0
for i in range(n):
z=list(map(int,input().split()))
if z[1]-1>=z[0]:
count+=1
print(count)
|
Title: George and Accommodation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Output Specification:
Print a single integer — the number of rooms where George and Alex can move in.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n']
Demo Output:
['0\n', '2\n']
Note:
none
|
```python
n=int(input())
count=0
for i in range(n):
z=list(map(int,input().split()))
if z[1]-1>=z[0]:
count+=1
print(count)
```
| 0
|
|
999
|
A
|
Mishka and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
|
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
|
Print one integer — the maximum number of problems Mishka can solve.
|
[
"8 4\n4 2 3 1 5 1 6 4\n",
"5 2\n3 1 2 1 3\n",
"5 100\n12 34 55 43 21\n"
] |
[
"5\n",
"0\n",
"5\n"
] |
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
| 0
|
[
{
"input": "8 4\n4 2 3 1 5 1 6 4",
"output": "5"
},
{
"input": "5 2\n3 1 2 1 3",
"output": "0"
},
{
"input": "5 100\n12 34 55 43 21",
"output": "5"
},
{
"input": "100 100\n44 47 36 83 76 94 86 69 31 2 22 77 37 51 10 19 25 78 53 25 1 29 48 95 35 53 22 72 49 86 60 38 13 91 89 18 54 19 71 2 25 33 65 49 53 5 95 90 100 68 25 5 87 48 45 72 34 14 100 44 94 75 80 26 25 7 57 82 49 73 55 43 42 60 34 8 51 11 71 41 81 23 20 89 12 72 68 26 96 92 32 63 13 47 19 9 35 56 79 62",
"output": "100"
},
{
"input": "100 99\n84 82 43 4 71 3 30 92 15 47 76 43 2 17 76 4 1 33 24 96 44 98 75 99 59 11 73 27 67 17 8 88 69 41 44 22 91 48 4 46 42 21 21 67 85 51 57 84 11 100 100 59 39 72 89 82 74 19 98 14 37 97 20 78 38 52 44 83 19 83 69 32 56 6 93 13 98 80 80 2 33 71 11 15 55 51 98 58 16 91 39 32 83 58 77 79 88 81 17 98",
"output": "98"
},
{
"input": "100 69\n80 31 12 89 16 35 8 28 39 12 32 51 42 67 64 53 17 88 63 97 29 41 57 28 51 33 82 75 93 79 57 86 32 100 83 82 99 33 1 27 86 22 65 15 60 100 42 37 38 85 26 43 90 62 91 13 1 92 16 20 100 19 28 30 23 6 5 69 24 22 9 1 10 14 28 14 25 9 32 8 67 4 39 7 10 57 15 7 8 35 62 6 53 59 62 13 24 7 53 2",
"output": "39"
},
{
"input": "100 2\n2 2 2 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 2 1 1 1 2 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 16",
"output": "99"
},
{
"input": "100 3\n86 53 82 40 2 20 59 2 46 63 75 49 24 81 70 22 9 9 93 72 47 23 29 77 78 51 17 59 19 71 35 3 20 60 70 9 11 96 71 94 91 19 88 93 50 49 72 19 53 30 38 67 62 71 81 86 5 26 5 32 63 98 1 97 22 32 87 65 96 55 43 85 56 37 56 67 12 100 98 58 77 54 18 20 33 53 21 66 24 64 42 71 59 32 51 69 49 79 10 1",
"output": "1"
},
{
"input": "13 7\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "1 5\n4",
"output": "1"
},
{
"input": "3 2\n1 4 1",
"output": "2"
},
{
"input": "1 2\n100",
"output": "0"
},
{
"input": "7 4\n4 2 3 4 4 2 3",
"output": "7"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "1 2\n15",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "5 3\n3 4 3 2 1",
"output": "4"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "1 5\n1",
"output": "1"
},
{
"input": "6 6\n7 1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n6 5 5 5 5",
"output": "4"
},
{
"input": "1 4\n2",
"output": "1"
},
{
"input": "9 4\n1 2 1 2 4 2 1 2 1",
"output": "9"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n5",
"output": "1"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "100 10\n2 5 1 10 10 2 7 7 9 4 1 8 1 1 8 4 7 9 10 5 7 9 5 6 7 2 7 5 3 2 1 82 4 80 9 8 6 1 10 7 5 7 1 5 6 7 19 4 2 4 6 2 1 8 31 6 2 2 57 42 3 2 7 1 9 5 10 8 5 4 10 8 3 5 8 7 2 7 6 5 3 3 4 10 6 7 10 8 7 10 7 2 4 6 8 10 10 2 6 4",
"output": "71"
},
{
"input": "100 90\n17 16 5 51 17 62 24 45 49 41 90 30 19 78 67 66 59 34 28 47 42 8 33 77 90 41 61 16 86 33 43 71 90 95 23 9 56 41 24 90 31 12 77 36 90 67 47 15 92 50 79 88 42 19 21 79 86 60 41 26 47 4 70 62 44 90 82 89 84 91 54 16 90 53 29 69 21 44 18 28 88 74 56 43 12 76 10 22 34 24 27 52 28 76 90 75 5 29 50 90",
"output": "63"
},
{
"input": "100 10\n6 4 8 4 1 9 4 8 5 2 2 5 2 6 10 2 2 5 3 5 2 3 10 5 2 9 1 1 6 1 5 9 16 42 33 49 26 31 81 27 53 63 81 90 55 97 70 51 87 21 79 62 60 91 54 95 26 26 30 61 87 79 47 11 59 34 40 82 37 40 81 2 7 1 8 4 10 7 1 10 8 7 3 5 2 8 3 3 9 2 1 1 5 7 8 7 1 10 9 8",
"output": "61"
},
{
"input": "100 90\n45 57 52 69 17 81 85 60 59 39 55 14 87 90 90 31 41 57 35 89 74 20 53 4 33 49 71 11 46 90 71 41 71 90 63 74 51 13 99 92 99 91 100 97 93 40 93 96 100 99 100 92 98 96 78 91 91 91 91 100 94 97 95 97 96 95 17 13 45 35 54 26 2 74 6 51 20 3 73 90 90 42 66 43 86 28 84 70 37 27 90 30 55 80 6 58 57 51 10 22",
"output": "72"
},
{
"input": "100 10\n10 2 10 10 10 10 10 10 10 7 10 10 10 10 10 10 9 10 10 10 10 10 10 10 10 7 9 10 10 10 37 10 4 10 10 10 59 5 95 10 10 10 10 39 10 10 10 10 10 10 10 5 10 10 10 10 10 10 10 10 10 10 10 10 66 10 10 10 10 10 5 10 10 10 10 10 10 44 10 10 10 10 10 10 10 10 10 10 10 7 10 10 10 10 10 10 10 10 10 2",
"output": "52"
},
{
"input": "100 90\n57 90 90 90 90 90 90 90 81 90 3 90 39 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 92 90 90 90 90 90 90 90 90 98 90 90 90 90 90 90 90 90 90 90 90 90 90 54 90 90 90 90 90 62 90 90 91 90 90 90 90 90 90 91 90 90 90 90 90 90 90 3 90 90 90 90 90 90 90 2 90 90 90 90 90 90 90 90 90 2 90 90 90 90 90",
"output": "60"
},
{
"input": "100 10\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 78 90 61 40 87 39 91 50 64 30 10 24 10 55 28 11 28 35 26 26 10 57 45 67 14 99 96 51 67 79 59 11 21 55 70 33 10 16 92 70 38 50 66 52 5 10 10 10 2 4 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 10 10 10 10 8 10 10 10 10 10",
"output": "56"
},
{
"input": "100 90\n90 90 90 90 90 90 55 21 90 90 90 90 90 90 90 90 90 90 69 83 90 90 90 90 90 90 90 90 93 95 92 98 92 97 91 92 92 91 91 95 94 95 100 100 96 97 94 93 90 90 95 95 97 99 90 95 98 91 94 96 99 99 94 95 95 97 99 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 12 90 3 90 90 90 90 90 90 90",
"output": "61"
},
{
"input": "100 49\n71 25 14 36 36 48 36 49 28 40 49 49 49 38 40 49 33 22 49 49 14 46 8 44 49 11 37 49 40 49 2 49 3 49 37 49 49 11 25 49 49 32 49 11 49 30 16 21 49 49 23 24 30 49 49 49 49 49 49 27 49 42 49 49 20 32 30 29 35 49 30 49 9 49 27 25 5 49 49 42 49 20 49 35 49 22 15 49 49 49 19 49 29 28 13 49 22 7 6 24",
"output": "99"
},
{
"input": "100 50\n38 68 9 6 50 18 19 50 50 20 33 34 43 50 24 50 50 2 50 50 50 50 50 21 30 50 41 40 50 50 50 50 50 7 50 21 19 23 1 50 24 50 50 50 25 50 50 50 50 50 50 50 7 24 28 18 50 5 43 50 20 50 13 50 50 16 50 3 2 24 50 50 18 5 50 4 50 50 38 50 33 49 12 33 11 14 50 50 50 33 50 50 50 50 50 50 7 4 50 50",
"output": "99"
},
{
"input": "100 48\n8 6 23 47 29 48 48 48 48 48 48 26 24 48 48 48 3 48 27 28 41 45 9 29 48 48 48 48 48 48 48 48 48 48 47 23 48 48 48 5 48 22 40 48 48 48 20 48 48 57 48 32 19 48 33 2 4 19 48 48 39 48 16 48 48 44 48 48 48 48 29 14 25 43 46 7 48 19 30 48 18 8 39 48 30 47 35 18 48 45 48 48 30 13 48 48 48 17 9 48",
"output": "99"
},
{
"input": "100 57\n57 9 57 4 43 57 57 57 57 26 57 18 57 57 57 57 57 57 57 47 33 57 57 43 57 57 55 57 14 57 57 4 1 57 57 57 57 57 46 26 57 57 57 57 57 57 57 39 57 57 57 5 57 12 11 57 57 57 25 37 34 57 54 18 29 57 39 57 5 57 56 34 57 24 7 57 57 57 2 57 57 57 57 1 55 39 19 57 57 57 57 21 3 40 13 3 57 57 62 57",
"output": "99"
},
{
"input": "100 51\n51 51 38 51 51 45 51 51 51 18 51 36 51 19 51 26 37 51 11 51 45 34 51 21 51 51 33 51 6 51 51 51 21 47 51 13 51 51 30 29 50 51 51 51 51 51 51 45 14 51 2 51 51 23 9 51 50 23 51 29 34 51 40 32 1 36 31 51 11 51 51 47 51 51 51 51 51 51 51 50 39 51 14 4 4 12 3 11 51 51 51 51 41 51 51 51 49 37 5 93",
"output": "99"
},
{
"input": "100 50\n87 91 95 73 50 50 16 97 39 24 58 50 33 89 42 37 50 50 12 71 3 55 50 50 80 10 76 50 52 36 88 44 66 69 86 71 77 50 72 50 21 55 50 50 78 61 75 89 65 2 50 69 62 47 11 92 97 77 41 31 55 29 35 51 36 48 50 91 92 86 50 36 50 94 51 74 4 27 55 63 50 36 87 50 67 7 65 75 20 96 88 50 41 73 35 51 66 21 29 33",
"output": "3"
},
{
"input": "100 50\n50 37 28 92 7 76 50 50 50 76 100 57 50 50 50 32 76 50 8 72 14 8 50 91 67 50 55 82 50 50 24 97 88 50 59 61 68 86 44 15 61 67 88 50 40 50 36 99 1 23 63 50 88 59 76 82 99 76 68 50 50 30 31 68 57 98 71 12 15 60 35 79 90 6 67 50 50 50 50 68 13 6 50 50 16 87 84 50 67 67 50 64 50 58 50 50 77 51 50 51",
"output": "3"
},
{
"input": "100 50\n43 50 50 91 97 67 6 50 86 50 76 60 50 59 4 56 11 38 49 50 37 50 50 20 60 47 33 54 95 58 22 50 77 77 72 9 57 40 81 57 95 50 81 63 62 76 13 87 50 39 74 69 50 99 63 1 11 62 84 31 97 99 56 73 70 36 45 100 28 91 93 9 19 52 73 50 83 58 84 52 86 12 50 44 64 52 97 50 12 71 97 52 87 66 83 66 86 50 9 49",
"output": "6"
},
{
"input": "88 10\n10 8 1 10 10 1 3 7 10 5 8 8 10 2 7 10 10 10 10 10 1 10 10 10 10 1 2 9 10 9 10 10 10 64 100 25 10 12 9 52 13 8 10 56 10 4 10 7 10 3 10 79 74 8 73 10 10 10 9 10 3 5 10 10 10 5 1 10 10 4 3 10 10 10 4 10 6 4 10 10 10 10 3 3 8 5 6 8",
"output": "66"
},
{
"input": "100 50\n80 39 33 69 75 50 23 88 50 50 67 90 87 50 29 15 55 32 60 50 50 50 38 95 62 50 50 88 8 97 45 50 42 12 22 93 49 50 24 50 50 71 60 4 50 72 57 57 50 50 50 83 69 17 1 31 72 55 50 11 50 80 93 41 91 94 20 60 50 50 51 48 53 56 76 73 50 72 19 98 50 50 50 50 50 28 48 45 62 11 16 67 93 88 63 50 50 66 48 95",
"output": "0"
},
{
"input": "100 50\n70 50 38 50 38 50 32 30 50 31 26 42 50 33 34 50 50 50 28 21 50 44 50 47 50 50 9 40 50 50 50 50 50 42 50 50 16 50 50 3 24 50 50 50 4 26 50 2 50 50 33 1 27 50 50 50 8 29 50 23 33 50 6 29 50 50 15 50 50 50 32 50 43 50 50 50 31 50 4 50 50 31 50 50 31 16 50 17 50 17 31 13 25 16 50 10 50 47 50 66",
"output": "0"
},
{
"input": "2 8\n8 8",
"output": "2"
},
{
"input": "1 6\n3",
"output": "1"
},
{
"input": "1 5\n5",
"output": "1"
}
] | 1,692,516,027
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
n, k = map(int, input().split())
q = 0
s = list(map(int, input().split()))
for i in range(n - 1, -1, -1):
if k >= s[i]:
q += 1
s.pop()
else:
break
for i in range(len(s)):
if k >= s[i]:
q += 1
else:
break
print(q)
|
Title: Mishka and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
Output Specification:
Print one integer — the maximum number of problems Mishka can solve.
Demo Input:
['8 4\n4 2 3 1 5 1 6 4\n', '5 2\n3 1 2 1 3\n', '5 100\n12 34 55 43 21\n']
Demo Output:
['5\n', '0\n', '5\n']
Note:
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
|
```python
n, k = map(int, input().split())
q = 0
s = list(map(int, input().split()))
for i in range(n - 1, -1, -1):
if k >= s[i]:
q += 1
s.pop()
else:
break
for i in range(len(s)):
if k >= s[i]:
q += 1
else:
break
print(q)
```
| 3
|
|
399
|
A
|
Pages
|
PROGRAMMING
| 0
|
[
"implementation"
] | null | null |
User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this:
When someone clicks the button "<<" he is redirected to page 1, and when someone clicks the button ">>" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page.
There are some conditions in the navigation:
- If page 1 is in the navigation, the button "<<" must not be printed. - If page *n* is in the navigation, the button ">>" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed.
You can see some examples of the navigations. Make a program that prints the navigation.
|
The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*)
|
Print the proper navigation. Follow the format of the output from the test samples.
|
[
"17 5 2\n",
"6 5 2\n",
"6 1 2\n",
"6 2 2\n",
"9 6 3\n",
"10 6 3\n",
"8 5 4\n"
] |
[
"<< 3 4 (5) 6 7 >> ",
"<< 3 4 (5) 6 ",
"(1) 2 3 >> ",
"1 (2) 3 4 >>",
"<< 3 4 5 (6) 7 8 9",
"<< 3 4 5 (6) 7 8 9 >>",
"1 2 3 4 (5) 6 7 8 "
] |
none
| 500
|
[
{
"input": "17 5 2",
"output": "<< 3 4 (5) 6 7 >> "
},
{
"input": "6 5 2",
"output": "<< 3 4 (5) 6 "
},
{
"input": "6 1 2",
"output": "(1) 2 3 >> "
},
{
"input": "6 2 2",
"output": "1 (2) 3 4 >> "
},
{
"input": "9 6 3",
"output": "<< 3 4 5 (6) 7 8 9 "
},
{
"input": "10 6 3",
"output": "<< 3 4 5 (6) 7 8 9 >> "
},
{
"input": "8 5 4",
"output": "1 2 3 4 (5) 6 7 8 "
},
{
"input": "100 10 20",
"output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 >> "
},
{
"input": "100 25 11",
"output": "<< 14 15 16 17 18 19 20 21 22 23 24 (25) 26 27 28 29 30 31 32 33 34 35 36 >> "
},
{
"input": "5 2 1",
"output": "1 (2) 3 >> "
},
{
"input": "5 3 1",
"output": "<< 2 (3) 4 >> "
},
{
"input": "79 35 12",
"output": "<< 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 >> "
},
{
"input": "100 99 5",
"output": "<< 94 95 96 97 98 (99) 100 "
},
{
"input": "100 99 15",
"output": "<< 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 (99) 100 "
},
{
"input": "100 100 17",
"output": "<< 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 (100) "
},
{
"input": "100 35 28",
"output": "<< 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 >> "
},
{
"input": "100 46 38",
"output": "<< 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 >> "
},
{
"input": "100 46 48",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 >> "
},
{
"input": "100 10 100",
"output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3 1 1",
"output": "(1) 2 >> "
},
{
"input": "3 2 1",
"output": "1 (2) 3 "
},
{
"input": "17 5 3",
"output": "<< 2 3 4 (5) 6 7 8 >> "
},
{
"input": "3 1 3",
"output": "(1) 2 3 "
},
{
"input": "7 5 1",
"output": "<< 4 (5) 6 >> "
},
{
"input": "5 5 5",
"output": "1 2 3 4 (5) "
},
{
"input": "5 3 5",
"output": "1 2 (3) 4 5 "
}
] | 1,573,350,513
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 109
| 0
|
nums = list(input().split())
n, p, k = int(nums[0]), int(nums[1]), int(nums[2])
if p > k+1:
print("<< ", end="")
for i in range(k):
if ((p-k)+i) > 0:
print(f"{(p-k)+i} ", end="")
print(f"({p}) ", end="")
for i in range(1, k+1):
if (p+i) <= n:
print(f"{p+i} ", end="")
if n > p+k:
print(">>")
|
Title: Pages
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this:
When someone clicks the button "<<" he is redirected to page 1, and when someone clicks the button ">>" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page.
There are some conditions in the navigation:
- If page 1 is in the navigation, the button "<<" must not be printed. - If page *n* is in the navigation, the button ">>" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed.
You can see some examples of the navigations. Make a program that prints the navigation.
Input Specification:
The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*)
Output Specification:
Print the proper navigation. Follow the format of the output from the test samples.
Demo Input:
['17 5 2\n', '6 5 2\n', '6 1 2\n', '6 2 2\n', '9 6 3\n', '10 6 3\n', '8 5 4\n']
Demo Output:
['<< 3 4 (5) 6 7 >> ', '<< 3 4 (5) 6 ', '(1) 2 3 >> ', '1 (2) 3 4 >>', '<< 3 4 5 (6) 7 8 9', '<< 3 4 5 (6) 7 8 9 >>', '1 2 3 4 (5) 6 7 8 ']
Note:
none
|
```python
nums = list(input().split())
n, p, k = int(nums[0]), int(nums[1]), int(nums[2])
if p > k+1:
print("<< ", end="")
for i in range(k):
if ((p-k)+i) > 0:
print(f"{(p-k)+i} ", end="")
print(f"({p}) ", end="")
for i in range(1, k+1):
if (p+i) <= n:
print(f"{p+i} ", end="")
if n > p+k:
print(">>")
```
| 3
|
|
958
|
B1
|
Maximum Control (easy)
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
The Resistance is trying to take control over all planets in a particular solar system. This solar system is shaped like a tree. More precisely, some planets are connected by bidirectional hyperspace tunnels in such a way that there is a path between every pair of the planets, but removing any tunnel would disconnect some of them.
The Resistance already has measures in place that will, when the time is right, enable them to control every planet that is not remote. A planet is considered to be remote if it is connected to the rest of the planets only via a single hyperspace tunnel.
How much work is there left to be done: that is, how many remote planets are there?
|
The first line of the input contains an integer *N* (2<=≤<=*N*<=≤<=1000) – the number of planets in the galaxy.
The next *N*<=-<=1 lines describe the hyperspace tunnels between the planets. Each of the *N*<=-<=1 lines contains two space-separated integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*N*) indicating that there is a bidirectional hyperspace tunnel between the planets *u* and *v*. It is guaranteed that every two planets are connected by a path of tunnels, and that each tunnel connects a different pair of planets.
|
A single integer denoting the number of remote planets.
|
[
"5\n4 1\n4 2\n1 3\n1 5\n",
"4\n1 2\n4 3\n1 4\n"
] |
[
"3\n",
"2\n"
] |
In the first example, only planets 2, 3 and 5 are connected by a single tunnel.
In the second example, the remote planets are 2 and 3.
Note that this problem has only two versions – easy and medium.
| 0
|
[
{
"input": "5\n4 1\n4 2\n1 3\n1 5",
"output": "3"
},
{
"input": "4\n1 2\n4 3\n1 4",
"output": "2"
},
{
"input": "10\n4 3\n2 6\n10 1\n5 7\n5 8\n10 6\n5 9\n9 3\n2 9",
"output": "4"
}
] | 1,643,788,006
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 3,379,200
|
n=int(input())
a=[]
cnt=0
for i in range(p-1):
a+=input().split()
for i in range(1,p+1):
if a.count(str(i))==1:
cnt+=1
print(cnt)
|
Title: Maximum Control (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Resistance is trying to take control over all planets in a particular solar system. This solar system is shaped like a tree. More precisely, some planets are connected by bidirectional hyperspace tunnels in such a way that there is a path between every pair of the planets, but removing any tunnel would disconnect some of them.
The Resistance already has measures in place that will, when the time is right, enable them to control every planet that is not remote. A planet is considered to be remote if it is connected to the rest of the planets only via a single hyperspace tunnel.
How much work is there left to be done: that is, how many remote planets are there?
Input Specification:
The first line of the input contains an integer *N* (2<=≤<=*N*<=≤<=1000) – the number of planets in the galaxy.
The next *N*<=-<=1 lines describe the hyperspace tunnels between the planets. Each of the *N*<=-<=1 lines contains two space-separated integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*N*) indicating that there is a bidirectional hyperspace tunnel between the planets *u* and *v*. It is guaranteed that every two planets are connected by a path of tunnels, and that each tunnel connects a different pair of planets.
Output Specification:
A single integer denoting the number of remote planets.
Demo Input:
['5\n4 1\n4 2\n1 3\n1 5\n', '4\n1 2\n4 3\n1 4\n']
Demo Output:
['3\n', '2\n']
Note:
In the first example, only planets 2, 3 and 5 are connected by a single tunnel.
In the second example, the remote planets are 2 and 3.
Note that this problem has only two versions – easy and medium.
|
```python
n=int(input())
a=[]
cnt=0
for i in range(p-1):
a+=input().split()
for i in range(1,p+1):
if a.count(str(i))==1:
cnt+=1
print(cnt)
```
| -1
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.