contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
618
|
A
|
Slime Combining
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
|
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
|
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
|
[
"1\n",
"2\n",
"3\n",
"8\n"
] |
[
"1\n",
"2\n",
"2 1\n",
"4\n"
] |
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "8",
"output": "4"
},
{
"input": "100000",
"output": "17 16 11 10 8 6"
},
{
"input": "12345",
"output": "14 13 6 5 4 1"
},
{
"input": "32",
"output": "6"
},
{
"input": "70958",
"output": "17 13 11 9 6 4 3 2"
},
{
"input": "97593",
"output": "17 15 14 13 12 11 9 6 5 4 1"
},
{
"input": "91706",
"output": "17 15 14 11 10 6 5 4 2"
},
{
"input": "85371",
"output": "17 15 12 11 9 7 6 5 4 2 1"
},
{
"input": "97205",
"output": "17 15 14 13 12 10 9 8 6 5 3 1"
},
{
"input": "34768",
"output": "16 11 10 9 8 7 5"
},
{
"input": "12705",
"output": "14 13 9 8 6 1"
},
{
"input": "30151",
"output": "15 14 13 11 9 8 7 3 2 1"
},
{
"input": "4974",
"output": "13 10 9 7 6 4 3 2"
},
{
"input": "32728",
"output": "15 14 13 12 11 10 9 8 7 5 4"
},
{
"input": "8192",
"output": "14"
},
{
"input": "65536",
"output": "17"
},
{
"input": "32",
"output": "6"
},
{
"input": "256",
"output": "9"
},
{
"input": "4096",
"output": "13"
},
{
"input": "33301",
"output": "16 10 5 3 1"
},
{
"input": "16725",
"output": "15 9 7 5 3 1"
},
{
"input": "149",
"output": "8 5 3 1"
},
{
"input": "16277",
"output": "14 13 12 11 10 9 8 5 3 1"
},
{
"input": "99701",
"output": "17 16 11 9 7 6 5 3 1"
}
] | 1,683,656,830
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 1,060
| 614,400
|
n = int(input())
slimes = [1] * n
i = 0
while i < len(slimes)-1:
if slimes[i] == slimes[i+1]:
slimes[i] += 1
del slimes[i+1]
i = max(i-1, 0) # Go back one position if necessary
else:
i += 1
print(*slimes)
|
Title: Slime Combining
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
Input Specification:
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
Output Specification:
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
Demo Input:
['1\n', '2\n', '3\n', '8\n']
Demo Output:
['1\n', '2\n', '2 1\n', '4\n']
Note:
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4
|
```python
n = int(input())
slimes = [1] * n
i = 0
while i < len(slimes)-1:
if slimes[i] == slimes[i+1]:
slimes[i] += 1
del slimes[i+1]
i = max(i-1, 0) # Go back one position if necessary
else:
i += 1
print(*slimes)
```
| 3
|
|
745
|
B
|
Hongcow Solves A Puzzle
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Hongcow likes solving puzzles.
One day, Hongcow finds two identical puzzle pieces, with the instructions "make a rectangle" next to them. The pieces can be described by an *n* by *m* grid of characters, where the character 'X' denotes a part of the puzzle and '.' denotes an empty part of the grid. It is guaranteed that the puzzle pieces are one 4-connected piece. See the input format and samples for the exact details on how a jigsaw piece will be specified.
The puzzle pieces are very heavy, so Hongcow cannot rotate or flip the puzzle pieces. However, he is allowed to move them in any directions. The puzzle pieces also cannot overlap.
You are given as input the description of one of the pieces. Determine if it is possible to make a rectangle from two identical copies of the given input. The rectangle should be solid, i.e. there should be no empty holes inside it or on its border. Keep in mind that Hongcow is not allowed to flip or rotate pieces and they cannot overlap, i.e. no two 'X' from different pieces can share the same position.
|
The first line of input will contain two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=500), the dimensions of the puzzle piece.
The next *n* lines will describe the jigsaw piece. Each line will have length *m* and will consist of characters '.' and 'X' only. 'X' corresponds to a part of the puzzle piece, '.' is an empty space.
It is guaranteed there is at least one 'X' character in the input and that the 'X' characters form a 4-connected region.
|
Output "YES" if it is possible for Hongcow to make a rectangle. Output "NO" otherwise.
|
[
"2 3\nXXX\nXXX\n",
"2 2\n.X\nXX\n",
"5 5\n.....\n..X..\n.....\n.....\n.....\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
For the first sample, one example of a rectangle we can form is as follows
For the second sample, it is impossible to put two of those pieces without rotating or flipping to form a rectangle.
In the third sample, we can shift the first tile by one to the right, and then compose the following rectangle:
| 1,000
|
[
{
"input": "2 3\nXXX\nXXX",
"output": "YES"
},
{
"input": "2 2\n.X\nXX",
"output": "NO"
},
{
"input": "1 500\n.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.",
"output": "YES"
},
{
"input": "10 1\n.\n.\n.\n.\nX\n.\n.\n.\n.\n.",
"output": "YES"
},
{
"input": "8 5\nXX.XX\nX.XXX\nX.XXX\nXXX.X\nXX.XX\nXX..X\nXXX.X\nXXXX.",
"output": "NO"
},
{
"input": "6 8\nXXXXXX..\nXXXXXXXX\n.X.X..X.\n.XXXX..X\nXX.XXXXX\nX...X..X",
"output": "NO"
},
{
"input": "10 2\n.X\n.X\nXX\nXX\nX.\nXX\nX.\nX.\n..\n..",
"output": "NO"
},
{
"input": "1 1\nX",
"output": "YES"
},
{
"input": "3 3\nXXX\nX.X\nX..",
"output": "NO"
},
{
"input": "3 3\nXX.\nXXX\n.XX",
"output": "NO"
},
{
"input": "4 4\nXXXX\nXXXX\nXX..\nXX..",
"output": "NO"
},
{
"input": "3 3\nX.X\nX.X\nXXX",
"output": "NO"
},
{
"input": "3 2\nX.\nXX\n.X",
"output": "NO"
},
{
"input": "2 1\nX\nX",
"output": "YES"
},
{
"input": "1 2\nXX",
"output": "YES"
},
{
"input": "2 3\n.XX\nXX.",
"output": "NO"
},
{
"input": "5 5\nXXX..\n.XXX.\n..XXX\nXXX..\n.XXX.",
"output": "NO"
},
{
"input": "2 4\nXX..\n.XX.",
"output": "NO"
},
{
"input": "4 4\nXXX.\nXXX.\nX.X.\n..X.",
"output": "NO"
},
{
"input": "2 3\nXX.\n.XX",
"output": "NO"
},
{
"input": "3 5\nXXXX.\n.XXXX\nXXXX.",
"output": "NO"
},
{
"input": "2 4\nXXX.\n.XXX",
"output": "NO"
},
{
"input": "3 3\n...\n.X.\nXXX",
"output": "NO"
},
{
"input": "3 3\n.X.\nXX.\nX..",
"output": "NO"
},
{
"input": "3 4\nXXX.\nX.X.\nXXX.",
"output": "NO"
},
{
"input": "4 4\n....\n....\n.XX.\n..X.",
"output": "NO"
},
{
"input": "4 4\n....\n....\n.XXX\n..X.",
"output": "NO"
},
{
"input": "2 6\nXXXXX.\nXXXXXX",
"output": "NO"
},
{
"input": "3 3\nX.X\nXXX\n.X.",
"output": "NO"
},
{
"input": "3 3\nXXX\nX.X\n..X",
"output": "NO"
},
{
"input": "3 3\n.XX\nXX.\n.XX",
"output": "NO"
},
{
"input": "3 8\n.XXXXXX.\nXXX..XXX\n.XXXXXX.",
"output": "NO"
},
{
"input": "3 3\nXX.\n.XX\nXX.",
"output": "NO"
},
{
"input": "3 3\n.XX\nXX.\nXX.",
"output": "NO"
},
{
"input": "4 4\n....\nXXX.\nX.XX\nXXX.",
"output": "NO"
},
{
"input": "2 2\nX.\nX.",
"output": "YES"
},
{
"input": "2 5\n...XX\n..XX.",
"output": "NO"
},
{
"input": "3 5\nXXX..\n.XXX.\n..XXX",
"output": "NO"
},
{
"input": "2 6\n...XXX\n.XXX..",
"output": "NO"
},
{
"input": "5 5\n.X.XX\n.XXX.\n.XXX.\n.XXX.\n.XXX.",
"output": "NO"
},
{
"input": "4 4\n....\n.XXX\n..X.\n.XX.",
"output": "NO"
},
{
"input": "2 4\n..XX\n.XX.",
"output": "NO"
},
{
"input": "3 6\nXXX...\n.XXX..\n..XXX.",
"output": "NO"
},
{
"input": "3 4\n.XXX\nXXX.\n.XXX",
"output": "NO"
}
] | 1,482,012,156
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 77
| 420
| 614,400
|
import sys
n, m = map(int, input().split())
a = [input() for _ in range(n)]
min_i, min_j = n, m
max_i, max_j = 0, 0
for i in range(n):
for j in range(m):
if a[i][j] == 'X':
min_i, min_j = min(min_i, i), min(min_j, j)
max_i, max_j = max(max_i, i), max(max_j, j)
for i in range(min_i, max_i + 1):
for j in range(min_j, max_j + 1):
if a[i][j] != 'X':
print("NO")
sys.exit(0)
print("YES")
|
Title: Hongcow Solves A Puzzle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hongcow likes solving puzzles.
One day, Hongcow finds two identical puzzle pieces, with the instructions "make a rectangle" next to them. The pieces can be described by an *n* by *m* grid of characters, where the character 'X' denotes a part of the puzzle and '.' denotes an empty part of the grid. It is guaranteed that the puzzle pieces are one 4-connected piece. See the input format and samples for the exact details on how a jigsaw piece will be specified.
The puzzle pieces are very heavy, so Hongcow cannot rotate or flip the puzzle pieces. However, he is allowed to move them in any directions. The puzzle pieces also cannot overlap.
You are given as input the description of one of the pieces. Determine if it is possible to make a rectangle from two identical copies of the given input. The rectangle should be solid, i.e. there should be no empty holes inside it or on its border. Keep in mind that Hongcow is not allowed to flip or rotate pieces and they cannot overlap, i.e. no two 'X' from different pieces can share the same position.
Input Specification:
The first line of input will contain two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=500), the dimensions of the puzzle piece.
The next *n* lines will describe the jigsaw piece. Each line will have length *m* and will consist of characters '.' and 'X' only. 'X' corresponds to a part of the puzzle piece, '.' is an empty space.
It is guaranteed there is at least one 'X' character in the input and that the 'X' characters form a 4-connected region.
Output Specification:
Output "YES" if it is possible for Hongcow to make a rectangle. Output "NO" otherwise.
Demo Input:
['2 3\nXXX\nXXX\n', '2 2\n.X\nXX\n', '5 5\n.....\n..X..\n.....\n.....\n.....\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
For the first sample, one example of a rectangle we can form is as follows
For the second sample, it is impossible to put two of those pieces without rotating or flipping to form a rectangle.
In the third sample, we can shift the first tile by one to the right, and then compose the following rectangle:
|
```python
import sys
n, m = map(int, input().split())
a = [input() for _ in range(n)]
min_i, min_j = n, m
max_i, max_j = 0, 0
for i in range(n):
for j in range(m):
if a[i][j] == 'X':
min_i, min_j = min(min_i, i), min(min_j, j)
max_i, max_j = max(max_i, i), max(max_j, j)
for i in range(min_i, max_i + 1):
for j in range(min_j, max_j + 1):
if a[i][j] != 'X':
print("NO")
sys.exit(0)
print("YES")
```
| 3
|
|
584
|
D
|
Dima and Lisa
|
PROGRAMMING
| 1,800
|
[
"brute force",
"math",
"number theory"
] | null | null |
Dima loves representing an odd number as the sum of multiple primes, and Lisa loves it when there are at most three primes. Help them to represent the given number as the sum of at most than three primes.
More formally, you are given an odd numer *n*. Find a set of numbers *p**i* (1<=≤<=*i*<=≤<=*k*), such that
1. 1<=≤<=*k*<=≤<=31. *p**i* is a prime1.
The numbers *p**i* do not necessarily have to be distinct. It is guaranteed that at least one possible solution exists.
|
The single line contains an odd number *n* (3<=≤<=*n*<=<<=109).
|
In the first line print *k* (1<=≤<=*k*<=≤<=3), showing how many numbers are in the representation you found.
In the second line print numbers *p**i* in any order. If there are multiple possible solutions, you can print any of them.
|
[
"27\n"
] |
[
"3\n5 11 11\n"
] |
A prime is an integer strictly larger than one that is divisible only by one and by itself.
| 2,000
|
[
{
"input": "27",
"output": "3\n2 2 23"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "25",
"output": "2\n2 23"
},
{
"input": "9",
"output": "2\n2 7"
},
{
"input": "91",
"output": "2\n2 89"
},
{
"input": "57",
"output": "3\n2 2 53"
},
{
"input": "31",
"output": "1\n31"
},
{
"input": "555",
"output": "3\n3 5 547"
},
{
"input": "700000001",
"output": "1\n700000001"
},
{
"input": "5",
"output": "1\n5"
},
{
"input": "7",
"output": "1\n7"
},
{
"input": "11",
"output": "1\n11"
},
{
"input": "13",
"output": "1\n13"
},
{
"input": "15",
"output": "2\n2 13"
},
{
"input": "17",
"output": "1\n17"
},
{
"input": "19",
"output": "1\n19"
},
{
"input": "21",
"output": "2\n2 19"
},
{
"input": "23",
"output": "1\n23"
},
{
"input": "29",
"output": "1\n29"
},
{
"input": "79",
"output": "1\n79"
},
{
"input": "99",
"output": "2\n2 97"
},
{
"input": "27",
"output": "3\n2 2 23"
},
{
"input": "55",
"output": "2\n2 53"
},
{
"input": "79",
"output": "1\n79"
},
{
"input": "585",
"output": "3\n3 5 577"
},
{
"input": "245",
"output": "3\n2 2 241"
},
{
"input": "793",
"output": "3\n3 3 787"
},
{
"input": "133",
"output": "2\n2 131"
},
{
"input": "681",
"output": "3\n2 2 677"
},
{
"input": "981399",
"output": "2\n2 981397"
},
{
"input": "867773",
"output": "1\n867773"
},
{
"input": "654141",
"output": "3\n3 11 654127"
},
{
"input": "202985",
"output": "3\n2 2 202981"
},
{
"input": "784533",
"output": "3\n3 17 784513"
},
{
"input": "370359",
"output": "3\n19 79 370261"
},
{
"input": "396831",
"output": "3\n19 79 396733"
},
{
"input": "492211",
"output": "3\n19 79 492113"
},
{
"input": "838347",
"output": "3\n19 79 838249"
},
{
"input": "1098945",
"output": "3\n19 79 1098847"
},
{
"input": "1313565",
"output": "3\n19 79 1313467"
},
{
"input": "1349631",
"output": "3\n19 79 1349533"
},
{
"input": "1357299",
"output": "3\n19 79 1357201"
},
{
"input": "1357323",
"output": "3\n13 109 1357201"
},
{
"input": "1357329",
"output": "3\n19 109 1357201"
},
{
"input": "1388581",
"output": "3\n19 79 1388483"
},
{
"input": "5275",
"output": "2\n2 5273"
},
{
"input": "9515",
"output": "3\n2 2 9511"
},
{
"input": "7847",
"output": "3\n3 3 7841"
},
{
"input": "7077",
"output": "3\n3 5 7069"
},
{
"input": "9531",
"output": "3\n3 7 9521"
},
{
"input": "7865",
"output": "3\n5 7 7853"
},
{
"input": "9675",
"output": "3\n3 11 9661"
},
{
"input": "8909",
"output": "3\n3 13 8893"
},
{
"input": "7147",
"output": "3\n5 13 7129"
},
{
"input": "8487",
"output": "3\n3 17 8467"
},
{
"input": "436273289",
"output": "3\n3 277 436273009"
},
{
"input": "649580445",
"output": "3\n3 271 649580171"
},
{
"input": "944193065",
"output": "3\n7 251 944192807"
},
{
"input": "630045387",
"output": "3\n11 239 630045137"
},
{
"input": "931103229",
"output": "3\n3 223 931103003"
},
{
"input": "950664039",
"output": "3\n3 197 950663839"
},
{
"input": "996104777",
"output": "3\n7 173 996104597"
},
{
"input": "997255617",
"output": "3\n7 157 997255453"
},
{
"input": "999962901",
"output": "3\n19 109 999962773"
},
{
"input": "999995529",
"output": "3\n19 79 999995431"
},
{
"input": "999995339",
"output": "3\n5 43 999995291"
},
{
"input": "999998367",
"output": "3\n5 23 999998339"
},
{
"input": "999999891",
"output": "3\n3 5 999999883"
},
{
"input": "999999935",
"output": "3\n3 3 999999929"
},
{
"input": "999999755",
"output": "3\n2 2 999999751"
},
{
"input": "999999759",
"output": "2\n2 999999757"
},
{
"input": "999999191",
"output": "1\n999999191"
},
{
"input": "999999999",
"output": "3\n3 59 999999937"
},
{
"input": "409449117",
"output": "3\n2 2 409449113"
},
{
"input": "882499837",
"output": "3\n3 3 882499831"
},
{
"input": "765615965",
"output": "3\n5 23 765615937"
},
{
"input": "648732093",
"output": "3\n3 11 648732079"
},
{
"input": "826815517",
"output": "3\n3 11 826815503"
},
{
"input": "4898941",
"output": "2\n2 4898939"
},
{
"input": "182982365",
"output": "3\n5 13 182982347"
},
{
"input": "66098493",
"output": "3\n3 41 66098449"
},
{
"input": "539149213",
"output": "1\n539149213"
},
{
"input": "655957385",
"output": "3\n3 13 655957369"
},
{
"input": "199999581",
"output": "3\n19 79 199999483"
},
{
"input": "199998345",
"output": "3\n19 79 199998247"
},
{
"input": "199991935",
"output": "3\n19 79 199991837"
},
{
"input": "199986207",
"output": "3\n19 79 199986109"
},
{
"input": "499991589",
"output": "3\n19 79 499991491"
},
{
"input": "499984689",
"output": "3\n19 79 499984591"
},
{
"input": "499984159",
"output": "3\n19 79 499984061"
},
{
"input": "499966179",
"output": "3\n19 79 499966081"
},
{
"input": "999995529",
"output": "3\n19 79 999995431"
},
{
"input": "999995085",
"output": "3\n19 79 999994987"
},
{
"input": "999991817",
"output": "3\n11 137 999991669"
},
{
"input": "999991797",
"output": "3\n19 109 999991669"
},
{
"input": "999991791",
"output": "3\n13 109 999991669"
},
{
"input": "748859699",
"output": "3\n3 3 748859693"
},
{
"input": "323845235",
"output": "3\n3 3 323845229"
},
{
"input": "462409937",
"output": "3\n2 2 462409933"
},
{
"input": "618047403",
"output": "3\n3 13 618047387"
},
{
"input": "501148647",
"output": "3\n2 2 501148643"
},
{
"input": "998017623",
"output": "2\n2 998017621"
},
{
"input": "436273289",
"output": "3\n3 277 436273009"
},
{
"input": "999999965",
"output": "3\n5 23 999999937"
},
{
"input": "5",
"output": "1\n5"
},
{
"input": "1000037",
"output": "1\n1000037"
},
{
"input": "989898987",
"output": "3\n2 2 989898983"
},
{
"input": "999999999",
"output": "3\n3 59 999999937"
},
{
"input": "100000003",
"output": "3\n3 11 99999989"
}
] | 1,695,722,689
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 109
| 124
| 4,096,000
|
import sys
import random
input = sys.stdin.readline
rd = random.randint(10 ** 9, 2 * 10 ** 9)
n = int(input())
def isPrime(x: int) -> bool:
if x < 3:
return x == 2
if x % 2 != 1:
return False
A = [2, 325, 9375, 28178, 450775, 9780504, 1795265022]
d = x - 1
r = 0
while d % 2 == 0:
r += 1
d //= 2
for a in A:
v = pow(a, d, x)
if v <= 1 or v == x - 1:
continue
for i in range(r):
v = v * v % x
if v == x - 1 and i != r - 1:
v = 1
break
# 在中途而非开头得到1，却没有经过 - 1，说明存在其他数字y≠-1满足y ^ 2≡1，则x一定不是奇素数
if v == 1:
return False
if v != 1:
return False
return True
if isPrime(n):
print(1)
print(n)
else:
ps = []
for i in range(2,10 ** 4):
if isPrime(i):
ps.append(i)
for p in ps:
if isPrime(n - p):
print(2)
print(p, n - p)
exit()
else:
for p1 in ps:
for p2 in ps:
if isPrime(n - p1 - p2):
print(3)
print(p1, p2, n - p1 - p2)
exit()
|
Title: Dima and Lisa
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima loves representing an odd number as the sum of multiple primes, and Lisa loves it when there are at most three primes. Help them to represent the given number as the sum of at most than three primes.
More formally, you are given an odd numer *n*. Find a set of numbers *p**i* (1<=≤<=*i*<=≤<=*k*), such that
1. 1<=≤<=*k*<=≤<=31. *p**i* is a prime1.
The numbers *p**i* do not necessarily have to be distinct. It is guaranteed that at least one possible solution exists.
Input Specification:
The single line contains an odd number *n* (3<=≤<=*n*<=<<=109).
Output Specification:
In the first line print *k* (1<=≤<=*k*<=≤<=3), showing how many numbers are in the representation you found.
In the second line print numbers *p**i* in any order. If there are multiple possible solutions, you can print any of them.
Demo Input:
['27\n']
Demo Output:
['3\n5 11 11\n']
Note:
A prime is an integer strictly larger than one that is divisible only by one and by itself.
|
```python
import sys
import random
input = sys.stdin.readline
rd = random.randint(10 ** 9, 2 * 10 ** 9)
n = int(input())
def isPrime(x: int) -> bool:
if x < 3:
return x == 2
if x % 2 != 1:
return False
A = [2, 325, 9375, 28178, 450775, 9780504, 1795265022]
d = x - 1
r = 0
while d % 2 == 0:
r += 1
d //= 2
for a in A:
v = pow(a, d, x)
if v <= 1 or v == x - 1:
continue
for i in range(r):
v = v * v % x
if v == x - 1 and i != r - 1:
v = 1
break
# 在中途而非开头得到1，却没有经过 - 1，说明存在其他数字y≠-1满足y ^ 2≡1，则x一定不是奇素数
if v == 1:
return False
if v != 1:
return False
return True
if isPrime(n):
print(1)
print(n)
else:
ps = []
for i in range(2,10 ** 4):
if isPrime(i):
ps.append(i)
for p in ps:
if isPrime(n - p):
print(2)
print(p, n - p)
exit()
else:
for p1 in ps:
for p2 in ps:
if isPrime(n - p1 - p2):
print(3)
print(p1, p2, n - p1 - p2)
exit()
```
| 3
|
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,662,784,170
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 46
| 0
|
n=input()
a="heidi"
j=0
for i in n:
if i==a[j] :
j+=1
if j==5:
break
if(j==5):
print('YES')
else:
print('NO')
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
n=input()
a="heidi"
j=0
for i in n:
if i==a[j] :
j+=1
if j==5:
break
if(j==5):
print('YES')
else:
print('NO')
```
| 3
|
|
520
|
A
|
Pangram
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
|
Output "YES", if the string is a pangram and "NO" otherwise.
|
[
"12\ntoosmallword\n",
"35\nTheQuickBrownFoxJumpsOverTheLazyDog\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "12\ntoosmallword",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog",
"output": "YES"
},
{
"input": "1\na",
"output": "NO"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "YES"
},
{
"input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "YES"
},
{
"input": "48\nthereisasyetinsufficientdataforameaningfulanswer",
"output": "NO"
},
{
"input": "30\nToBeOrNotToBeThatIsTheQuestion",
"output": "NO"
},
{
"input": "30\njackdawslovemybigsphinxofquarz",
"output": "NO"
},
{
"input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY",
"output": "YES"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx",
"output": "YES"
},
{
"input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ",
"output": "YES"
},
{
"input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ",
"output": "YES"
},
{
"input": "25\nnxYTzLFwzNolAumjgcAboyxAj",
"output": "NO"
},
{
"input": "26\npRWdodGdxUESvcScPGbUoooZsC",
"output": "NO"
},
{
"input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj",
"output": "NO"
},
{
"input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa",
"output": "YES"
},
{
"input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK",
"output": "NO"
},
{
"input": "26\nvCUFRKElZOnjmXGylWQaHDiPst",
"output": "NO"
},
{
"input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY",
"output": "NO"
},
{
"input": "26\npGiFluRteQwkaVoPszJyNBChxM",
"output": "NO"
},
{
"input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY",
"output": "NO"
},
{
"input": "26\nLndjgvAEuICHKxPwqYztosrmBN",
"output": "NO"
},
{
"input": "26\nMdaXJrCipnOZLykfqHWEStevbU",
"output": "NO"
},
{
"input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba",
"output": "NO"
},
{
"input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo",
"output": "NO"
},
{
"input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa",
"output": "NO"
},
{
"input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO",
"output": "NO"
},
{
"input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe",
"output": "NO"
},
{
"input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG",
"output": "NO"
},
{
"input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF",
"output": "NO"
},
{
"input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu",
"output": "NO"
},
{
"input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf",
"output": "NO"
},
{
"input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE",
"output": "NO"
},
{
"input": "26\nDqspXZJTuONYieKgaHLMBwfVSC",
"output": "NO"
},
{
"input": "26\necOyUkqNljFHRVXtIpWabGMLDz",
"output": "NO"
},
{
"input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI",
"output": "NO"
},
{
"input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA",
"output": "NO"
},
{
"input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz",
"output": "NO"
},
{
"input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ",
"output": "NO"
},
{
"input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF",
"output": "NO"
},
{
"input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB",
"output": "NO"
},
{
"input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg",
"output": "NO"
},
{
"input": "26\nmnbvcxxlkjhgfdsapoiuytrewq",
"output": "NO"
},
{
"input": "26\naAbcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl",
"output": "NO"
},
{
"input": "25\nabcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "26\nabcdefhijklmnopqrstVxyzABC",
"output": "NO"
},
{
"input": "25\nqwertyuiopasdfghjklxcvbnm",
"output": "NO"
},
{
"input": "34\nTheQuickBrownFoxJumpsOverTheLayDog",
"output": "NO"
},
{
"input": "26\nabcdefghigklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyA",
"output": "NO"
},
{
"input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog",
"output": "NO"
},
{
"input": "25\nbcdefghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa",
"output": "NO"
},
{
"input": "26\nabcdefghiklmnopqrstvxyzABC",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxzZ",
"output": "NO"
},
{
"input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY",
"output": "NO"
}
] | 1,692,822,759
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 46
| 0
|
alpha="abcdefghijklmnopqrstuvwxyz"
n=int(input(""))
s=input().lower()
for x in alpha:
if x not in s:
print("no")
quit()
print("yes")
|
Title: Pangram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output Specification:
Output "YES", if the string is a pangram and "NO" otherwise.
Demo Input:
['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
alpha="abcdefghijklmnopqrstuvwxyz"
n=int(input(""))
s=input().lower()
for x in alpha:
if x not in s:
print("no")
quit()
print("yes")
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,687,268,614
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
s = input()
t = input()
t1 = s[::-1]
if(t==t1):
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
s = input()
t = input()
t1 = s[::-1]
if(t==t1):
print("YES")
else:
print("NO")
```
| 3.977
|
6
|
A
|
Triangle
|
PROGRAMMING
| 900
|
[
"brute force",
"geometry"
] |
A. Triangle
|
2
|
64
|
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same.
The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
|
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
|
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
|
[
"4 2 1 3\n",
"7 2 2 4\n",
"3 5 9 1\n"
] |
[
"TRIANGLE\n",
"SEGMENT\n",
"IMPOSSIBLE\n"
] |
none
| 0
|
[
{
"input": "4 2 1 3",
"output": "TRIANGLE"
},
{
"input": "7 2 2 4",
"output": "SEGMENT"
},
{
"input": "3 5 9 1",
"output": "IMPOSSIBLE"
},
{
"input": "3 1 5 1",
"output": "IMPOSSIBLE"
},
{
"input": "10 10 10 10",
"output": "TRIANGLE"
},
{
"input": "11 5 6 11",
"output": "TRIANGLE"
},
{
"input": "1 1 1 1",
"output": "TRIANGLE"
},
{
"input": "10 20 30 40",
"output": "TRIANGLE"
},
{
"input": "45 25 5 15",
"output": "IMPOSSIBLE"
},
{
"input": "20 5 8 13",
"output": "TRIANGLE"
},
{
"input": "10 30 7 20",
"output": "SEGMENT"
},
{
"input": "3 2 3 2",
"output": "TRIANGLE"
},
{
"input": "70 10 100 30",
"output": "SEGMENT"
},
{
"input": "4 8 16 2",
"output": "IMPOSSIBLE"
},
{
"input": "3 3 3 10",
"output": "TRIANGLE"
},
{
"input": "1 5 5 5",
"output": "TRIANGLE"
},
{
"input": "13 25 12 1",
"output": "SEGMENT"
},
{
"input": "10 100 7 3",
"output": "SEGMENT"
},
{
"input": "50 1 50 100",
"output": "TRIANGLE"
},
{
"input": "50 1 100 49",
"output": "SEGMENT"
},
{
"input": "49 51 100 1",
"output": "SEGMENT"
},
{
"input": "5 11 2 25",
"output": "IMPOSSIBLE"
},
{
"input": "91 50 9 40",
"output": "IMPOSSIBLE"
},
{
"input": "27 53 7 97",
"output": "IMPOSSIBLE"
},
{
"input": "51 90 24 8",
"output": "IMPOSSIBLE"
},
{
"input": "3 5 1 1",
"output": "IMPOSSIBLE"
},
{
"input": "13 49 69 15",
"output": "IMPOSSIBLE"
},
{
"input": "16 99 9 35",
"output": "IMPOSSIBLE"
},
{
"input": "27 6 18 53",
"output": "IMPOSSIBLE"
},
{
"input": "57 88 17 8",
"output": "IMPOSSIBLE"
},
{
"input": "95 20 21 43",
"output": "IMPOSSIBLE"
},
{
"input": "6 19 32 61",
"output": "IMPOSSIBLE"
},
{
"input": "100 21 30 65",
"output": "IMPOSSIBLE"
},
{
"input": "85 16 61 9",
"output": "IMPOSSIBLE"
},
{
"input": "5 6 19 82",
"output": "IMPOSSIBLE"
},
{
"input": "1 5 1 3",
"output": "IMPOSSIBLE"
},
{
"input": "65 10 36 17",
"output": "IMPOSSIBLE"
},
{
"input": "81 64 9 7",
"output": "IMPOSSIBLE"
},
{
"input": "11 30 79 43",
"output": "IMPOSSIBLE"
},
{
"input": "1 1 5 3",
"output": "IMPOSSIBLE"
},
{
"input": "21 94 61 31",
"output": "IMPOSSIBLE"
},
{
"input": "49 24 9 74",
"output": "IMPOSSIBLE"
},
{
"input": "11 19 5 77",
"output": "IMPOSSIBLE"
},
{
"input": "52 10 19 71",
"output": "SEGMENT"
},
{
"input": "2 3 7 10",
"output": "SEGMENT"
},
{
"input": "1 2 6 3",
"output": "SEGMENT"
},
{
"input": "2 6 1 8",
"output": "SEGMENT"
},
{
"input": "1 2 4 1",
"output": "SEGMENT"
},
{
"input": "4 10 6 2",
"output": "SEGMENT"
},
{
"input": "2 10 7 3",
"output": "SEGMENT"
},
{
"input": "5 2 3 9",
"output": "SEGMENT"
},
{
"input": "6 1 4 10",
"output": "SEGMENT"
},
{
"input": "10 6 4 1",
"output": "SEGMENT"
},
{
"input": "3 2 9 1",
"output": "SEGMENT"
},
{
"input": "22 80 29 7",
"output": "SEGMENT"
},
{
"input": "2 6 3 9",
"output": "SEGMENT"
},
{
"input": "3 1 2 1",
"output": "SEGMENT"
},
{
"input": "3 4 7 1",
"output": "SEGMENT"
},
{
"input": "8 4 3 1",
"output": "SEGMENT"
},
{
"input": "2 8 3 5",
"output": "SEGMENT"
},
{
"input": "4 1 2 1",
"output": "SEGMENT"
},
{
"input": "8 1 3 2",
"output": "SEGMENT"
},
{
"input": "6 2 1 8",
"output": "SEGMENT"
},
{
"input": "3 3 3 6",
"output": "TRIANGLE"
},
{
"input": "3 6 3 3",
"output": "TRIANGLE"
},
{
"input": "4 10 4 4",
"output": "TRIANGLE"
},
{
"input": "1 1 2 1",
"output": "TRIANGLE"
},
{
"input": "3 3 3 6",
"output": "TRIANGLE"
},
{
"input": "5 4 5 5",
"output": "TRIANGLE"
},
{
"input": "8 7 8 8",
"output": "TRIANGLE"
},
{
"input": "3 3 3 1",
"output": "TRIANGLE"
},
{
"input": "1 1 6 6",
"output": "TRIANGLE"
},
{
"input": "1 9 1 9",
"output": "TRIANGLE"
},
{
"input": "7 2 2 7",
"output": "TRIANGLE"
},
{
"input": "7 2 3 2",
"output": "TRIANGLE"
},
{
"input": "4 4 10 10",
"output": "TRIANGLE"
},
{
"input": "7 7 10 7",
"output": "TRIANGLE"
},
{
"input": "4 4 4 5",
"output": "TRIANGLE"
},
{
"input": "1 10 9 2",
"output": "TRIANGLE"
},
{
"input": "1 8 2 7",
"output": "TRIANGLE"
},
{
"input": "4 3 2 8",
"output": "TRIANGLE"
},
{
"input": "5 9 5 3",
"output": "TRIANGLE"
},
{
"input": "4 10 3 5",
"output": "TRIANGLE"
}
] | 1,625,087,900
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 83
| 124
| 0
|
s = input().split(' ')
s = [int(i) for i in s]
s.sort()
def sticks(s):
if (s[0] + s[1] > s[2]) or (s[1] + s[2] > s[3]) or (s[0] + s[2] > s[3]):
return 'TRIANGLE'
elif (s[0] + s[1] == s[2]) or (s[1] + s[2] == s[3]) or (s[0] + s[2] == s[3]):
return 'SEGMENT'
else:
return 'IMPOSSIBLE'
print(sticks(s))
|
Title: Triangle
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same.
The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
Input Specification:
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
Output Specification:
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
Demo Input:
['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n']
Demo Output:
['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n']
Note:
none
|
```python
s = input().split(' ')
s = [int(i) for i in s]
s.sort()
def sticks(s):
if (s[0] + s[1] > s[2]) or (s[1] + s[2] > s[3]) or (s[0] + s[2] > s[3]):
return 'TRIANGLE'
elif (s[0] + s[1] == s[2]) or (s[1] + s[2] == s[3]) or (s[0] + s[2] == s[3]):
return 'SEGMENT'
else:
return 'IMPOSSIBLE'
print(sticks(s))
```
| 3.969
|
916
|
A
|
Jamie and Alarm Snooze
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Jamie loves sleeping. One day, he decides that he needs to wake up at exactly *hh*:<=*mm*. However, he hates waking up, so he wants to make waking up less painful by setting the alarm at a lucky time. He will then press the snooze button every *x* minutes until *hh*:<=*mm* is reached, and only then he will wake up. He wants to know what is the smallest number of times he needs to press the snooze button.
A time is considered lucky if it contains a digit '7'. For example, 13:<=07 and 17:<=27 are lucky, while 00:<=48 and 21:<=34 are not lucky.
Note that it is not necessary that the time set for the alarm and the wake-up time are on the same day. It is guaranteed that there is a lucky time Jamie can set so that he can wake at *hh*:<=*mm*.
Formally, find the smallest possible non-negative integer *y* such that the time representation of the time *x*·*y* minutes before *hh*:<=*mm* contains the digit '7'.
Jamie uses 24-hours clock, so after 23:<=59 comes 00:<=00.
|
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=60).
The second line contains two two-digit integers, *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59).
|
Print the minimum number of times he needs to press the button.
|
[
"3\n11 23\n",
"5\n01 07\n"
] |
[
"2\n",
"0\n"
] |
In the first sample, Jamie needs to wake up at 11:23. So, he can set his alarm at 11:17. He would press the snooze button when the alarm rings at 11:17 and at 11:20.
In the second sample, Jamie can set his alarm at exactly at 01:07 which is lucky.
| 500
|
[
{
"input": "3\n11 23",
"output": "2"
},
{
"input": "5\n01 07",
"output": "0"
},
{
"input": "34\n09 24",
"output": "3"
},
{
"input": "2\n14 37",
"output": "0"
},
{
"input": "14\n19 54",
"output": "9"
},
{
"input": "42\n15 44",
"output": "12"
},
{
"input": "46\n02 43",
"output": "1"
},
{
"input": "14\n06 41",
"output": "1"
},
{
"input": "26\n04 58",
"output": "26"
},
{
"input": "54\n16 47",
"output": "0"
},
{
"input": "38\n20 01",
"output": "3"
},
{
"input": "11\n02 05",
"output": "8"
},
{
"input": "55\n22 10",
"output": "5"
},
{
"input": "23\n10 08",
"output": "6"
},
{
"input": "23\n23 14",
"output": "9"
},
{
"input": "51\n03 27",
"output": "0"
},
{
"input": "35\n15 25",
"output": "13"
},
{
"input": "3\n12 15",
"output": "6"
},
{
"input": "47\n00 28",
"output": "3"
},
{
"input": "31\n13 34",
"output": "7"
},
{
"input": "59\n17 32",
"output": "0"
},
{
"input": "25\n11 03",
"output": "8"
},
{
"input": "9\n16 53",
"output": "4"
},
{
"input": "53\n04 06",
"output": "3"
},
{
"input": "37\n00 12",
"output": "5"
},
{
"input": "5\n13 10",
"output": "63"
},
{
"input": "50\n01 59",
"output": "10"
},
{
"input": "34\n06 13",
"output": "4"
},
{
"input": "2\n18 19",
"output": "1"
},
{
"input": "46\n06 16",
"output": "17"
},
{
"input": "14\n03 30",
"output": "41"
},
{
"input": "40\n13 37",
"output": "0"
},
{
"input": "24\n17 51",
"output": "0"
},
{
"input": "8\n14 57",
"output": "0"
},
{
"input": "52\n18 54",
"output": "2"
},
{
"input": "20\n15 52",
"output": "24"
},
{
"input": "20\n03 58",
"output": "30"
},
{
"input": "48\n07 11",
"output": "0"
},
{
"input": "32\n04 01",
"output": "2"
},
{
"input": "60\n08 15",
"output": "1"
},
{
"input": "44\n20 20",
"output": "4"
},
{
"input": "55\n15 35",
"output": "9"
},
{
"input": "55\n03 49",
"output": "11"
},
{
"input": "23\n16 39",
"output": "4"
},
{
"input": "7\n20 36",
"output": "7"
},
{
"input": "35\n16 42",
"output": "1"
},
{
"input": "35\n05 56",
"output": "21"
},
{
"input": "3\n17 45",
"output": "0"
},
{
"input": "47\n05 59",
"output": "6"
},
{
"input": "15\n10 13",
"output": "9"
},
{
"input": "59\n06 18",
"output": "9"
},
{
"input": "34\n17 18",
"output": "0"
},
{
"input": "18\n05 23",
"output": "2"
},
{
"input": "46\n17 21",
"output": "0"
},
{
"input": "30\n06 27",
"output": "0"
},
{
"input": "14\n18 40",
"output": "3"
},
{
"input": "58\n22 54",
"output": "6"
},
{
"input": "26\n19 44",
"output": "5"
},
{
"input": "10\n15 57",
"output": "0"
},
{
"input": "54\n20 47",
"output": "0"
},
{
"input": "22\n08 45",
"output": "3"
},
{
"input": "48\n18 08",
"output": "1"
},
{
"input": "32\n07 06",
"output": "0"
},
{
"input": "60\n19 19",
"output": "2"
},
{
"input": "45\n07 25",
"output": "0"
},
{
"input": "29\n12 39",
"output": "8"
},
{
"input": "13\n08 28",
"output": "3"
},
{
"input": "41\n21 42",
"output": "5"
},
{
"input": "41\n09 32",
"output": "3"
},
{
"input": "9\n21 45",
"output": "2"
},
{
"input": "37\n10 43",
"output": "5"
},
{
"input": "3\n20 50",
"output": "1"
},
{
"input": "47\n00 04",
"output": "1"
},
{
"input": "15\n13 10",
"output": "21"
},
{
"input": "15\n17 23",
"output": "0"
},
{
"input": "43\n22 13",
"output": "2"
},
{
"input": "27\n10 26",
"output": "6"
},
{
"input": "55\n22 24",
"output": "5"
},
{
"input": "55\n03 30",
"output": "11"
},
{
"input": "24\n23 27",
"output": "0"
},
{
"input": "52\n11 33",
"output": "3"
},
{
"input": "18\n22 48",
"output": "17"
},
{
"input": "1\n12 55",
"output": "8"
},
{
"input": "1\n04 27",
"output": "0"
},
{
"input": "1\n12 52",
"output": "5"
},
{
"input": "1\n20 16",
"output": "9"
},
{
"input": "1\n04 41",
"output": "4"
},
{
"input": "1\n20 21",
"output": "4"
},
{
"input": "1\n04 45",
"output": "8"
},
{
"input": "1\n12 18",
"output": "1"
},
{
"input": "1\n04 42",
"output": "5"
},
{
"input": "1\n02 59",
"output": "2"
},
{
"input": "1\n18 24",
"output": "7"
},
{
"input": "1\n02 04",
"output": "7"
},
{
"input": "1\n18 28",
"output": "1"
},
{
"input": "1\n18 01",
"output": "2"
},
{
"input": "1\n10 25",
"output": "8"
},
{
"input": "1\n02 49",
"output": "2"
},
{
"input": "1\n02 30",
"output": "3"
},
{
"input": "1\n18 54",
"output": "7"
},
{
"input": "1\n02 19",
"output": "2"
},
{
"input": "1\n05 25",
"output": "8"
},
{
"input": "60\n23 55",
"output": "6"
},
{
"input": "60\n08 19",
"output": "1"
},
{
"input": "60\n00 00",
"output": "7"
},
{
"input": "60\n08 24",
"output": "1"
},
{
"input": "60\n16 13",
"output": "9"
},
{
"input": "60\n08 21",
"output": "1"
},
{
"input": "60\n16 45",
"output": "9"
},
{
"input": "60\n08 26",
"output": "1"
},
{
"input": "60\n08 50",
"output": "1"
},
{
"input": "60\n05 21",
"output": "12"
},
{
"input": "60\n13 29",
"output": "6"
},
{
"input": "60\n05 18",
"output": "12"
},
{
"input": "60\n13 42",
"output": "6"
},
{
"input": "60\n05 07",
"output": "0"
},
{
"input": "60\n05 47",
"output": "0"
},
{
"input": "60\n21 55",
"output": "4"
},
{
"input": "60\n05 36",
"output": "12"
},
{
"input": "60\n21 08",
"output": "4"
},
{
"input": "60\n21 32",
"output": "4"
},
{
"input": "60\n16 31",
"output": "9"
},
{
"input": "5\n00 00",
"output": "73"
},
{
"input": "2\n06 58",
"output": "390"
},
{
"input": "60\n00 00",
"output": "7"
},
{
"input": "2\n00 00",
"output": "181"
},
{
"input": "10\n00 00",
"output": "37"
},
{
"input": "60\n01 00",
"output": "8"
},
{
"input": "12\n00 06",
"output": "31"
},
{
"input": "1\n00 01",
"output": "4"
},
{
"input": "5\n00 05",
"output": "74"
},
{
"input": "60\n01 01",
"output": "8"
},
{
"input": "11\n18 11",
"output": "2"
},
{
"input": "60\n01 15",
"output": "8"
},
{
"input": "10\n00 16",
"output": "38"
},
{
"input": "60\n00 59",
"output": "7"
},
{
"input": "30\n00 00",
"output": "13"
},
{
"input": "60\n01 05",
"output": "8"
},
{
"input": "4\n00 03",
"output": "4"
},
{
"input": "4\n00 00",
"output": "91"
},
{
"input": "60\n00 01",
"output": "7"
},
{
"input": "6\n00 03",
"output": "1"
},
{
"input": "13\n00 00",
"output": "1"
},
{
"input": "1\n18 01",
"output": "2"
},
{
"input": "5\n06 00",
"output": "145"
},
{
"input": "60\n04 08",
"output": "11"
},
{
"input": "5\n01 55",
"output": "96"
},
{
"input": "8\n00 08",
"output": "47"
},
{
"input": "23\n18 23",
"output": "2"
},
{
"input": "6\n00 06",
"output": "62"
},
{
"input": "59\n18 59",
"output": "2"
},
{
"input": "11\n00 10",
"output": "3"
},
{
"input": "10\n00 01",
"output": "37"
},
{
"input": "59\n00 00",
"output": "7"
},
{
"input": "10\n18 10",
"output": "2"
},
{
"input": "5\n00 01",
"output": "73"
},
{
"input": "1\n00 00",
"output": "3"
},
{
"input": "8\n00 14",
"output": "47"
},
{
"input": "60\n03 00",
"output": "10"
},
{
"input": "60\n00 10",
"output": "7"
},
{
"input": "5\n01 13",
"output": "87"
},
{
"input": "30\n02 43",
"output": "18"
},
{
"input": "17\n00 08",
"output": "3"
},
{
"input": "3\n00 00",
"output": "1"
},
{
"input": "60\n00 05",
"output": "7"
},
{
"input": "5\n18 05",
"output": "2"
},
{
"input": "30\n00 30",
"output": "14"
},
{
"input": "1\n00 06",
"output": "9"
},
{
"input": "55\n00 00",
"output": "7"
},
{
"input": "8\n02 08",
"output": "62"
},
{
"input": "7\n00 00",
"output": "9"
},
{
"input": "6\n08 06",
"output": "2"
},
{
"input": "48\n06 24",
"output": "16"
},
{
"input": "8\n06 58",
"output": "98"
},
{
"input": "3\n12 00",
"output": "1"
},
{
"input": "5\n01 06",
"output": "86"
},
{
"input": "2\n00 08",
"output": "185"
},
{
"input": "3\n18 03",
"output": "2"
},
{
"input": "1\n17 00",
"output": "0"
},
{
"input": "59\n00 48",
"output": "7"
},
{
"input": "5\n12 01",
"output": "49"
},
{
"input": "55\n01 25",
"output": "9"
},
{
"input": "2\n07 23",
"output": "0"
},
{
"input": "10\n01 10",
"output": "44"
},
{
"input": "2\n00 01",
"output": "2"
},
{
"input": "59\n00 01",
"output": "6"
},
{
"input": "5\n00 02",
"output": "1"
},
{
"input": "4\n01 02",
"output": "106"
},
{
"input": "5\n00 06",
"output": "74"
},
{
"input": "42\n00 08",
"output": "9"
},
{
"input": "60\n01 20",
"output": "8"
},
{
"input": "3\n06 00",
"output": "1"
},
{
"input": "4\n00 01",
"output": "1"
},
{
"input": "2\n00 06",
"output": "184"
},
{
"input": "1\n00 57",
"output": "0"
},
{
"input": "6\n00 00",
"output": "61"
},
{
"input": "5\n08 40",
"output": "9"
},
{
"input": "58\n00 55",
"output": "1"
},
{
"input": "2\n00 02",
"output": "182"
},
{
"input": "1\n08 01",
"output": "2"
},
{
"input": "10\n10 10",
"output": "14"
},
{
"input": "60\n01 11",
"output": "8"
},
{
"input": "2\n07 00",
"output": "0"
},
{
"input": "15\n00 03",
"output": "25"
},
{
"input": "6\n04 34",
"output": "106"
},
{
"input": "16\n00 16",
"output": "24"
},
{
"input": "2\n00 59",
"output": "1"
},
{
"input": "59\n00 08",
"output": "7"
},
{
"input": "10\n03 10",
"output": "56"
},
{
"input": "3\n08 03",
"output": "2"
},
{
"input": "20\n06 11",
"output": "37"
},
{
"input": "4\n01 00",
"output": "106"
},
{
"input": "38\n01 08",
"output": "12"
},
{
"input": "60\n00 06",
"output": "7"
},
{
"input": "5\n12 00",
"output": "49"
},
{
"input": "6\n01 42",
"output": "78"
},
{
"input": "4\n00 04",
"output": "92"
},
{
"input": "60\n04 05",
"output": "11"
},
{
"input": "1\n00 53",
"output": "6"
},
{
"input": "5\n08 05",
"output": "2"
},
{
"input": "60\n18 45",
"output": "1"
},
{
"input": "60\n06 23",
"output": "13"
},
{
"input": "6\n00 15",
"output": "3"
},
{
"input": "58\n00 06",
"output": "7"
},
{
"input": "2\n06 44",
"output": "383"
},
{
"input": "1\n08 00",
"output": "1"
},
{
"input": "10\n06 58",
"output": "78"
},
{
"input": "59\n00 58",
"output": "8"
},
{
"input": "1\n18 00",
"output": "1"
},
{
"input": "50\n00 42",
"output": "9"
},
{
"input": "30\n18 30",
"output": "2"
},
{
"input": "60\n21 59",
"output": "4"
},
{
"input": "2\n10 52",
"output": "87"
},
{
"input": "56\n00 00",
"output": "7"
},
{
"input": "16\n18 16",
"output": "2"
},
{
"input": "5\n01 05",
"output": "86"
},
{
"input": "5\n05 00",
"output": "133"
},
{
"input": "5\n23 59",
"output": "72"
},
{
"input": "7\n17 13",
"output": "0"
},
{
"input": "58\n00 00",
"output": "7"
},
{
"input": "15\n00 07",
"output": "0"
},
{
"input": "59\n08 00",
"output": "1"
},
{
"input": "46\n00 00",
"output": "8"
},
{
"input": "59\n01 05",
"output": "2"
},
{
"input": "2\n01 00",
"output": "211"
},
{
"input": "60\n00 24",
"output": "7"
},
{
"input": "10\n00 08",
"output": "37"
},
{
"input": "10\n00 06",
"output": "37"
},
{
"input": "60\n01 24",
"output": "8"
},
{
"input": "50\n00 10",
"output": "8"
},
{
"input": "2\n03 00",
"output": "271"
},
{
"input": "4\n19 04",
"output": "17"
},
{
"input": "25\n00 23",
"output": "16"
},
{
"input": "10\n01 01",
"output": "43"
}
] | 1,624,329,125
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 254
| 77
| 0
|
n=int(input())
h,m=map(int,input().split())
c=h*60+m
ans=0
while "7" not in str(c//60)+str(c%60):
c-=n
ans+=1
if c==0:
c=1440
print(ans)
|
Title: Jamie and Alarm Snooze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jamie loves sleeping. One day, he decides that he needs to wake up at exactly *hh*:<=*mm*. However, he hates waking up, so he wants to make waking up less painful by setting the alarm at a lucky time. He will then press the snooze button every *x* minutes until *hh*:<=*mm* is reached, and only then he will wake up. He wants to know what is the smallest number of times he needs to press the snooze button.
A time is considered lucky if it contains a digit '7'. For example, 13:<=07 and 17:<=27 are lucky, while 00:<=48 and 21:<=34 are not lucky.
Note that it is not necessary that the time set for the alarm and the wake-up time are on the same day. It is guaranteed that there is a lucky time Jamie can set so that he can wake at *hh*:<=*mm*.
Formally, find the smallest possible non-negative integer *y* such that the time representation of the time *x*·*y* minutes before *hh*:<=*mm* contains the digit '7'.
Jamie uses 24-hours clock, so after 23:<=59 comes 00:<=00.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=60).
The second line contains two two-digit integers, *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59).
Output Specification:
Print the minimum number of times he needs to press the button.
Demo Input:
['3\n11 23\n', '5\n01 07\n']
Demo Output:
['2\n', '0\n']
Note:
In the first sample, Jamie needs to wake up at 11:23. So, he can set his alarm at 11:17. He would press the snooze button when the alarm rings at 11:17 and at 11:20.
In the second sample, Jamie can set his alarm at exactly at 01:07 which is lucky.
|
```python
n=int(input())
h,m=map(int,input().split())
c=h*60+m
ans=0
while "7" not in str(c//60)+str(c%60):
c-=n
ans+=1
if c==0:
c=1440
print(ans)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,653,406,979
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
basic = input()
upper = []
lower = []
for item in basic:
if (item.isupper() == True ):
upper.append(item)
elif (item.islower() == True ):
lower.append(item)
if len(upper) <= len(lower) :
print(basic.lower())
elif len(upper) > len(lower) :
print(basic.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
basic = input()
upper = []
lower = []
for item in basic:
if (item.isupper() == True ):
upper.append(item)
elif (item.islower() == True ):
lower.append(item)
if len(upper) <= len(lower) :
print(basic.lower())
elif len(upper) > len(lower) :
print(basic.upper())
```
| 3.977
|
735
|
D
|
Taxes
|
PROGRAMMING
| 1,600
|
[
"math",
"number theory"
] | null | null |
Mr. Funt now lives in a country with a very specific tax laws. The total income of mr. Funt during this year is equal to *n* (*n*<=≥<=2) burles and the amount of tax he has to pay is calculated as the maximum divisor of *n* (not equal to *n*, of course). For example, if *n*<==<=6 then Funt has to pay 3 burles, while for *n*<==<=25 he needs to pay 5 and if *n*<==<=2 he pays only 1 burle.
As mr. Funt is a very opportunistic person he wants to cheat a bit. In particular, he wants to split the initial *n* in several parts *n*1<=+<=*n*2<=+<=...<=+<=*n**k*<==<=*n* (here *k* is arbitrary, even *k*<==<=1 is allowed) and pay the taxes for each part separately. He can't make some part equal to 1 because it will reveal him. So, the condition *n**i*<=≥<=2 should hold for all *i* from 1 to *k*.
Ostap Bender wonders, how many money Funt has to pay (i.e. minimal) if he chooses and optimal way to split *n* in parts.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=2·109) — the total year income of mr. Funt.
|
Print one integer — minimum possible number of burles that mr. Funt has to pay as a tax.
|
[
"4\n",
"27\n"
] |
[
"2\n",
"3\n"
] |
none
| 1,750
|
[
{
"input": "4",
"output": "2"
},
{
"input": "27",
"output": "3"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "1"
},
{
"input": "10",
"output": "2"
},
{
"input": "2000000000",
"output": "2"
},
{
"input": "26",
"output": "2"
},
{
"input": "7",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "11",
"output": "1"
},
{
"input": "1000000007",
"output": "1"
},
{
"input": "1000000009",
"output": "1"
},
{
"input": "1999999999",
"output": "3"
},
{
"input": "1000000011",
"output": "2"
},
{
"input": "101",
"output": "1"
},
{
"input": "103",
"output": "1"
},
{
"input": "1001",
"output": "3"
},
{
"input": "1003",
"output": "3"
},
{
"input": "10001",
"output": "3"
},
{
"input": "10003",
"output": "3"
},
{
"input": "129401294",
"output": "2"
},
{
"input": "234911024",
"output": "2"
},
{
"input": "192483501",
"output": "3"
},
{
"input": "1234567890",
"output": "2"
},
{
"input": "719241201",
"output": "3"
},
{
"input": "9",
"output": "2"
},
{
"input": "33",
"output": "2"
},
{
"input": "25",
"output": "2"
},
{
"input": "15",
"output": "2"
},
{
"input": "147",
"output": "3"
},
{
"input": "60119912",
"output": "2"
},
{
"input": "45",
"output": "2"
},
{
"input": "21",
"output": "2"
},
{
"input": "9975",
"output": "2"
},
{
"input": "17",
"output": "1"
},
{
"input": "99",
"output": "2"
},
{
"input": "49",
"output": "2"
},
{
"input": "243",
"output": "2"
},
{
"input": "43",
"output": "1"
},
{
"input": "39",
"output": "2"
},
{
"input": "6",
"output": "2"
},
{
"input": "8",
"output": "2"
},
{
"input": "12",
"output": "2"
},
{
"input": "13",
"output": "1"
},
{
"input": "14",
"output": "2"
},
{
"input": "16",
"output": "2"
},
{
"input": "18",
"output": "2"
},
{
"input": "19",
"output": "1"
},
{
"input": "20",
"output": "2"
},
{
"input": "22",
"output": "2"
},
{
"input": "23",
"output": "1"
},
{
"input": "24",
"output": "2"
},
{
"input": "962",
"output": "2"
},
{
"input": "29",
"output": "1"
},
{
"input": "55",
"output": "2"
},
{
"input": "125",
"output": "3"
},
{
"input": "1999999929",
"output": "2"
},
{
"input": "493",
"output": "2"
},
{
"input": "10000021",
"output": "2"
},
{
"input": "541",
"output": "1"
},
{
"input": "187",
"output": "3"
},
{
"input": "95",
"output": "3"
},
{
"input": "999991817",
"output": "3"
},
{
"input": "37998938",
"output": "2"
},
{
"input": "1847133842",
"output": "2"
},
{
"input": "1000000005",
"output": "3"
},
{
"input": "19828",
"output": "2"
},
{
"input": "998321704",
"output": "2"
},
{
"input": "370359",
"output": "3"
},
{
"input": "115",
"output": "2"
},
{
"input": "200000015",
"output": "3"
},
{
"input": "479001600",
"output": "2"
},
{
"input": "536870912",
"output": "2"
},
{
"input": "10759922",
"output": "2"
},
{
"input": "1999999927",
"output": "1"
},
{
"input": "123",
"output": "3"
},
{
"input": "200743933",
"output": "3"
},
{
"input": "949575615",
"output": "3"
},
{
"input": "99990001",
"output": "1"
},
{
"input": "715827883",
"output": "1"
},
{
"input": "5592406",
"output": "2"
},
{
"input": "8388609",
"output": "3"
},
{
"input": "1908903481",
"output": "3"
},
{
"input": "1076153021",
"output": "3"
},
{
"input": "344472101",
"output": "3"
}
] | 1,565,522,896
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 85
| 140
| 1,228,800
|
n = int(input())
def isPrime(n):
if (n==0 or n==1):
return False
i = 2
while (i*i<=n):
if (n%i==0):
return False
i += 1
return True
if (n%2==0):
if (n==2):
print(1)
else:
print(2)
else:
if (isPrime(n)):
print(1)
elif (isPrime(n-2)):
print(2)
else:
print(3)
|
Title: Taxes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Funt now lives in a country with a very specific tax laws. The total income of mr. Funt during this year is equal to *n* (*n*<=≥<=2) burles and the amount of tax he has to pay is calculated as the maximum divisor of *n* (not equal to *n*, of course). For example, if *n*<==<=6 then Funt has to pay 3 burles, while for *n*<==<=25 he needs to pay 5 and if *n*<==<=2 he pays only 1 burle.
As mr. Funt is a very opportunistic person he wants to cheat a bit. In particular, he wants to split the initial *n* in several parts *n*1<=+<=*n*2<=+<=...<=+<=*n**k*<==<=*n* (here *k* is arbitrary, even *k*<==<=1 is allowed) and pay the taxes for each part separately. He can't make some part equal to 1 because it will reveal him. So, the condition *n**i*<=≥<=2 should hold for all *i* from 1 to *k*.
Ostap Bender wonders, how many money Funt has to pay (i.e. minimal) if he chooses and optimal way to split *n* in parts.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=2·109) — the total year income of mr. Funt.
Output Specification:
Print one integer — minimum possible number of burles that mr. Funt has to pay as a tax.
Demo Input:
['4\n', '27\n']
Demo Output:
['2\n', '3\n']
Note:
none
|
```python
n = int(input())
def isPrime(n):
if (n==0 or n==1):
return False
i = 2
while (i*i<=n):
if (n%i==0):
return False
i += 1
return True
if (n%2==0):
if (n==2):
print(1)
else:
print(2)
else:
if (isPrime(n)):
print(1)
elif (isPrime(n-2)):
print(2)
else:
print(3)
```
| 3
|
|
205
|
A
|
Little Elephant and Rozdil
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
|
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
|
[
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] |
[
"2\n",
"Still Rozdil\n"
] |
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
| 500
|
[
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,665,632,560
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 154
| 8,396,800
|
n = int(input())
l = list(map(int, input().split()))
m = min(l)
if l.count(m) > 1:
print("Still Rozdil" )
else:
print((l.index(m) + 1))
|
Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
|
```python
n = int(input())
l = list(map(int, input().split()))
m = min(l)
if l.count(m) > 1:
print("Still Rozdil" )
else:
print((l.index(m) + 1))
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,671,302,035
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
x=str(input())
y=str(input())
x_rev=x[::-1]
if x_rev==y:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
x=str(input())
y=str(input())
x_rev=x[::-1]
if x_rev==y:
print("YES")
else:
print("NO")
```
| 3.977
|
136
|
A
|
Presents
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
|
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
|
[
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] |
[
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,683,881,748
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 101
| 92
| 0
|
a = eval(input())
s = (input())
s = s.split()
arr = [0] * a
for i in range(a):
b = int(s[i])
arr[b-1] = int(i+1)
res = ' '.join([str(elem) for elem in arr])
print(res)
|
Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none
|
```python
a = eval(input())
s = (input())
s = s.split()
arr = [0] * a
for i in range(a):
b = int(s[i])
arr[b-1] = int(i+1)
res = ' '.join([str(elem) for elem in arr])
print(res)
```
| 3
|
|
918
|
A
|
Eleven
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
|
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
Print Eleven's new name on the first and only line of output.
|
[
"8\n",
"15\n"
] |
[
"OOOoOooO\n",
"OOOoOooOooooOoo\n"
] |
none
| 500
|
[
{
"input": "8",
"output": "OOOoOooO"
},
{
"input": "15",
"output": "OOOoOooOooooOoo"
},
{
"input": "85",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooo"
},
{
"input": "381",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooo"
},
{
"input": "805",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1000",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1",
"output": "O"
},
{
"input": "2",
"output": "OO"
},
{
"input": "3",
"output": "OOO"
},
{
"input": "5",
"output": "OOOoO"
},
{
"input": "17",
"output": "OOOoOooOooooOoooo"
},
{
"input": "49",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooo"
},
{
"input": "256",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooo"
},
{
"input": "512",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "933",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "61",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooo"
},
{
"input": "781",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "999",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
}
] | 1,530,184,455
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 93
| 0
|
n=int(input())
def f(n):
if n==1 or n==2:
return 1
return f(n-1)+f(n-2)
i=2
p=[]
while f(i)<=n:
p.append(f(i))
i+=1
x=''
for i in range(n):
if i+1 in p:
x+='O'
else:
x+='o'
print(x)
|
Title: Eleven
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
Input Specification:
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
Print Eleven's new name on the first and only line of output.
Demo Input:
['8\n', '15\n']
Demo Output:
['OOOoOooO\n', 'OOOoOooOooooOoo\n']
Note:
none
|
```python
n=int(input())
def f(n):
if n==1 or n==2:
return 1
return f(n-1)+f(n-2)
i=2
p=[]
while f(i)<=n:
p.append(f(i))
i+=1
x=''
for i in range(n):
if i+1 in p:
x+='O'
else:
x+='o'
print(x)
```
| 3
|
|
92
|
A
|
Chips
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] |
A. Chips
|
2
|
256
|
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
|
Print the number of chips the presenter ended up with.
|
[
"4 11\n",
"17 107\n",
"3 8\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
| 500
|
[
{
"input": "4 11",
"output": "0"
},
{
"input": "17 107",
"output": "2"
},
{
"input": "3 8",
"output": "1"
},
{
"input": "46 7262",
"output": "35"
},
{
"input": "32 6864",
"output": "0"
},
{
"input": "36 6218",
"output": "14"
},
{
"input": "25 9712",
"output": "11"
},
{
"input": "9 7601",
"output": "5"
},
{
"input": "1 9058",
"output": "0"
},
{
"input": "29 7772",
"output": "26"
},
{
"input": "45 9465",
"output": "14"
},
{
"input": "46 866",
"output": "5"
},
{
"input": "29 1241",
"output": "20"
},
{
"input": "17 4248",
"output": "12"
},
{
"input": "20 8082",
"output": "11"
},
{
"input": "50 9555",
"output": "0"
},
{
"input": "4 7455",
"output": "2"
},
{
"input": "36 880",
"output": "4"
},
{
"input": "24 7440",
"output": "9"
},
{
"input": "44 7888",
"output": "12"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "50 10000",
"output": "40"
},
{
"input": "1 10000",
"output": "0"
},
{
"input": "50 1",
"output": "0"
},
{
"input": "50 50",
"output": "5"
}
] | 1,634,201,527
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
n,m = map(int,input().split())
m%=(n*(n+1)/2)
for i in range(1,n):
if m<i:
break
m-=i
print(int(m))
|
Title: Chips
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
Output Specification:
Print the number of chips the presenter ended up with.
Demo Input:
['4 11\n', '17 107\n', '3 8\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
|
```python
n,m = map(int,input().split())
m%=(n*(n+1)/2)
for i in range(1,n):
if m<i:
break
m-=i
print(int(m))
```
| 3.977
|
999
|
A
|
Mishka and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
|
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
|
Print one integer — the maximum number of problems Mishka can solve.
|
[
"8 4\n4 2 3 1 5 1 6 4\n",
"5 2\n3 1 2 1 3\n",
"5 100\n12 34 55 43 21\n"
] |
[
"5\n",
"0\n",
"5\n"
] |
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
| 0
|
[
{
"input": "8 4\n4 2 3 1 5 1 6 4",
"output": "5"
},
{
"input": "5 2\n3 1 2 1 3",
"output": "0"
},
{
"input": "5 100\n12 34 55 43 21",
"output": "5"
},
{
"input": "100 100\n44 47 36 83 76 94 86 69 31 2 22 77 37 51 10 19 25 78 53 25 1 29 48 95 35 53 22 72 49 86 60 38 13 91 89 18 54 19 71 2 25 33 65 49 53 5 95 90 100 68 25 5 87 48 45 72 34 14 100 44 94 75 80 26 25 7 57 82 49 73 55 43 42 60 34 8 51 11 71 41 81 23 20 89 12 72 68 26 96 92 32 63 13 47 19 9 35 56 79 62",
"output": "100"
},
{
"input": "100 99\n84 82 43 4 71 3 30 92 15 47 76 43 2 17 76 4 1 33 24 96 44 98 75 99 59 11 73 27 67 17 8 88 69 41 44 22 91 48 4 46 42 21 21 67 85 51 57 84 11 100 100 59 39 72 89 82 74 19 98 14 37 97 20 78 38 52 44 83 19 83 69 32 56 6 93 13 98 80 80 2 33 71 11 15 55 51 98 58 16 91 39 32 83 58 77 79 88 81 17 98",
"output": "98"
},
{
"input": "100 69\n80 31 12 89 16 35 8 28 39 12 32 51 42 67 64 53 17 88 63 97 29 41 57 28 51 33 82 75 93 79 57 86 32 100 83 82 99 33 1 27 86 22 65 15 60 100 42 37 38 85 26 43 90 62 91 13 1 92 16 20 100 19 28 30 23 6 5 69 24 22 9 1 10 14 28 14 25 9 32 8 67 4 39 7 10 57 15 7 8 35 62 6 53 59 62 13 24 7 53 2",
"output": "39"
},
{
"input": "100 2\n2 2 2 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 2 1 1 1 2 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 16",
"output": "99"
},
{
"input": "100 3\n86 53 82 40 2 20 59 2 46 63 75 49 24 81 70 22 9 9 93 72 47 23 29 77 78 51 17 59 19 71 35 3 20 60 70 9 11 96 71 94 91 19 88 93 50 49 72 19 53 30 38 67 62 71 81 86 5 26 5 32 63 98 1 97 22 32 87 65 96 55 43 85 56 37 56 67 12 100 98 58 77 54 18 20 33 53 21 66 24 64 42 71 59 32 51 69 49 79 10 1",
"output": "1"
},
{
"input": "13 7\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "1 5\n4",
"output": "1"
},
{
"input": "3 2\n1 4 1",
"output": "2"
},
{
"input": "1 2\n100",
"output": "0"
},
{
"input": "7 4\n4 2 3 4 4 2 3",
"output": "7"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "1 2\n15",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "5 3\n3 4 3 2 1",
"output": "4"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "1 5\n1",
"output": "1"
},
{
"input": "6 6\n7 1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n6 5 5 5 5",
"output": "4"
},
{
"input": "1 4\n2",
"output": "1"
},
{
"input": "9 4\n1 2 1 2 4 2 1 2 1",
"output": "9"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n5",
"output": "1"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "100 10\n2 5 1 10 10 2 7 7 9 4 1 8 1 1 8 4 7 9 10 5 7 9 5 6 7 2 7 5 3 2 1 82 4 80 9 8 6 1 10 7 5 7 1 5 6 7 19 4 2 4 6 2 1 8 31 6 2 2 57 42 3 2 7 1 9 5 10 8 5 4 10 8 3 5 8 7 2 7 6 5 3 3 4 10 6 7 10 8 7 10 7 2 4 6 8 10 10 2 6 4",
"output": "71"
},
{
"input": "100 90\n17 16 5 51 17 62 24 45 49 41 90 30 19 78 67 66 59 34 28 47 42 8 33 77 90 41 61 16 86 33 43 71 90 95 23 9 56 41 24 90 31 12 77 36 90 67 47 15 92 50 79 88 42 19 21 79 86 60 41 26 47 4 70 62 44 90 82 89 84 91 54 16 90 53 29 69 21 44 18 28 88 74 56 43 12 76 10 22 34 24 27 52 28 76 90 75 5 29 50 90",
"output": "63"
},
{
"input": "100 10\n6 4 8 4 1 9 4 8 5 2 2 5 2 6 10 2 2 5 3 5 2 3 10 5 2 9 1 1 6 1 5 9 16 42 33 49 26 31 81 27 53 63 81 90 55 97 70 51 87 21 79 62 60 91 54 95 26 26 30 61 87 79 47 11 59 34 40 82 37 40 81 2 7 1 8 4 10 7 1 10 8 7 3 5 2 8 3 3 9 2 1 1 5 7 8 7 1 10 9 8",
"output": "61"
},
{
"input": "100 90\n45 57 52 69 17 81 85 60 59 39 55 14 87 90 90 31 41 57 35 89 74 20 53 4 33 49 71 11 46 90 71 41 71 90 63 74 51 13 99 92 99 91 100 97 93 40 93 96 100 99 100 92 98 96 78 91 91 91 91 100 94 97 95 97 96 95 17 13 45 35 54 26 2 74 6 51 20 3 73 90 90 42 66 43 86 28 84 70 37 27 90 30 55 80 6 58 57 51 10 22",
"output": "72"
},
{
"input": "100 10\n10 2 10 10 10 10 10 10 10 7 10 10 10 10 10 10 9 10 10 10 10 10 10 10 10 7 9 10 10 10 37 10 4 10 10 10 59 5 95 10 10 10 10 39 10 10 10 10 10 10 10 5 10 10 10 10 10 10 10 10 10 10 10 10 66 10 10 10 10 10 5 10 10 10 10 10 10 44 10 10 10 10 10 10 10 10 10 10 10 7 10 10 10 10 10 10 10 10 10 2",
"output": "52"
},
{
"input": "100 90\n57 90 90 90 90 90 90 90 81 90 3 90 39 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 92 90 90 90 90 90 90 90 90 98 90 90 90 90 90 90 90 90 90 90 90 90 90 54 90 90 90 90 90 62 90 90 91 90 90 90 90 90 90 91 90 90 90 90 90 90 90 3 90 90 90 90 90 90 90 2 90 90 90 90 90 90 90 90 90 2 90 90 90 90 90",
"output": "60"
},
{
"input": "100 10\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 78 90 61 40 87 39 91 50 64 30 10 24 10 55 28 11 28 35 26 26 10 57 45 67 14 99 96 51 67 79 59 11 21 55 70 33 10 16 92 70 38 50 66 52 5 10 10 10 2 4 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 10 10 10 10 8 10 10 10 10 10",
"output": "56"
},
{
"input": "100 90\n90 90 90 90 90 90 55 21 90 90 90 90 90 90 90 90 90 90 69 83 90 90 90 90 90 90 90 90 93 95 92 98 92 97 91 92 92 91 91 95 94 95 100 100 96 97 94 93 90 90 95 95 97 99 90 95 98 91 94 96 99 99 94 95 95 97 99 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 12 90 3 90 90 90 90 90 90 90",
"output": "61"
},
{
"input": "100 49\n71 25 14 36 36 48 36 49 28 40 49 49 49 38 40 49 33 22 49 49 14 46 8 44 49 11 37 49 40 49 2 49 3 49 37 49 49 11 25 49 49 32 49 11 49 30 16 21 49 49 23 24 30 49 49 49 49 49 49 27 49 42 49 49 20 32 30 29 35 49 30 49 9 49 27 25 5 49 49 42 49 20 49 35 49 22 15 49 49 49 19 49 29 28 13 49 22 7 6 24",
"output": "99"
},
{
"input": "100 50\n38 68 9 6 50 18 19 50 50 20 33 34 43 50 24 50 50 2 50 50 50 50 50 21 30 50 41 40 50 50 50 50 50 7 50 21 19 23 1 50 24 50 50 50 25 50 50 50 50 50 50 50 7 24 28 18 50 5 43 50 20 50 13 50 50 16 50 3 2 24 50 50 18 5 50 4 50 50 38 50 33 49 12 33 11 14 50 50 50 33 50 50 50 50 50 50 7 4 50 50",
"output": "99"
},
{
"input": "100 48\n8 6 23 47 29 48 48 48 48 48 48 26 24 48 48 48 3 48 27 28 41 45 9 29 48 48 48 48 48 48 48 48 48 48 47 23 48 48 48 5 48 22 40 48 48 48 20 48 48 57 48 32 19 48 33 2 4 19 48 48 39 48 16 48 48 44 48 48 48 48 29 14 25 43 46 7 48 19 30 48 18 8 39 48 30 47 35 18 48 45 48 48 30 13 48 48 48 17 9 48",
"output": "99"
},
{
"input": "100 57\n57 9 57 4 43 57 57 57 57 26 57 18 57 57 57 57 57 57 57 47 33 57 57 43 57 57 55 57 14 57 57 4 1 57 57 57 57 57 46 26 57 57 57 57 57 57 57 39 57 57 57 5 57 12 11 57 57 57 25 37 34 57 54 18 29 57 39 57 5 57 56 34 57 24 7 57 57 57 2 57 57 57 57 1 55 39 19 57 57 57 57 21 3 40 13 3 57 57 62 57",
"output": "99"
},
{
"input": "100 51\n51 51 38 51 51 45 51 51 51 18 51 36 51 19 51 26 37 51 11 51 45 34 51 21 51 51 33 51 6 51 51 51 21 47 51 13 51 51 30 29 50 51 51 51 51 51 51 45 14 51 2 51 51 23 9 51 50 23 51 29 34 51 40 32 1 36 31 51 11 51 51 47 51 51 51 51 51 51 51 50 39 51 14 4 4 12 3 11 51 51 51 51 41 51 51 51 49 37 5 93",
"output": "99"
},
{
"input": "100 50\n87 91 95 73 50 50 16 97 39 24 58 50 33 89 42 37 50 50 12 71 3 55 50 50 80 10 76 50 52 36 88 44 66 69 86 71 77 50 72 50 21 55 50 50 78 61 75 89 65 2 50 69 62 47 11 92 97 77 41 31 55 29 35 51 36 48 50 91 92 86 50 36 50 94 51 74 4 27 55 63 50 36 87 50 67 7 65 75 20 96 88 50 41 73 35 51 66 21 29 33",
"output": "3"
},
{
"input": "100 50\n50 37 28 92 7 76 50 50 50 76 100 57 50 50 50 32 76 50 8 72 14 8 50 91 67 50 55 82 50 50 24 97 88 50 59 61 68 86 44 15 61 67 88 50 40 50 36 99 1 23 63 50 88 59 76 82 99 76 68 50 50 30 31 68 57 98 71 12 15 60 35 79 90 6 67 50 50 50 50 68 13 6 50 50 16 87 84 50 67 67 50 64 50 58 50 50 77 51 50 51",
"output": "3"
},
{
"input": "100 50\n43 50 50 91 97 67 6 50 86 50 76 60 50 59 4 56 11 38 49 50 37 50 50 20 60 47 33 54 95 58 22 50 77 77 72 9 57 40 81 57 95 50 81 63 62 76 13 87 50 39 74 69 50 99 63 1 11 62 84 31 97 99 56 73 70 36 45 100 28 91 93 9 19 52 73 50 83 58 84 52 86 12 50 44 64 52 97 50 12 71 97 52 87 66 83 66 86 50 9 49",
"output": "6"
},
{
"input": "88 10\n10 8 1 10 10 1 3 7 10 5 8 8 10 2 7 10 10 10 10 10 1 10 10 10 10 1 2 9 10 9 10 10 10 64 100 25 10 12 9 52 13 8 10 56 10 4 10 7 10 3 10 79 74 8 73 10 10 10 9 10 3 5 10 10 10 5 1 10 10 4 3 10 10 10 4 10 6 4 10 10 10 10 3 3 8 5 6 8",
"output": "66"
},
{
"input": "100 50\n80 39 33 69 75 50 23 88 50 50 67 90 87 50 29 15 55 32 60 50 50 50 38 95 62 50 50 88 8 97 45 50 42 12 22 93 49 50 24 50 50 71 60 4 50 72 57 57 50 50 50 83 69 17 1 31 72 55 50 11 50 80 93 41 91 94 20 60 50 50 51 48 53 56 76 73 50 72 19 98 50 50 50 50 50 28 48 45 62 11 16 67 93 88 63 50 50 66 48 95",
"output": "0"
},
{
"input": "100 50\n70 50 38 50 38 50 32 30 50 31 26 42 50 33 34 50 50 50 28 21 50 44 50 47 50 50 9 40 50 50 50 50 50 42 50 50 16 50 50 3 24 50 50 50 4 26 50 2 50 50 33 1 27 50 50 50 8 29 50 23 33 50 6 29 50 50 15 50 50 50 32 50 43 50 50 50 31 50 4 50 50 31 50 50 31 16 50 17 50 17 31 13 25 16 50 10 50 47 50 66",
"output": "0"
},
{
"input": "2 8\n8 8",
"output": "2"
},
{
"input": "1 6\n3",
"output": "1"
},
{
"input": "1 5\n5",
"output": "1"
}
] | 1,677,656,767
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 48
| 77
| 0
|
n, k = map(int, input().split())
a = list(map(int, input().split()))
res = 0
for _ in range(n):
if a[0] <= k:
a = a[1:]
res += 1
elif a[-1] <= k:
a = a[:-1]
res += 1
print(res)
|
Title: Mishka and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
Output Specification:
Print one integer — the maximum number of problems Mishka can solve.
Demo Input:
['8 4\n4 2 3 1 5 1 6 4\n', '5 2\n3 1 2 1 3\n', '5 100\n12 34 55 43 21\n']
Demo Output:
['5\n', '0\n', '5\n']
Note:
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
|
```python
n, k = map(int, input().split())
a = list(map(int, input().split()))
res = 0
for _ in range(n):
if a[0] <= k:
a = a[1:]
res += 1
elif a[-1] <= k:
a = a[:-1]
res += 1
print(res)
```
| 3
|
|
178
|
A1
|
Educational Game
|
PROGRAMMING
| 1,000
|
[] | null | null |
The Smart Beaver from ABBYY began to develop a new educational game for children. The rules of the game are fairly simple and are described below.
The playing field is a sequence of *n* non-negative integers *a**i* numbered from 1 to *n*. The goal of the game is to make numbers *a*1,<=*a*2,<=...,<=*a**k* (i.e. some prefix of the sequence) equal to zero for some fixed *k* (*k*<=<<=*n*), and this should be done in the smallest possible number of moves.
One move is choosing an integer *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=><=0 and an integer *t* (*t*<=≥<=0) such that *i*<=+<=2*t*<=≤<=*n*. After the values of *i* and *t* have been selected, the value of *a**i* is decreased by 1, and the value of *a**i*<=+<=2*t* is increased by 1. For example, let *n*<==<=4 and *a*<==<=(1,<=0,<=1,<=2), then it is possible to make move *i*<==<=3, *t*<==<=0 and get *a*<==<=(1,<=0,<=0,<=3) or to make move *i*<==<=1, *t*<==<=1 and get *a*<==<=(0,<=0,<=2,<=2) (the only possible other move is *i*<==<=1, *t*<==<=0).
You are given *n* and the initial sequence *a**i*. The task is to calculate the minimum number of moves needed to make the first *k* elements of the original sequence equal to zero for each possible *k* (1<=≤<=*k*<=<<=*n*).
|
The first input line contains a single integer *n*. The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=104), separated by single spaces.
The input limitations for getting 20 points are:
- 1<=≤<=*n*<=≤<=300
The input limitations for getting 50 points are:
- 1<=≤<=*n*<=≤<=2000
The input limitations for getting 100 points are:
- 1<=≤<=*n*<=≤<=105
|
Print exactly *n*<=-<=1 lines: the *k*-th output line must contain the minimum number of moves needed to make the first *k* elements of the original sequence *a**i* equal to zero.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams, or the %I64d specifier.
|
[
"4\n1 0 1 2\n",
"8\n1 2 3 4 5 6 7 8\n"
] |
[
"1\n1\n3\n",
"1\n3\n6\n10\n16\n24\n40\n"
] |
none
| 20
|
[
{
"input": "4\n1 0 1 2",
"output": "1\n1\n3"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1\n3\n6\n10\n16\n24\n40"
},
{
"input": "5\n4 1 4 7 6",
"output": "4\n5\n9\n17"
},
{
"input": "9\n13 13 7 11 3 9 3 5 5",
"output": "13\n26\n33\n44\n47\n69\n79\n117"
},
{
"input": "30\n8 17 20 15 18 15 20 10 5 13 5 4 15 9 11 14 18 15 7 16 18 9 17 7 10 9 5 13 17 16",
"output": "8\n25\n45\n60\n78\n93\n113\n123\n128\n141\n146\n150\n165\n174\n185\n199\n225\n257\n284\n315\n351\n375\n423\n454\n495\n549\n634\n713\n907"
},
{
"input": "80\n72 66 82 46 44 22 63 92 71 65 5 30 45 84 29 73 9 90 25 19 26 15 12 29 33 19 85 92 91 66 83 39 100 53 20 99 11 81 26 41 36 51 21 72 28 100 34 3 24 58 11 85 73 18 4 45 90 99 42 85 26 71 58 49 76 32 88 13 40 98 57 95 20 36 70 66 75 12 54 96",
"output": "72\n138\n220\n266\n310\n332\n395\n487\n558\n623\n628\n658\n703\n787\n816\n889\n898\n988\n1013\n1032\n1058\n1073\n1085\n1114\n1147\n1166\n1251\n1343\n1434\n1500\n1583\n1622\n1722\n1775\n1795\n1894\n1905\n1986\n2012\n2053\n2089\n2140\n2161\n2233\n2261\n2361\n2395\n2398\n2431\n2579\n2615\n2719\n2818\n2851\n2867\n2941\n3064\n3182\n3309\n3486\n3603\n3740\n3881\n3969\n4250\n4549\n4775\n5037\n5231\n5465\n5627\n5929\n6460\n7029\n7478\n8085\n9075\n10211\n12070"
},
{
"input": "120\n242 524 420 973 816 432 247 666 134 849 145 366 608 930 613 315 863 628 97 109 65 704 741 314 736 17 872 971 559 648 223 771 171 327 782 837 303 393 292 339 730 834 794 868 540 251 789 893 23 305 116 220 699 863 580 992 861 393 98 253 544 171 336 207 348 496 316 285 286 727 613 616 304 811 592 916 91 554 962 950 475 473 806 510 986 254 290 351 143 710 573 949 256 216 235 246 533 177 12 764 543 689 490 386 849 694 386 693 134 416 293 589 171 76 527 324 782 661 943 134",
"output": "242\n766\n1186\n2159\n2975\n3407\n3654\n4320\n4454\n5303\n5448\n5814\n6422\n7352\n7965\n8280\n9143\n9771\n9868\n9977\n10042\n10746\n11487\n11801\n12537\n12554\n13426\n14397\n14956\n15604\n15827\n16598\n16769\n17096\n17878\n18715\n19018\n19411\n19703\n20042\n20772\n21606\n22400\n23268\n23808\n24059\n24848\n25741\n25764\n26069\n26185\n26405\n27104\n27967\n28547\n29539\n30400\n30793\n30891\n31144\n31688\n31859\n32195\n32402\n32992\n34012\n34748\n36006\n37108\n38267\n39127\n40409\n40847\n42507\n43244\n44526\n4..."
}
] | 1,691,996,717
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS1
| 12
| 122
| 1,536,000
|
def find(a):
n=0
while pow(2,n)<=a:
n+=1
return pow(2,n-1)
m = int(input())
l = [int(x) for x in input().split()]
ans=0
n=0
c=0
for i in range(m):
ans+=l[i]
if c<m-1:
c+=1
print(ans)
n=int(find(m-(i+1)))
l[i+n]+=l[i]
|
Title: Educational Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Smart Beaver from ABBYY began to develop a new educational game for children. The rules of the game are fairly simple and are described below.
The playing field is a sequence of *n* non-negative integers *a**i* numbered from 1 to *n*. The goal of the game is to make numbers *a*1,<=*a*2,<=...,<=*a**k* (i.e. some prefix of the sequence) equal to zero for some fixed *k* (*k*<=<<=*n*), and this should be done in the smallest possible number of moves.
One move is choosing an integer *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=><=0 and an integer *t* (*t*<=≥<=0) such that *i*<=+<=2*t*<=≤<=*n*. After the values of *i* and *t* have been selected, the value of *a**i* is decreased by 1, and the value of *a**i*<=+<=2*t* is increased by 1. For example, let *n*<==<=4 and *a*<==<=(1,<=0,<=1,<=2), then it is possible to make move *i*<==<=3, *t*<==<=0 and get *a*<==<=(1,<=0,<=0,<=3) or to make move *i*<==<=1, *t*<==<=1 and get *a*<==<=(0,<=0,<=2,<=2) (the only possible other move is *i*<==<=1, *t*<==<=0).
You are given *n* and the initial sequence *a**i*. The task is to calculate the minimum number of moves needed to make the first *k* elements of the original sequence equal to zero for each possible *k* (1<=≤<=*k*<=<<=*n*).
Input Specification:
The first input line contains a single integer *n*. The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=104), separated by single spaces.
The input limitations for getting 20 points are:
- 1<=≤<=*n*<=≤<=300
The input limitations for getting 50 points are:
- 1<=≤<=*n*<=≤<=2000
The input limitations for getting 100 points are:
- 1<=≤<=*n*<=≤<=105
Output Specification:
Print exactly *n*<=-<=1 lines: the *k*-th output line must contain the minimum number of moves needed to make the first *k* elements of the original sequence *a**i* equal to zero.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams, or the %I64d specifier.
Demo Input:
['4\n1 0 1 2\n', '8\n1 2 3 4 5 6 7 8\n']
Demo Output:
['1\n1\n3\n', '1\n3\n6\n10\n16\n24\n40\n']
Note:
none
|
```python
def find(a):
n=0
while pow(2,n)<=a:
n+=1
return pow(2,n-1)
m = int(input())
l = [int(x) for x in input().split()]
ans=0
n=0
c=0
for i in range(m):
ans+=l[i]
if c<m-1:
c+=1
print(ans)
n=int(find(m-(i+1)))
l[i+n]+=l[i]
```
| 3
|
|
734
|
A
|
Anton and Danik
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
|
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
|
[
"6\nADAAAA\n",
"7\nDDDAADA\n",
"6\nDADADA\n"
] |
[
"Anton\n",
"Danik\n",
"Friendship\n"
] |
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
| 500
|
[
{
"input": "6\nADAAAA",
"output": "Anton"
},
{
"input": "7\nDDDAADA",
"output": "Danik"
},
{
"input": "6\nDADADA",
"output": "Friendship"
},
{
"input": "10\nDDDDADDADD",
"output": "Danik"
},
{
"input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA",
"output": "Anton"
},
{
"input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD",
"output": "Friendship"
},
{
"input": "1\nA",
"output": "Anton"
},
{
"input": "1\nD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "4\nDADA",
"output": "Friendship"
},
{
"input": "4\nDAAD",
"output": "Friendship"
},
{
"input": "3\nADD",
"output": "Danik"
},
{
"input": "3\nDAD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA",
"output": "Anton"
}
] | 1,698,996,040
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 25
| 46
| 0
|
n = int(input())
s = str(input())
k1 = s.count("A")
k2 = s.count("D")
if k1 > k2:
print("Anton")
elif k1 < k2:
print("Danik")
else:
print("Friendship")
|
Title: Anton and Danik
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
Output Specification:
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
Demo Input:
['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n']
Demo Output:
['Anton\n', 'Danik\n', 'Friendship\n']
Note:
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
|
```python
n = int(input())
s = str(input())
k1 = s.count("A")
k2 = s.count("D")
if k1 > k2:
print("Anton")
elif k1 < k2:
print("Danik")
else:
print("Friendship")
```
| 3
|
|
472
|
A
|
Design Tutorial: Learn from Math
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
|
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
|
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
|
[
"12\n",
"15\n",
"23\n",
"1000000\n"
] |
[
"4 8\n",
"6 9\n",
"8 15\n",
"500000 500000\n"
] |
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
| 500
|
[
{
"input": "12",
"output": "4 8"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "23",
"output": "8 15"
},
{
"input": "1000000",
"output": "500000 500000"
},
{
"input": "63874",
"output": "4 63870"
},
{
"input": "14568",
"output": "4 14564"
},
{
"input": "192",
"output": "4 188"
},
{
"input": "86",
"output": "4 82"
},
{
"input": "46220",
"output": "4 46216"
},
{
"input": "57114",
"output": "4 57110"
},
{
"input": "869",
"output": "4 865"
},
{
"input": "738457",
"output": "4 738453"
},
{
"input": "58113",
"output": "6 58107"
},
{
"input": "4864",
"output": "4 4860"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "74752",
"output": "4 74748"
},
{
"input": "6073",
"output": "4 6069"
},
{
"input": "1289",
"output": "4 1285"
},
{
"input": "20",
"output": "4 16"
},
{
"input": "58134",
"output": "4 58130"
},
{
"input": "57756",
"output": "4 57752"
},
{
"input": "765",
"output": "6 759"
},
{
"input": "59",
"output": "4 55"
},
{
"input": "991666",
"output": "4 991662"
},
{
"input": "70761",
"output": "4 70757"
},
{
"input": "13",
"output": "4 9"
},
{
"input": "999999",
"output": "4 999995"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "21",
"output": "6 15"
},
{
"input": "19",
"output": "4 15"
},
{
"input": "100007",
"output": "6 100001"
},
{
"input": "999987",
"output": "6 999981"
},
{
"input": "22",
"output": "4 18"
}
] | 1,689,764,326
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 62
| 0
|
n=int(input())
if n%2 == 0: print(f"4 {n-4}")
else: print(f"9 {n-9}")
|
Title: Design Tutorial: Learn from Math
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
Input Specification:
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output Specification:
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
Demo Input:
['12\n', '15\n', '23\n', '1000000\n']
Demo Output:
['4 8\n', '6 9\n', '8 15\n', '500000 500000\n']
Note:
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
|
```python
n=int(input())
if n%2 == 0: print(f"4 {n-4}")
else: print(f"9 {n-9}")
```
| 3
|
|
361
|
A
|
Levko and Table
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*.
Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
|
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
|
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value.
If there are multiple suitable tables, you are allowed to print any of them.
|
[
"2 4\n",
"4 7\n"
] |
[
"1 3\n3 1\n",
"2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n"
] |
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample.
In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
| 500
|
[
{
"input": "2 4",
"output": "4 0 \n0 4 "
},
{
"input": "4 7",
"output": "7 0 0 0 \n0 7 0 0 \n0 0 7 0 \n0 0 0 7 "
},
{
"input": "1 8",
"output": "8 "
},
{
"input": "9 3",
"output": "3 0 0 0 0 0 0 0 0 \n0 3 0 0 0 0 0 0 0 \n0 0 3 0 0 0 0 0 0 \n0 0 0 3 0 0 0 0 0 \n0 0 0 0 3 0 0 0 0 \n0 0 0 0 0 3 0 0 0 \n0 0 0 0 0 0 3 0 0 \n0 0 0 0 0 0 0 3 0 \n0 0 0 0 0 0 0 0 3 "
},
{
"input": "31 581",
"output": "581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "100 1000",
"output": "1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..."
},
{
"input": "100 999",
"output": "999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 998",
"output": "998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "100 997",
"output": "997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "81 111",
"output": "111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 111 0 0..."
},
{
"input": "1 407",
"output": "407 "
},
{
"input": "54 341",
"output": "341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "92 460",
"output": "460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "34 47",
"output": "47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 ..."
},
{
"input": "11 547",
"output": "547 0 0 0 0 0 0 0 0 0 0 \n0 547 0 0 0 0 0 0 0 0 0 \n0 0 547 0 0 0 0 0 0 0 0 \n0 0 0 547 0 0 0 0 0 0 0 \n0 0 0 0 547 0 0 0 0 0 0 \n0 0 0 0 0 547 0 0 0 0 0 \n0 0 0 0 0 0 547 0 0 0 0 \n0 0 0 0 0 0 0 547 0 0 0 \n0 0 0 0 0 0 0 0 547 0 0 \n0 0 0 0 0 0 0 0 0 547 0 \n0 0 0 0 0 0 0 0 0 0 547 "
},
{
"input": "100 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 2",
"output": "2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "2 7",
"output": "7 0 \n0 7 "
},
{
"input": "100 100",
"output": "100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "4 3",
"output": "3 0 0 0 \n0 3 0 0 \n0 0 3 0 \n0 0 0 3 "
},
{
"input": "3 2",
"output": "2 0 0 \n0 2 0 \n0 0 2 "
}
] | 1,612,221,531
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 22
| 77
| 307,200
|
a,b=map(int,input().split())
j=0
while j<a:
for i in range(0,a):
if i==j:print(b,end=" ")
else: print(0,end=" ")
j+=1
print()
|
Title: Levko and Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*.
Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
Output Specification:
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value.
If there are multiple suitable tables, you are allowed to print any of them.
Demo Input:
['2 4\n', '4 7\n']
Demo Output:
['1 3\n3 1\n', '2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n']
Note:
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample.
In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
|
```python
a,b=map(int,input().split())
j=0
while j<a:
for i in range(0,a):
if i==j:print(b,end=" ")
else: print(0,end=" ")
j+=1
print()
```
| 3
|
|
54
|
A
|
Presents
|
PROGRAMMING
| 1,300
|
[
"implementation"
] |
A. Presents
|
2
|
256
|
The Hedgehog likes to give presents to his friend, but no less he likes to receive them.
Having received another present today, the Hedgehog suddenly understood that he has no place to put it as there was no room left on the special shelf in the cupboard. He will have to choose another shelf, but which one should he choose, how large should it be?
In order to get to know this, the Hedgehog asks you to write him a program that will count the estimated number of presents that he will receive during the following *N* days. Besides, he is guided by the principle:
- on each holiday day the Hedgehog will necessarily receive a present, - he receives presents at least every *K* days (i.e., if he received a present on the *i*-th day, he will receive the next present no later than on the *i*<=+<=*K*-th day).
For the given *N* and *K*, as well as the list of holidays among the following *N* days count the minimal number of presents that could be given to the Hedgehog. The number of today's day is zero, and you should regard today's present as already given (i.e., you shouldn't count it in the answer).
|
The first line contains integers *N* and *K* (1<=≤<=*N*<=≤<=365, 1<=≤<=*K*<=≤<=*N*).
The second line contains a number *C* which represents the number of holidays (0<=≤<=*C*<=≤<=*N*). Then in the same line follow *C* numbers ranging from 1 to *N* which are the numbers of holiday days. The numbers are given in the increasing order, without repeating numbers among them.
|
Print a single number — the minimal number of presents the Hedgehog will receive over the following *N* days.
|
[
"5 2\n1 3\n",
"10 1\n3 6 7 8\n"
] |
[
"3",
"10"
] |
none
| 500
|
[
{
"input": "5 2\n1 3",
"output": "3"
},
{
"input": "10 1\n3 6 7 8",
"output": "10"
},
{
"input": "5 5\n1 3",
"output": "1"
},
{
"input": "10 3\n3 3 6 9",
"output": "3"
},
{
"input": "5 2\n0",
"output": "2"
},
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "5 1\n0",
"output": "5"
},
{
"input": "5 1\n1 2",
"output": "5"
},
{
"input": "5 2\n0",
"output": "2"
},
{
"input": "10 3\n2 4 8",
"output": "4"
},
{
"input": "10 1\n0",
"output": "10"
},
{
"input": "10 2\n1 5",
"output": "5"
},
{
"input": "10 1\n0",
"output": "10"
},
{
"input": "10 1\n0",
"output": "10"
},
{
"input": "15 5\n0",
"output": "3"
},
{
"input": "15 1\n1 3",
"output": "15"
},
{
"input": "15 2\n1 10",
"output": "7"
},
{
"input": "15 1\n0",
"output": "15"
},
{
"input": "15 3\n1 11",
"output": "5"
},
{
"input": "20 1\n3 7 9 20",
"output": "20"
},
{
"input": "20 3\n1 11",
"output": "7"
},
{
"input": "20 2\n6 6 9 10 15 19 20",
"output": "12"
},
{
"input": "20 1\n0",
"output": "20"
},
{
"input": "20 1\n1 13",
"output": "20"
},
{
"input": "25 1\n9 2 6 8 10 14 15 17 18 23",
"output": "25"
},
{
"input": "25 1\n0",
"output": "25"
},
{
"input": "25 1\n4 8 10 13 24",
"output": "25"
},
{
"input": "25 1\n1 14",
"output": "25"
},
{
"input": "25 1\n0",
"output": "25"
},
{
"input": "100 3\n0",
"output": "33"
},
{
"input": "100 10\n0",
"output": "10"
},
{
"input": "100 23\n22 2 9 18 22 23 30 44 50 55 58 61 70 71 73 76 79 82 85 88 94 95 99",
"output": "22"
},
{
"input": "100 5\n10 2 17 21 34 52 58 60 64 68 95",
"output": "24"
},
{
"input": "100 4\n2 29 63",
"output": "26"
},
{
"input": "150 16\n9 19 31 47 53 57 96 105 108 120",
"output": "13"
},
{
"input": "150 52\n5 11 37 60 67 86",
"output": "6"
},
{
"input": "150 4\n7 21 54 106 108 109 119 123",
"output": "40"
},
{
"input": "150 3\n0",
"output": "50"
},
{
"input": "150 21\n21 22 26 30 36 39 52 59 62 66 68 78 86 92 96 103 108 113 118 119 125 139",
"output": "22"
},
{
"input": "300 15\n14 3 38 52 57 142 157 175 201 209 238 258 288 294 299",
"output": "26"
},
{
"input": "300 2\n14 29 94 122 123 158 160 164 191 200 202 208 246 272 286",
"output": "153"
},
{
"input": "300 5\n16 22 38 72 78 108 116 140 147 160 189 209 214 227 252 294 300",
"output": "66"
},
{
"input": "300 8\n4 27 76 155 260",
"output": "40"
},
{
"input": "300 24\n20 18 76 80 81 85 103 110 112 129 145 151 172 180 184 201 205 241 257 268 276",
"output": "24"
},
{
"input": "350 22\n11 38 111 115 176 194 204 207 231 274 307 348",
"output": "21"
},
{
"input": "350 22\n73 1 4 8 10 14 16 19 28 37 41 42 43 55 56 64 66 67 79 80 84 87 96 99 101 103 119 120 121 122 127 128 135 141 142 143 148 156 159 160 161 166 167 169 173 189 201 202 205 219 223 227 233 242 243 244 250 257 260 262 263 264 273 291 301 302 305 306 307 314 326 336 342 345",
"output": "73"
},
{
"input": "350 26\n10 13 16 81 99 144 191 223 258 316 329",
"output": "18"
},
{
"input": "350 16\n12 31 76 103 116 191 201 241 256 260 291 306 336",
"output": "24"
},
{
"input": "350 28\n5 23 104 135 305 331",
"output": "14"
},
{
"input": "365 34\n6 80 94 208 256 325 349",
"output": "14"
},
{
"input": "365 19\n7 47 114 139 210 226 266 279",
"output": "22"
},
{
"input": "365 8\n32 1 13 22 25 33 72 80 86 96 117 132 145 146 156 176 177 179 188 198 203 218 225 235 253 256 267 279 286 294 303 333 363",
"output": "61"
},
{
"input": "365 8\n55 3 12 26 28 36 45 47 59 61 65 82 90 103 109 114 117 121 123 126 134 142 144 146 151 154 168 175 189 193 195 197 199 210 212 214 230 232 241 248 254 267 271 291 304 306 308 311 315 317 318 334 335 346 354 365",
"output": "74"
},
{
"input": "365 2\n2 96 241",
"output": "183"
},
{
"input": "365 42\n10 8 66 77 148 161 183 231 301 340 350",
"output": "14"
},
{
"input": "365 40\n30 1 14 21 31 32 36 56 59 68 96 119 131 137 166 179 181 202 235 248 272 294 309 315 322 327 334 341 347 362 365",
"output": "30"
},
{
"input": "365 31\n19 13 18 27 33 46 58 86 114 178 187 198 228 233 240 255 277 332 348 351",
"output": "22"
},
{
"input": "365 54\n21 28 42 56 65 66 67 76 81 85 89 123 132 136 153 195 215 249 294 296 300 355",
"output": "22"
},
{
"input": "365 5\n5 10 31 121 235 322",
"output": "74"
},
{
"input": "365 81\n2 1 75",
"output": "5"
},
{
"input": "365 21\n4 1 17 344 345",
"output": "19"
},
{
"input": "11 2\n5 3 6 7 9 10",
"output": "7"
},
{
"input": "5 3\n2 2 4",
"output": "2"
},
{
"input": "362 360\n0",
"output": "1"
},
{
"input": "18 4\n4 1 9 10 18",
"output": "6"
}
] | 1,533,484,224
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 65
| 248
| 0
|
n, k = list(map(int,input().strip().split(' ')))
holidays = list(map(int,input().strip().split(' ')))[1:]
prev = 0
i = 0
inc = 0
pres = 0
while i < n:
i += 1
inc += 1
if inc == k or i in holidays:
prev = i
inc = 0
pres += 1
print(pres)
|
Title: Presents
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Hedgehog likes to give presents to his friend, but no less he likes to receive them.
Having received another present today, the Hedgehog suddenly understood that he has no place to put it as there was no room left on the special shelf in the cupboard. He will have to choose another shelf, but which one should he choose, how large should it be?
In order to get to know this, the Hedgehog asks you to write him a program that will count the estimated number of presents that he will receive during the following *N* days. Besides, he is guided by the principle:
- on each holiday day the Hedgehog will necessarily receive a present, - he receives presents at least every *K* days (i.e., if he received a present on the *i*-th day, he will receive the next present no later than on the *i*<=+<=*K*-th day).
For the given *N* and *K*, as well as the list of holidays among the following *N* days count the minimal number of presents that could be given to the Hedgehog. The number of today's day is zero, and you should regard today's present as already given (i.e., you shouldn't count it in the answer).
Input Specification:
The first line contains integers *N* and *K* (1<=≤<=*N*<=≤<=365, 1<=≤<=*K*<=≤<=*N*).
The second line contains a number *C* which represents the number of holidays (0<=≤<=*C*<=≤<=*N*). Then in the same line follow *C* numbers ranging from 1 to *N* which are the numbers of holiday days. The numbers are given in the increasing order, without repeating numbers among them.
Output Specification:
Print a single number — the minimal number of presents the Hedgehog will receive over the following *N* days.
Demo Input:
['5 2\n1 3\n', '10 1\n3 6 7 8\n']
Demo Output:
['3', '10']
Note:
none
|
```python
n, k = list(map(int,input().strip().split(' ')))
holidays = list(map(int,input().strip().split(' ')))[1:]
prev = 0
i = 0
inc = 0
pres = 0
while i < n:
i += 1
inc += 1
if inc == k or i in holidays:
prev = i
inc = 0
pres += 1
print(pres)
```
| 3.938
|
6
|
C
|
Alice, Bob and Chocolate
|
PROGRAMMING
| 1,200
|
[
"greedy",
"two pointers"
] |
C. Alice, Bob and Chocolate
|
2
|
64
|
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
|
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
|
[
"5\n2 9 8 2 7\n"
] |
[
"2 3\n"
] |
none
| 0
|
[
{
"input": "5\n2 9 8 2 7",
"output": "2 3"
},
{
"input": "1\n1",
"output": "1 0"
},
{
"input": "2\n1 1",
"output": "1 1"
},
{
"input": "3\n1 1 1",
"output": "2 1"
},
{
"input": "4\n1 1 1 1",
"output": "2 2"
},
{
"input": "1\n6",
"output": "1 0"
},
{
"input": "2\n8 2",
"output": "1 1"
},
{
"input": "3\n6 8 4",
"output": "1 2"
},
{
"input": "4\n4 3 2 8",
"output": "3 1"
},
{
"input": "5\n1 9 8 2 7",
"output": "2 3"
},
{
"input": "6\n1 4 7 3 2 1",
"output": "3 3"
},
{
"input": "11\n7 9 1 8 7 1 7 1 4 8 1",
"output": "4 7"
},
{
"input": "12\n4 2 7 1 9 5 6 2 7 8 5 7",
"output": "7 5"
},
{
"input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9",
"output": "7 6"
}
] | 1,585,135,748
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 372
| 8,089,600
|
n = int(input())
a = [int(x) for x in input().split()]
b = 0
c = 0
d = 0
e = n-1
while d <= e:
if b <= c:
b += a[d]
d += 1
else:
c += a[e]
e -= 1
print(d, n - d)
|
Title: Alice, Bob and Chocolate
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Output Specification:
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
Demo Input:
['5\n2 9 8 2 7\n']
Demo Output:
['2 3\n']
Note:
none
|
```python
n = int(input())
a = [int(x) for x in input().split()]
b = 0
c = 0
d = 0
e = n-1
while d <= e:
if b <= c:
b += a[d]
d += 1
else:
c += a[e]
e -= 1
print(d, n - d)
```
| 3.846728
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,616,639,981
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 12
| 93
| 0
|
n = int(input())
for i in range(1+(n)//2):
num_D = 1 + ((i)*2)
num_ast = (n-num_D)//2
str_d = ''.join(['*']*(num_ast)+['D']*(num_D)+['*']*(num_ast))
print(str_d)
for i in range((n)//2):
num_D = n - ((i+1)*2)
num_ast = (n-num_D)//2
str_d = ''.join(['*']*(num_ast)+['D']*(num_D)+['*']*(num_ast))
print(str_d)
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
n = int(input())
for i in range(1+(n)//2):
num_D = 1 + ((i)*2)
num_ast = (n-num_D)//2
str_d = ''.join(['*']*(num_ast)+['D']*(num_D)+['*']*(num_ast))
print(str_d)
for i in range((n)//2):
num_D = n - ((i+1)*2)
num_ast = (n-num_D)//2
str_d = ''.join(['*']*(num_ast)+['D']*(num_D)+['*']*(num_ast))
print(str_d)
```
| 3
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,688,033,038
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
T = int(input())
a = input()
a = a.split()
a = [int(x) for x in a]
l = 0
for i in a:
l += i
l = l/T
print(l)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
T = int(input())
a = input()
a = a.split()
a = [int(x) for x in a]
l = 0
for i in a:
l += i
l = l/T
print(l)
```
| 3
|
|
426
|
A
|
Sereja and Mugs
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Sereja showed an interesting game to his friends. The game goes like that. Initially, there is a table with an empty cup and *n* water mugs on it. Then all players take turns to move. During a move, a player takes a non-empty mug of water and pours all water from it into the cup. If the cup overfills, then we assume that this player lost.
As soon as Sereja's friends heard of the game, they wanted to play it. Sereja, on the other hand, wanted to find out whether his friends can play the game in such a way that there are no losers. You are given the volumes of all mugs and the cup. Also, you know that Sereja has (*n*<=-<=1) friends. Determine if Sereja's friends can play the game so that nobody loses.
|
The first line contains integers *n* and *s* (2<=≤<=*n*<=≤<=100; 1<=≤<=*s*<=≤<=1000) — the number of mugs and the volume of the cup. The next line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10). Number *a**i* means the volume of the *i*-th mug.
|
In a single line, print "YES" (without the quotes) if his friends can play in the described manner, and "NO" (without the quotes) otherwise.
|
[
"3 4\n1 1 1\n",
"3 4\n3 1 3\n",
"3 4\n4 4 4\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "3 4\n1 1 1",
"output": "YES"
},
{
"input": "3 4\n3 1 3",
"output": "YES"
},
{
"input": "3 4\n4 4 4",
"output": "NO"
},
{
"input": "2 1\n1 10",
"output": "YES"
},
{
"input": "3 12\n5 6 6",
"output": "YES"
},
{
"input": "4 10\n6 3 8 7",
"output": "NO"
},
{
"input": "5 16\n3 3 2 7 9",
"output": "YES"
},
{
"input": "6 38\n9 10 3 8 10 6",
"output": "YES"
},
{
"input": "7 12\n4 4 5 2 2 4 9",
"output": "NO"
},
{
"input": "8 15\n8 10 4 2 10 9 7 6",
"output": "NO"
},
{
"input": "9 22\n1 3 5 9 7 6 1 10 1",
"output": "NO"
},
{
"input": "10 30\n9 10 4 5 5 7 1 7 7 2",
"output": "NO"
},
{
"input": "38 83\n9 9 3 10 2 4 6 10 9 5 1 8 7 4 7 2 6 5 3 1 10 8 4 8 3 7 1 2 7 6 8 6 5 2 3 1 1 2",
"output": "NO"
},
{
"input": "84 212\n6 2 3 1 2 7 5 1 7 2 9 10 9 5 2 5 4 10 9 9 1 9 8 8 9 4 9 4 8 2 1 8 4 5 10 7 6 2 1 10 10 7 9 4 5 9 5 10 10 3 6 6 4 4 4 8 5 4 9 1 9 9 1 7 9 2 10 9 10 8 3 3 9 3 9 10 1 8 9 2 6 9 7 2",
"output": "NO"
},
{
"input": "8 50\n8 8 8 4 4 6 10 10",
"output": "YES"
},
{
"input": "7 24\n1 4 9 1 2 3 6",
"output": "YES"
},
{
"input": "47 262\n3 7 6 4 10 3 5 7 2 9 3 2 2 10 8 7 3 10 6 3 1 1 4 10 2 9 2 10 6 4 3 6 3 6 9 7 8 8 3 3 10 5 2 10 7 10 9",
"output": "YES"
},
{
"input": "42 227\n3 6 1 9 4 10 4 10 7 8 10 10 8 7 10 4 6 8 7 7 6 9 3 6 5 5 2 7 2 7 4 4 6 6 4 3 9 3 6 4 7 2",
"output": "NO"
},
{
"input": "97 65\n3 10 2 6 1 4 7 5 10 3 10 4 5 5 1 6 10 7 4 5 3 9 9 8 6 9 2 3 6 8 5 5 5 5 5 3 10 4 1 8 8 9 8 4 1 4 9 3 6 3 1 4 8 3 10 8 6 4 5 4 3 2 2 4 3 6 4 6 2 3 3 3 7 5 1 8 1 4 5 1 1 6 4 2 1 7 8 6 1 1 5 6 5 10 6 7 5",
"output": "NO"
},
{
"input": "94 279\n2 5 9 5 10 3 1 8 1 7 1 8 1 6 7 8 4 9 5 10 3 7 6 8 8 5 6 8 10 9 4 1 3 3 4 7 8 2 6 6 5 1 3 7 1 7 2 2 2 8 4 1 1 5 9 4 1 2 3 10 1 4 9 9 6 8 8 1 9 10 4 1 8 5 8 9 4 8 2 1 1 9 4 5 6 1 2 5 6 7 3 1 4 6",
"output": "NO"
},
{
"input": "58 70\n8 2 10 2 7 3 8 3 8 7 6 2 4 10 10 6 10 3 7 6 4 3 5 5 5 3 8 10 3 4 8 4 2 6 8 9 6 9 4 3 5 2 2 6 10 6 2 1 7 5 6 4 1 9 10 2 4 5",
"output": "NO"
},
{
"input": "6 14\n3 9 2 1 4 2",
"output": "YES"
},
{
"input": "78 400\n5 9 3 4 7 4 1 4 6 3 9 1 8 3 3 6 10 2 1 9 6 1 8 10 1 6 4 5 2 1 5 9 6 10 3 6 5 2 4 10 6 9 3 8 10 7 2 8 8 2 10 1 4 5 2 8 6 4 4 3 5 2 3 10 1 9 8 5 6 7 9 1 8 8 5 4 2 4",
"output": "YES"
},
{
"input": "41 181\n5 3 10 4 2 5 9 3 1 6 6 10 4 3 9 8 5 9 2 5 4 6 6 3 7 9 10 3 10 6 10 5 6 1 6 9 9 1 2 4 3",
"output": "NO"
},
{
"input": "2 4\n4 4",
"output": "YES"
},
{
"input": "29 71\n4 8 9 4 8 10 4 10 2 9 3 9 1 2 9 5 9 7 1 10 4 1 1 9 8 7 4 6 7",
"output": "NO"
},
{
"input": "49 272\n4 10 8 7 5 6 9 7 2 6 6 2 10 7 5 6 5 3 6 4 3 7 9 3 7 7 4 10 5 6 7 3 6 4 6 7 7 2 5 5 7 3 7 9 3 6 6 2 1",
"output": "YES"
},
{
"input": "91 486\n1 3 5 4 4 7 3 9 3 4 5 4 5 4 7 9 5 8 4 10 9 1 1 9 9 1 6 2 5 4 7 4 10 3 2 10 9 3 4 5 1 3 4 2 10 9 10 9 10 2 4 6 2 5 3 6 4 9 10 3 9 8 1 2 5 9 2 10 4 6 10 8 10 9 1 2 5 8 6 6 6 1 10 3 9 3 5 6 1 5 5",
"output": "YES"
},
{
"input": "80 78\n1 9 4 9 8 3 7 10 4 9 2 1 4 4 9 5 9 1 2 6 5 2 4 8 4 6 9 6 7 10 1 9 10 4 7 1 7 10 8 9 10 5 2 6 7 7 7 7 7 8 2 5 1 7 2 3 2 5 10 6 3 4 5 2 6 3 4 2 7 9 9 3 8 8 2 3 7 1 5 10",
"output": "NO"
},
{
"input": "53 245\n5 6 9 9 2 3 2 5 10 9 3 5 6 3 10 10 9 4 9 7 10 9 7 7 3 4 9 3 7 3 8 6 8 9 3 8 9 1 3 1 9 10 3 9 3 1 6 6 3 8 7 8 9",
"output": "NO"
},
{
"input": "50 271\n6 9 10 1 1 1 8 3 6 6 3 2 5 9 7 5 7 9 10 9 4 6 6 2 6 6 9 5 1 6 5 8 3 2 5 10 10 1 4 1 4 6 1 8 7 8 9 4 7 5",
"output": "YES"
},
{
"input": "38 214\n5 8 4 5 1 9 9 2 6 3 4 3 5 7 7 7 3 10 1 5 10 4 2 2 10 10 6 6 6 7 1 6 10 5 7 4 5 10",
"output": "YES"
},
{
"input": "100 1\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "100 100\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "100 989\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "100 990\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "YES"
},
{
"input": "100 1000\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "YES"
},
{
"input": "2 1\n1 1",
"output": "YES"
},
{
"input": "2 1\n2 2",
"output": "NO"
},
{
"input": "2 1000\n1 1",
"output": "YES"
},
{
"input": "10 89\n10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "10 44\n1 10 2 3 4 5 6 7 8 9",
"output": "NO"
}
] | 1,627,555,537
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 77
| 6,758,400
|
k = int(input().split()[1])
if sum(sorted(list(map(int,input().split())))[:-1]) > k:
print('NO')
else:
print('YES')
|
Title: Sereja and Mugs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja showed an interesting game to his friends. The game goes like that. Initially, there is a table with an empty cup and *n* water mugs on it. Then all players take turns to move. During a move, a player takes a non-empty mug of water and pours all water from it into the cup. If the cup overfills, then we assume that this player lost.
As soon as Sereja's friends heard of the game, they wanted to play it. Sereja, on the other hand, wanted to find out whether his friends can play the game in such a way that there are no losers. You are given the volumes of all mugs and the cup. Also, you know that Sereja has (*n*<=-<=1) friends. Determine if Sereja's friends can play the game so that nobody loses.
Input Specification:
The first line contains integers *n* and *s* (2<=≤<=*n*<=≤<=100; 1<=≤<=*s*<=≤<=1000) — the number of mugs and the volume of the cup. The next line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10). Number *a**i* means the volume of the *i*-th mug.
Output Specification:
In a single line, print "YES" (without the quotes) if his friends can play in the described manner, and "NO" (without the quotes) otherwise.
Demo Input:
['3 4\n1 1 1\n', '3 4\n3 1 3\n', '3 4\n4 4 4\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none
|
```python
k = int(input().split()[1])
if sum(sorted(list(map(int,input().split())))[:-1]) > k:
print('NO')
else:
print('YES')
```
| 3
|
|
705
|
A
|
Hulk
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
|
Print Dr.Banner's feeling in one line.
|
[
"1\n",
"2\n",
"3\n"
] |
[
"I hate it\n",
"I hate that I love it\n",
"I hate that I love that I hate it\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "I hate it"
},
{
"input": "2",
"output": "I hate that I love it"
},
{
"input": "3",
"output": "I hate that I love that I hate it"
},
{
"input": "4",
"output": "I hate that I love that I hate that I love it"
},
{
"input": "5",
"output": "I hate that I love that I hate that I love that I hate it"
},
{
"input": "10",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "18",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "19",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "76",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "77",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "81",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "82",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "85",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "86",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "99",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "98",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "33",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "34",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "57",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
}
] | 1,688,652,245
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 46
| 0
|
n=int(input())
f=[]
for i in range(1,n+1):
if i%2==1:
f.append("I hate")
else:
f.append("I love")
if i!=n:
f.append("that")
f.append("it")
x=' '.join(f)
print(x)
|
Title: Hulk
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Output Specification:
Print Dr.Banner's feeling in one line.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n']
Note:
none
|
```python
n=int(input())
f=[]
for i in range(1,n+1):
if i%2==1:
f.append("I hate")
else:
f.append("I love")
if i!=n:
f.append("that")
f.append("it")
x=' '.join(f)
print(x)
```
| 3
|
|
421
|
A
|
Pasha and Hamsters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Pasha has two hamsters: Arthur and Alexander. Pasha put *n* apples in front of them. Pasha knows which apples Arthur likes. Similarly, Pasha knows which apples Alexander likes. Pasha doesn't want any conflict between the hamsters (as they may like the same apple), so he decided to distribute the apples between the hamsters on his own. He is going to give some apples to Arthur and some apples to Alexander. It doesn't matter how many apples each hamster gets but it is important that each hamster gets only the apples he likes. It is possible that somebody doesn't get any apples.
Help Pasha distribute all the apples between the hamsters. Note that Pasha wants to distribute all the apples, not just some of them.
|
The first line contains integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=100; 1<=≤<=*a*,<=*b*<=≤<=*n*) — the number of apples Pasha has, the number of apples Arthur likes and the number of apples Alexander likes, correspondingly.
The next line contains *a* distinct integers — the numbers of the apples Arthur likes. The next line contains *b* distinct integers — the numbers of the apples Alexander likes.
Assume that the apples are numbered from 1 to *n*. The input is such that the answer exists.
|
Print *n* characters, each of them equals either 1 or 2. If the *i*-h character equals 1, then the *i*-th apple should be given to Arthur, otherwise it should be given to Alexander. If there are multiple correct answers, you are allowed to print any of them.
|
[
"4 2 3\n1 2\n2 3 4\n",
"5 5 2\n3 4 1 2 5\n2 3\n"
] |
[
"1 1 2 2\n",
"1 1 1 1 1\n"
] |
none
| 500
|
[
{
"input": "4 2 3\n1 2\n2 3 4",
"output": "1 1 2 2"
},
{
"input": "5 5 2\n3 4 1 2 5\n2 3",
"output": "1 1 1 1 1"
},
{
"input": "100 69 31\n1 3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 24 26 27 29 31 37 38 39 40 44 46 48 49 50 51 53 55 56 57 58 59 60 61 63 64 65 66 67 68 69 70 71 72 74 76 77 78 79 80 81 82 83 89 92 94 95 97 98 99 100\n2 13 22 23 25 28 30 32 33 34 35 36 41 42 43 45 47 52 54 62 73 75 84 85 86 87 88 90 91 93 96",
"output": "1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 2 1 2 1 2 2 2 2 2 1 1 1 1 2 2 2 1 2 1 2 1 1 1 1 2 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 2 2 1 2 2 1 2 1 1 2 1 1 1 1"
},
{
"input": "100 56 44\n1 2 5 8 14 15 17 18 20 21 23 24 25 27 30 33 34 35 36 38 41 42 44 45 46 47 48 49 50 53 56 58 59 60 62 63 64 65 68 69 71 75 76 80 81 84 87 88 90 91 92 94 95 96 98 100\n3 4 6 7 9 10 11 12 13 16 19 22 26 28 29 31 32 37 39 40 43 51 52 54 55 57 61 66 67 70 72 73 74 77 78 79 82 83 85 86 89 93 97 99",
"output": "1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 2 1 1 2 1 1 2 1 1 1 2 1 2 2 1 2 2 1 1 1 1 2 1 2 2 1 1 2 1 1 1 1 1 1 1 2 2 1 2 2 1 2 1 1 1 2 1 1 1 1 2 2 1 1 2 1 2 2 2 1 1 2 2 2 1 1 2 2 1 2 2 1 1 2 1 1 1 2 1 1 1 2 1 2 1"
},
{
"input": "100 82 18\n1 2 3 4 5 6 7 8 9 10 11 13 14 15 16 17 18 19 20 22 23 25 27 29 30 31 32 33 34 35 36 37 38 42 43 44 45 46 47 48 49 50 51 53 54 55 57 58 59 60 61 62 63 64 65 66 67 68 69 71 72 73 74 75 77 78 79 80 82 83 86 88 90 91 92 93 94 96 97 98 99 100\n12 21 24 26 28 39 40 41 52 56 70 76 81 84 85 87 89 95",
"output": "1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 2 2 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1"
},
{
"input": "99 72 27\n1 2 3 4 5 6 7 8 10 11 12 13 14 15 16 17 20 23 25 26 28 29 30 32 33 34 35 36 39 41 42 43 44 45 46 47 50 51 52 54 55 56 58 59 60 61 62 67 70 71 72 74 75 76 77 80 81 82 84 85 86 88 90 91 92 93 94 95 96 97 98 99\n9 18 19 21 22 24 27 31 37 38 40 48 49 53 57 63 64 65 66 68 69 73 78 79 83 87 89",
"output": "1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 1 1 1 1 1 1 2 2 1 1 1 2 1 1 1 2 1 1 1 1 1 2 2 2 2 1 2 2 1 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "99 38 61\n1 3 10 15 16 22 23 28 31 34 35 36 37 38 39 43 44 49 50 53 56 60 63 68 69 70 72 74 75 77 80 81 83 85 96 97 98 99\n2 4 5 6 7 8 9 11 12 13 14 17 18 19 20 21 24 25 26 27 29 30 32 33 40 41 42 45 46 47 48 51 52 54 55 57 58 59 61 62 64 65 66 67 71 73 76 78 79 82 84 86 87 88 89 90 91 92 93 94 95",
"output": "1 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 2 2 2 2 2 1 1 2 2 2 2 1 2 2 1 2 2 1 1 1 1 1 1 2 2 2 1 1 2 2 2 2 1 1 2 2 1 2 2 1 2 2 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 1 1 2 1 2 2 1 1 2 1 2 1 2 2 2 2 2 2 2 2 2 2 1 1 1 1"
},
{
"input": "99 84 15\n1 2 3 5 6 7 8 9 10 11 12 13 14 15 16 17 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 36 37 38 39 40 41 42 43 44 47 48 50 51 52 53 55 56 58 59 60 61 62 63 64 65 68 69 70 71 72 73 74 75 77 79 80 81 82 83 84 85 86 87 89 90 91 92 93 94 97 98 99\n4 18 33 45 46 49 54 57 66 67 76 78 88 95 96",
"output": "1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 2 1 1 1"
},
{
"input": "4 3 1\n1 3 4\n2",
"output": "1 2 1 1"
},
{
"input": "4 3 1\n1 2 4\n3",
"output": "1 1 2 1"
},
{
"input": "4 2 2\n2 3\n1 4",
"output": "2 1 1 2"
},
{
"input": "4 3 1\n2 3 4\n1",
"output": "2 1 1 1"
},
{
"input": "1 1 1\n1\n1",
"output": "1"
},
{
"input": "2 1 1\n2\n1",
"output": "2 1"
},
{
"input": "2 1 1\n1\n2",
"output": "1 2"
},
{
"input": "3 3 1\n1 2 3\n1",
"output": "1 1 1"
},
{
"input": "3 3 1\n1 2 3\n3",
"output": "1 1 1"
},
{
"input": "3 2 1\n1 3\n2",
"output": "1 2 1"
},
{
"input": "100 1 100\n84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "100 100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n17",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "98 51 47\n1 2 3 4 6 7 8 10 13 15 16 18 19 21 22 23 25 26 27 29 31 32 36 37 39 40 41 43 44 48 49 50 51 52 54 56 58 59 65 66 68 79 80 84 86 88 89 90 94 95 97\n5 9 11 12 14 17 20 24 28 30 33 34 35 38 42 45 46 47 53 55 57 60 61 62 63 64 67 69 70 71 72 73 74 75 76 77 78 81 82 83 85 87 91 92 93 96 98",
"output": "1 1 1 1 2 1 1 1 2 1 2 2 1 2 1 1 2 1 1 2 1 1 1 2 1 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 1 1 2 2 2 1 1 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 1 2 1 2 2 2 2 2 2 2 2 2 2 1 1 2 2 2 1 2 1 2 1 1 1 2 2 2 1 1 2 1 2"
},
{
"input": "98 28 70\n1 13 15 16 19 27 28 40 42 43 46 53 54 57 61 63 67 68 69 71 75 76 78 80 88 93 97 98\n2 3 4 5 6 7 8 9 10 11 12 14 17 18 20 21 22 23 24 25 26 29 30 31 32 33 34 35 36 37 38 39 41 44 45 47 48 49 50 51 52 55 56 58 59 60 62 64 65 66 70 72 73 74 77 79 81 82 83 84 85 86 87 89 90 91 92 94 95 96",
"output": "1 2 2 2 2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 2 2 2 1 1 2 2 1 2 2 2 1 2 1 2 2 2 1 1 1 2 1 2 2 2 1 1 2 1 2 1 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1"
},
{
"input": "97 21 76\n7 10 16 17 26 30 34 39 40 42 44 46 53 54 56 64 67 72 78 79 94\n1 2 3 4 5 6 8 9 11 12 13 14 15 18 19 20 21 22 23 24 25 27 28 29 31 32 33 35 36 37 38 41 43 45 47 48 49 50 51 52 55 57 58 59 60 61 62 63 65 66 68 69 70 71 73 74 75 76 77 80 81 82 83 84 85 86 87 88 89 90 91 92 93 95 96 97",
"output": "2 2 2 2 2 2 1 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 1 2 2 2 2 1 1 2 1 2 1 2 1 2 2 2 2 2 2 1 1 2 1 2 2 2 2 2 2 2 1 2 2 1 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2"
},
{
"input": "97 21 76\n1 10 12 13 17 18 22 25 31 48 50 54 61 64 67 74 78 81 86 88 94\n2 3 4 5 6 7 8 9 11 14 15 16 19 20 21 23 24 26 27 28 29 30 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 49 51 52 53 55 56 57 58 59 60 62 63 65 66 68 69 70 71 72 73 75 76 77 79 80 82 83 84 85 87 89 90 91 92 93 95 96 97",
"output": "1 2 2 2 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 1 2 2 1 2 2 1 2 2 2 2 2 2 1 2 2 2 1 2 2 1 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2"
},
{
"input": "96 10 86\n2 5 31 37 68 69 80 82 90 91\n1 3 4 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 32 33 34 35 36 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 70 71 72 73 74 75 76 77 78 79 81 83 84 85 86 87 88 89 92 93 94 95 96",
"output": "2 1 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 1 1 2 2 2 2 2"
},
{
"input": "95 4 91\n58 65 70 93\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 59 60 61 62 63 64 66 67 68 69 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 94 95",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2"
},
{
"input": "98 88 10\n1 2 4 5 6 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 33 34 35 36 38 39 40 41 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 62 63 64 65 66 67 68 69 71 72 73 74 75 76 77 79 80 81 83 84 85 86 87 88 89 90 92 93 94 95 96 97 98\n3 7 32 37 42 61 70 78 82 91",
"output": "1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1"
},
{
"input": "98 96 2\n1 2 3 4 5 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98\n6 7",
"output": "1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "97 97 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n94",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "97 97 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n20",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "96 96 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96\n48",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "95 95 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95\n55",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
}
] | 1,689,889,342
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 77
| 0
|
n,a,b, = map(int,input().split())
l1 = list(map(int,input().split()))
l2 = list(map(int,input().split()))
for i in range(1,n+1):
if i in l1:
print(1,end = ' ')
else:
print(2,end = ' ')
print()
|
Title: Pasha and Hamsters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has two hamsters: Arthur and Alexander. Pasha put *n* apples in front of them. Pasha knows which apples Arthur likes. Similarly, Pasha knows which apples Alexander likes. Pasha doesn't want any conflict between the hamsters (as they may like the same apple), so he decided to distribute the apples between the hamsters on his own. He is going to give some apples to Arthur and some apples to Alexander. It doesn't matter how many apples each hamster gets but it is important that each hamster gets only the apples he likes. It is possible that somebody doesn't get any apples.
Help Pasha distribute all the apples between the hamsters. Note that Pasha wants to distribute all the apples, not just some of them.
Input Specification:
The first line contains integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=100; 1<=≤<=*a*,<=*b*<=≤<=*n*) — the number of apples Pasha has, the number of apples Arthur likes and the number of apples Alexander likes, correspondingly.
The next line contains *a* distinct integers — the numbers of the apples Arthur likes. The next line contains *b* distinct integers — the numbers of the apples Alexander likes.
Assume that the apples are numbered from 1 to *n*. The input is such that the answer exists.
Output Specification:
Print *n* characters, each of them equals either 1 or 2. If the *i*-h character equals 1, then the *i*-th apple should be given to Arthur, otherwise it should be given to Alexander. If there are multiple correct answers, you are allowed to print any of them.
Demo Input:
['4 2 3\n1 2\n2 3 4\n', '5 5 2\n3 4 1 2 5\n2 3\n']
Demo Output:
['1 1 2 2\n', '1 1 1 1 1\n']
Note:
none
|
```python
n,a,b, = map(int,input().split())
l1 = list(map(int,input().split()))
l2 = list(map(int,input().split()))
for i in range(1,n+1):
if i in l1:
print(1,end = ' ')
else:
print(2,end = ' ')
print()
```
| 3
|
|
361
|
B
|
Levko and Permutation
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"math",
"number theory"
] | null | null |
Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them.
|
The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*).
|
In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them.
|
[
"4 2\n",
"1 1\n"
] |
[
"2 4 3 1",
"-1\n"
] |
In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations.
| 1,000
|
[
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "7 4",
"output": "3 1 2 4 5 6 7 "
},
{
"input": "10 9",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10000 5000",
"output": "5000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "7 0",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1 0",
"output": "1 "
},
{
"input": "7 7",
"output": "-1"
},
{
"input": "100000 47",
"output": "99953 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 100000",
"output": "-1"
},
{
"input": "100000 43425",
"output": "56575 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "7 6",
"output": "1 2 3 4 5 6 7 "
},
{
"input": "100000 99999",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "47 46",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 "
},
{
"input": "5 0",
"output": "5 1 2 3 4 "
},
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1533 1052",
"output": "481 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "81314 52747",
"output": "28567 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "17767 145",
"output": "17622 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "18168 7942",
"output": "10226 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 15915",
"output": "10678 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 8877",
"output": "17716 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "13852 12727",
"output": "1125 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "8834 8834",
"output": "-1"
},
{
"input": "8485 8484",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "14564 14564",
"output": "-1"
},
{
"input": "8254 8253",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "81314 81312",
"output": "2 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "5795 5792",
"output": "3 1 2 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "6417 3",
"output": "6414 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6896 0",
"output": "6896 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6778 1",
"output": "6777 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "9448 1",
"output": "9447 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "5938 2",
"output": "5936 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3072 0",
"output": "3072 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "8576 0",
"output": "8576 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "2 1",
"output": "1 2 "
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "5 5",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "100000 1",
"output": "99999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 50000",
"output": "50000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "100000 9999",
"output": "90001 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 99000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "100000 12347",
"output": "87653 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
}
] | 1,610,441,116
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 47
| 218
| 8,908,800
|
import sys
# sys.stdin = open('input.txt', 'r')
# sys.stdout = open('output.txt', 'w')
input = sys.stdin.readline
n, k = list(map(int, input().split()))
if k == n:
print(-1)
exit()
ans = list(range(n-k+1, n+1))
new_n = n-k
for i in range(1, new_n+1):
print(i%new_n + 1, end=" ")
print(*ans)
|
Title: Levko and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*).
Output Specification:
In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them.
Demo Input:
['4 2\n', '1 1\n']
Demo Output:
['2 4 3 1', '-1\n']
Note:
In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations.
|
```python
import sys
# sys.stdin = open('input.txt', 'r')
# sys.stdout = open('output.txt', 'w')
input = sys.stdin.readline
n, k = list(map(int, input().split()))
if k == n:
print(-1)
exit()
ans = list(range(n-k+1, n+1))
new_n = n-k
for i in range(1, new_n+1):
print(i%new_n + 1, end=" ")
print(*ans)
```
| 3
|
|
550
|
A
|
Two Substrings
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dp",
"greedy",
"implementation",
"strings"
] | null | null |
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
|
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
|
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
|
[
"ABA\n",
"BACFAB\n",
"AXBYBXA\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA".
| 1,000
|
[
{
"input": "ABA",
"output": "NO"
},
{
"input": "BACFAB",
"output": "YES"
},
{
"input": "AXBYBXA",
"output": "NO"
},
{
"input": "ABABAB",
"output": "YES"
},
{
"input": "BBBBBBBBBB",
"output": "NO"
},
{
"input": "ABBA",
"output": "YES"
},
{
"input": "ABAXXXAB",
"output": "YES"
},
{
"input": "TESTABAXXABTEST",
"output": "YES"
},
{
"input": "A",
"output": "NO"
},
{
"input": "B",
"output": "NO"
},
{
"input": "X",
"output": "NO"
},
{
"input": "BA",
"output": "NO"
},
{
"input": "AB",
"output": "NO"
},
{
"input": "AA",
"output": "NO"
},
{
"input": "BB",
"output": "NO"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "AAB",
"output": "NO"
},
{
"input": "BAA",
"output": "NO"
},
{
"input": "ABB",
"output": "NO"
},
{
"input": "BBA",
"output": "NO"
},
{
"input": "AAA",
"output": "NO"
},
{
"input": "BBB",
"output": "NO"
},
{
"input": "AXBXBXA",
"output": "NO"
},
{
"input": "SKDSKDJABSDBADKFJDK",
"output": "YES"
},
{
"input": "ABAXXBBXXAA",
"output": "NO"
},
{
"input": "ABAB",
"output": "NO"
},
{
"input": "BABA",
"output": "NO"
},
{
"input": "AAAB",
"output": "NO"
},
{
"input": "AAAA",
"output": "NO"
},
{
"input": "AABA",
"output": "NO"
},
{
"input": "ABAA",
"output": "NO"
},
{
"input": "BAAA",
"output": "NO"
},
{
"input": "AABB",
"output": "NO"
},
{
"input": "BAAB",
"output": "YES"
},
{
"input": "BBAA",
"output": "NO"
},
{
"input": "BBBA",
"output": "NO"
},
{
"input": "BBAB",
"output": "NO"
},
{
"input": "BABB",
"output": "NO"
},
{
"input": "ABBB",
"output": "NO"
},
{
"input": "BBBB",
"output": "NO"
},
{
"input": "BABAB",
"output": "YES"
},
{
"input": "ABABA",
"output": "YES"
},
{
"input": "AAABAAACBBBC",
"output": "NO"
},
{
"input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC",
"output": "YES"
},
{
"input": "CBBABDDBBADAC",
"output": "YES"
},
{
"input": "ABYFAB",
"output": "NO"
},
{
"input": "BABXXAB",
"output": "YES"
},
{
"input": "ABAXAB",
"output": "YES"
},
{
"input": "ABABXAB",
"output": "YES"
},
{
"input": "ABXABXABXABXABXBAXBAXBAXBA",
"output": "YES"
},
{
"input": "QQQQQQQQQABABQQQQQQQQ",
"output": "NO"
}
] | 1,687,031,771
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 85
| 46
| 102,400
|
s = input()
if 'AB' in s and 'BA' in s:
# Find the first occurrence of "AB" and the first occurrence of "BA" after the "AB"
ab_index = s.find('AB')
ba_index = s.find('BA', ab_index + 2)
# Check if the substrings are non-overlapping
if ba_index != -1 and ba_index != ab_index + 1:
print('YES')
else:
# Find the first occurrence of "BA" and the first occurrence of "AB" after the "BA"
ba_index = s.find('BA')
ab_index = s.find('AB', ba_index + 2)
# Check if the substrings are non-overlapping
if ab_index != -1 and ab_index != ba_index + 1:
print('YES')
else:
print('NO')
else:
print('NO')
|
Title: Two Substrings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
Input Specification:
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Output Specification:
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
Demo Input:
['ABA\n', 'BACFAB\n', 'AXBYBXA\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA".
|
```python
s = input()
if 'AB' in s and 'BA' in s:
# Find the first occurrence of "AB" and the first occurrence of "BA" after the "AB"
ab_index = s.find('AB')
ba_index = s.find('BA', ab_index + 2)
# Check if the substrings are non-overlapping
if ba_index != -1 and ba_index != ab_index + 1:
print('YES')
else:
# Find the first occurrence of "BA" and the first occurrence of "AB" after the "BA"
ba_index = s.find('BA')
ab_index = s.find('AB', ba_index + 2)
# Check if the substrings are non-overlapping
if ab_index != -1 and ab_index != ba_index + 1:
print('YES')
else:
print('NO')
else:
print('NO')
```
| 3
|
|
62
|
A
|
A Student's Dream
|
PROGRAMMING
| 1,300
|
[
"greedy",
"math"
] |
A. A Student's Dream
|
2
|
256
|
Statistics claims that students sleep no more than three hours a day. But even in the world of their dreams, while they are snoring peacefully, the sense of impending doom is still upon them.
A poor student is dreaming that he is sitting the mathematical analysis exam. And he is examined by the most formidable professor of all times, a three times Soviet Union Hero, a Noble Prize laureate in student expulsion, venerable Petr Palych.
The poor student couldn't answer a single question. Thus, instead of a large spacious office he is going to apply for a job to thorium mines. But wait a minute! Petr Palych decided to give the student the last chance! Yes, that is possible only in dreams.
So the professor began: "Once a Venusian girl and a Marsian boy met on the Earth and decided to take a walk holding hands. But the problem is the girl has *a**l* fingers on her left hand and *a**r* fingers on the right one. The boy correspondingly has *b**l* and *b**r* fingers. They can only feel comfortable when holding hands, when no pair of the girl's fingers will touch each other. That is, they are comfortable when between any two girl's fingers there is a boy's finger. And in addition, no three fingers of the boy should touch each other. Determine if they can hold hands so that the both were comfortable."
The boy any the girl don't care who goes to the left and who goes to the right. The difference is only that if the boy goes to the left of the girl, he will take her left hand with his right one, and if he goes to the right of the girl, then it is vice versa.
|
The first line contains two positive integers not exceeding 100. They are the number of fingers on the Venusian girl's left and right hand correspondingly. The second line contains two integers not exceeding 100. They are the number of fingers on the Marsian boy's left and right hands correspondingly.
|
Print YES or NO, that is, the answer to Petr Palych's question.
|
[
"5 1\n10 5\n",
"4 5\n3 3\n",
"1 2\n11 6\n"
] |
[
"YES",
"YES",
"NO"
] |
The boy and the girl don't really care who goes to the left.
| 500
|
[
{
"input": "5 1\n10 5",
"output": "YES"
},
{
"input": "4 5\n3 3",
"output": "YES"
},
{
"input": "1 2\n11 6",
"output": "NO"
},
{
"input": "1 1\n1 1",
"output": "YES"
},
{
"input": "2 2\n1 1",
"output": "YES"
},
{
"input": "3 3\n1 1",
"output": "NO"
},
{
"input": "4 4\n1 1",
"output": "NO"
},
{
"input": "100 100\n50 50",
"output": "NO"
},
{
"input": "100 3\n4 1",
"output": "YES"
},
{
"input": "100 5\n1 1",
"output": "NO"
},
{
"input": "100 4\n1 1",
"output": "NO"
},
{
"input": "100 1\n4 1",
"output": "YES"
},
{
"input": "1 100\n1 4",
"output": "YES"
},
{
"input": "1 100\n5 4",
"output": "YES"
},
{
"input": "1 100\n1 5",
"output": "NO"
},
{
"input": "43 100\n65 24",
"output": "NO"
},
{
"input": "4 2\n12 1",
"output": "NO"
},
{
"input": "6 11\n13 11",
"output": "YES"
},
{
"input": "2 6\n12 12",
"output": "YES"
},
{
"input": "14 7\n2 9",
"output": "NO"
},
{
"input": "1 14\n7 14",
"output": "NO"
},
{
"input": "6 11\n2 10",
"output": "YES"
},
{
"input": "5 12\n13 11",
"output": "YES"
},
{
"input": "15 1\n11 9",
"output": "NO"
},
{
"input": "7 12\n10 6",
"output": "YES"
},
{
"input": "15 7\n15 15",
"output": "YES"
},
{
"input": "1 5\n14 1",
"output": "YES"
},
{
"input": "2 4\n6 6",
"output": "YES"
},
{
"input": "12 8\n4 12",
"output": "YES"
},
{
"input": "6 14\n5 5",
"output": "YES"
},
{
"input": "19 17\n5 8",
"output": "NO"
},
{
"input": "9 21\n13 16",
"output": "YES"
},
{
"input": "11 2\n11 22",
"output": "YES"
},
{
"input": "15 3\n12 16",
"output": "YES"
},
{
"input": "13 2\n13 5",
"output": "NO"
},
{
"input": "21 1\n5 19",
"output": "NO"
},
{
"input": "9 15\n16 2",
"output": "YES"
},
{
"input": "7 18\n23 19",
"output": "YES"
},
{
"input": "13 17\n19 1",
"output": "YES"
},
{
"input": "5 15\n13 9",
"output": "YES"
},
{
"input": "11 17\n6 4",
"output": "NO"
},
{
"input": "18 3\n16 15",
"output": "NO"
},
{
"input": "5 23\n12 17",
"output": "NO"
},
{
"input": "25 8\n14 24",
"output": "YES"
},
{
"input": "18 22\n22 19",
"output": "YES"
},
{
"input": "2 25\n8 24",
"output": "NO"
},
{
"input": "7 25\n18 15",
"output": "YES"
},
{
"input": "8 22\n2 3",
"output": "NO"
},
{
"input": "25 9\n16 12",
"output": "YES"
},
{
"input": "19 4\n25 17",
"output": "NO"
},
{
"input": "24 43\n96 39",
"output": "YES"
},
{
"input": "13 23\n19 63",
"output": "NO"
},
{
"input": "93 12\n87 54",
"output": "NO"
},
{
"input": "94 35\n53 79",
"output": "YES"
},
{
"input": "65 8\n73 25",
"output": "NO"
},
{
"input": "25 14\n19 91",
"output": "YES"
},
{
"input": "58 86\n40 46",
"output": "NO"
},
{
"input": "82 60\n100 38",
"output": "YES"
},
{
"input": "36 62\n81 12",
"output": "YES"
},
{
"input": "30 38\n12 100",
"output": "NO"
}
] | 1,667,660,525
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 60
| 156
| 0
|
A1,A2=map(int,input().split())
B1,B2=map(int,input().split())
print("YES" if A2-1<=B1<=(A2-1)*2+4 or A1-1<=B2<=(A1-1)*2+4 else "NO")
|
Title: A Student's Dream
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Statistics claims that students sleep no more than three hours a day. But even in the world of their dreams, while they are snoring peacefully, the sense of impending doom is still upon them.
A poor student is dreaming that he is sitting the mathematical analysis exam. And he is examined by the most formidable professor of all times, a three times Soviet Union Hero, a Noble Prize laureate in student expulsion, venerable Petr Palych.
The poor student couldn't answer a single question. Thus, instead of a large spacious office he is going to apply for a job to thorium mines. But wait a minute! Petr Palych decided to give the student the last chance! Yes, that is possible only in dreams.
So the professor began: "Once a Venusian girl and a Marsian boy met on the Earth and decided to take a walk holding hands. But the problem is the girl has *a**l* fingers on her left hand and *a**r* fingers on the right one. The boy correspondingly has *b**l* and *b**r* fingers. They can only feel comfortable when holding hands, when no pair of the girl's fingers will touch each other. That is, they are comfortable when between any two girl's fingers there is a boy's finger. And in addition, no three fingers of the boy should touch each other. Determine if they can hold hands so that the both were comfortable."
The boy any the girl don't care who goes to the left and who goes to the right. The difference is only that if the boy goes to the left of the girl, he will take her left hand with his right one, and if he goes to the right of the girl, then it is vice versa.
Input Specification:
The first line contains two positive integers not exceeding 100. They are the number of fingers on the Venusian girl's left and right hand correspondingly. The second line contains two integers not exceeding 100. They are the number of fingers on the Marsian boy's left and right hands correspondingly.
Output Specification:
Print YES or NO, that is, the answer to Petr Palych's question.
Demo Input:
['5 1\n10 5\n', '4 5\n3 3\n', '1 2\n11 6\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
The boy and the girl don't really care who goes to the left.
|
```python
A1,A2=map(int,input().split())
B1,B2=map(int,input().split())
print("YES" if A2-1<=B1<=(A2-1)*2+4 or A1-1<=B2<=(A1-1)*2+4 else "NO")
```
| 3.961
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,587,637,002
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 218
| 0
|
def main():
y,w=[int(x) for x in input().split()]
temp=max(y,w)
ans=7-temp
if ans==1:
print('1/6')
elif ans==2:
print('1/3')
elif ans==3:
print('1/2')
elif ans==4:
print('2/3')
elif ans==5:
print('5/6')
elif ans==6:
print('1/1')
main()
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
def main():
y,w=[int(x) for x in input().split()]
temp=max(y,w)
ans=7-temp
if ans==1:
print('1/6')
elif ans==2:
print('1/3')
elif ans==3:
print('1/2')
elif ans==4:
print('2/3')
elif ans==5:
print('5/6')
elif ans==6:
print('1/1')
main()
```
| 3.891
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,673,034,077
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
t=input()
s=input()
if s==t[-1::-1]:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
t=input()
s=input()
if s==t[-1::-1]:
print("YES")
else:
print("NO")
```
| 3.977
|
469
|
A
|
I Wanna Be the Guy
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation"
] | null | null |
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
|
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
|
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
|
[
"4\n3 1 2 3\n2 2 4\n",
"4\n3 1 2 3\n2 2 3\n"
] |
[
"I become the guy.\n",
"Oh, my keyboard!\n"
] |
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
| 500
|
[
{
"input": "4\n3 1 2 3\n2 2 4",
"output": "I become the guy."
},
{
"input": "4\n3 1 2 3\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "10\n5 8 6 1 5 4\n6 1 3 2 9 4 6",
"output": "Oh, my keyboard!"
},
{
"input": "10\n8 8 10 7 3 1 4 2 6\n8 9 5 10 3 7 2 4 8",
"output": "I become the guy."
},
{
"input": "10\n9 6 1 8 3 9 7 5 10 4\n7 1 3 2 7 6 9 5",
"output": "I become the guy."
},
{
"input": "100\n75 83 69 73 30 76 37 48 14 41 42 21 35 15 50 61 86 85 46 3 31 13 78 10 2 44 80 95 56 82 38 75 77 4 99 9 84 53 12 11 36 74 39 72 43 89 57 28 54 1 51 66 27 22 93 59 68 88 91 29 7 20 63 8 52 23 64 58 100 79 65 49 96 71 33 45\n83 50 89 73 34 28 99 67 77 44 19 60 68 42 8 27 94 85 14 39 17 78 24 21 29 63 92 32 86 22 71 81 31 82 65 48 80 59 98 3 70 55 37 12 15 72 47 9 11 33 16 7 91 74 13 64 38 84 6 61 93 90 45 69 1 54 52 100 57 10 35 49 53 75 76 43 62 5 4 18 36 96 79 23",
"output": "Oh, my keyboard!"
},
{
"input": "1\n1 1\n1 1",
"output": "I become the guy."
},
{
"input": "1\n0\n1 1",
"output": "I become the guy."
},
{
"input": "1\n1 1\n0",
"output": "I become the guy."
},
{
"input": "1\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n44 71 70 55 49 43 16 53 7 95 58 56 38 76 67 94 20 73 29 90 25 30 8 84 5 14 77 52 99 91 66 24 39 37 22 44 78 12 63 59 32 51 15 82 34\n56 17 10 96 80 69 13 81 31 57 4 48 68 89 50 45 3 33 36 2 72 100 64 87 21 75 54 74 92 65 23 40 97 61 18 28 98 93 35 83 9 79 46 27 41 62 88 6 47 60 86 26 42 85 19 1 11",
"output": "I become the guy."
},
{
"input": "100\n78 63 59 39 11 58 4 2 80 69 22 95 90 26 65 16 30 100 66 99 67 79 54 12 23 28 45 56 70 74 60 82 73 91 68 43 92 75 51 21 17 97 86 44 62 47 85 78 72 64 50 81 71 5 57 13 31 76 87 9 49 96 25 42 19 35 88 53 7 83 38 27 29 41 89 93 10 84 18\n78 1 16 53 72 99 9 36 59 49 75 77 94 79 35 4 92 42 82 83 76 97 20 68 55 47 65 50 14 30 13 67 98 8 7 40 64 32 87 10 33 90 93 18 26 71 17 46 24 28 89 58 37 91 39 34 25 48 84 31 96 95 80 88 3 51 62 52 85 61 12 15 27 6 45 38 2 22 60",
"output": "I become the guy."
},
{
"input": "2\n2 2 1\n0",
"output": "I become the guy."
},
{
"input": "2\n1 2\n2 1 2",
"output": "I become the guy."
},
{
"input": "80\n57 40 1 47 36 69 24 76 5 72 26 4 29 62 6 60 3 70 8 64 18 37 16 14 13 21 25 7 66 68 44 74 61 39 38 33 15 63 34 65 10 23 56 51 80 58 49 75 71 12 50 57 2 30 54 27 17 52\n61 22 67 15 28 41 26 1 80 44 3 38 18 37 79 57 11 7 65 34 9 36 40 5 48 29 64 31 51 63 27 4 50 13 24 32 58 23 19 46 8 73 39 2 21 56 77 53 59 78 43 12 55 45 30 74 33 68 42 47 17 54",
"output": "Oh, my keyboard!"
},
{
"input": "100\n78 87 96 18 73 32 38 44 29 64 40 70 47 91 60 69 24 1 5 34 92 94 99 22 83 65 14 68 15 20 74 31 39 100 42 4 97 46 25 6 8 56 79 9 71 35 54 19 59 93 58 62 10 85 57 45 33 7 86 81 30 98 26 61 84 41 23 28 88 36 66 51 80 53 37 63 43 95 75\n76 81 53 15 26 37 31 62 24 87 41 39 75 86 46 76 34 4 51 5 45 65 67 48 68 23 71 27 94 47 16 17 9 96 84 89 88 100 18 52 69 42 6 92 7 64 49 12 98 28 21 99 25 55 44 40 82 19 36 30 77 90 14 43 50 3 13 95 78 35 20 54 58 11 2 1 33",
"output": "Oh, my keyboard!"
},
{
"input": "100\n77 55 26 98 13 91 78 60 23 76 12 11 36 62 84 80 18 1 68 92 81 67 19 4 2 10 17 77 96 63 15 69 46 97 82 42 83 59 50 72 14 40 89 9 52 29 56 31 74 39 45 85 22 99 44 65 95 6 90 38 54 32 49 34 3 70 75 33 94 53 21 71 5 66 73 41 100 24\n69 76 93 5 24 57 59 6 81 4 30 12 44 15 67 45 73 3 16 8 47 95 20 64 68 85 54 17 90 86 66 58 13 37 42 51 35 32 1 28 43 80 7 14 48 19 62 55 2 91 25 49 27 26 38 79 89 99 22 60 75 53 88 82 34 21 87 71 72 61",
"output": "I become the guy."
},
{
"input": "100\n74 96 32 63 12 69 72 99 15 22 1 41 79 77 71 31 20 28 75 73 85 37 38 59 42 100 86 89 55 87 68 4 24 57 52 8 92 27 56 98 95 58 34 9 45 14 11 36 66 76 61 19 25 23 78 49 90 26 80 43 70 13 65 10 5 74 81 21 44 60 97 3 47 93 6\n64 68 21 27 16 91 23 22 33 12 71 88 90 50 62 43 28 29 57 59 5 74 10 95 35 1 67 93 36 32 86 40 6 64 78 46 89 15 84 53 18 30 17 85 2 3 47 92 25 48 76 51 20 82 52 83 99 63 80 11 94 54 39 7 58",
"output": "I become the guy."
},
{
"input": "100\n75 11 98 44 47 88 94 23 78 59 70 2 43 39 34 63 71 19 42 61 30 74 14 77 97 53 92 60 67 36 37 13 6 86 62 46 41 3 25 93 7 12 27 48 55 49 31 35 51 10 57 54 95 82 28 90 73 26 17 50 81 56 20 87 40 85 72 64 99 29 91 5 80 18 24 52\n72 93 59 5 88 47 9 58 48 1 43 50 100 87 61 91 45 98 99 56 25 84 53 73 78 54 63 38 37 2 77 95 89 85 4 90 10 33 12 22 74 32 34 70 71 52 96 57 15 66 31 27 75 8 21 39 62 44 67 94 81 68 14 19 36 28 11 79 16 65 46 83 76",
"output": "Oh, my keyboard!"
},
{
"input": "3\n1 2\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "4\n1 2\n3 1 3 4",
"output": "I become the guy."
},
{
"input": "6\n2 1 2\n3 4 5 6",
"output": "Oh, my keyboard!"
}
] | 1,691,865,584
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 0
|
def can_pass_all_levels(n, p_levels, q_levels):
levels = [False] * n
for level in p_levels:
levels[level - 1] = True
for level in q_levels:
levels[level - 1] = True
for level in levels:
if not level:
return False
return True
n = int(input())
p_levels = list(map(int, input().split()))[1:]
q_levels = list(map(int, input().split()))[1:]
if can_pass_all_levels(n, p_levels, q_levels):
print("I become the guy.")
else:
print("Oh, my keyboard!")
|
Title: I Wanna Be the Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
Input Specification:
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
Output Specification:
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
Demo Input:
['4\n3 1 2 3\n2 2 4\n', '4\n3 1 2 3\n2 2 3\n']
Demo Output:
['I become the guy.\n', 'Oh, my keyboard!\n']
Note:
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
|
```python
def can_pass_all_levels(n, p_levels, q_levels):
levels = [False] * n
for level in p_levels:
levels[level - 1] = True
for level in q_levels:
levels[level - 1] = True
for level in levels:
if not level:
return False
return True
n = int(input())
p_levels = list(map(int, input().split()))[1:]
q_levels = list(map(int, input().split()))[1:]
if can_pass_all_levels(n, p_levels, q_levels):
print("I become the guy.")
else:
print("Oh, my keyboard!")
```
| 3
|
|
120
|
C
|
Winnie-the-Pooh and honey
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
As we all know, Winnie-the-Pooh just adores honey. Ones he and the Piglet found out that the Rabbit has recently gotten hold of an impressive amount of this sweet and healthy snack. As you may guess, Winnie and the Piglet asked to come at the Rabbit's place. Thus, there are *n* jars of honey lined up in front of Winnie-the-Pooh, jar number *i* contains *a**i* kilos of honey. Winnie-the-Pooh eats the honey like that: each time he chooses a jar containing most honey. If the jar has less that *k* kilos of honey or if Winnie-the-Pooh has already eaten from it three times, he gives the jar to Piglet. Otherwise he eats exactly *k* kilos of honey from the jar and puts it back. Winnie does so until he gives all jars to the Piglet. Count how much honey Piglet will overall get after Winnie satisfies his hunger.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, separated by spaces (1<=≤<=*a**i*<=≤<=100).
|
Print a single number — how many kilos of honey gets Piglet.
|
[
"3 3\n15 8 10\n"
] |
[
"9\n"
] |
none
| 0
|
[
{
"input": "3 3\n15 8 10",
"output": "9"
},
{
"input": "1 3\n3",
"output": "0"
},
{
"input": "3 4\n3 8 2",
"output": "5"
},
{
"input": "3 2\n95 25 49",
"output": "151"
},
{
"input": "3 1\n8 3 2",
"output": "5"
},
{
"input": "5 1\n4 7 9 5 7",
"output": "17"
},
{
"input": "8 6\n19 15 1 14 7 2 10 14",
"output": "16"
},
{
"input": "8 5\n5 2 17 12 16 12 17 3",
"output": "14"
},
{
"input": "10 7\n26 11 10 8 5 20 9 27 30 9",
"output": "43"
},
{
"input": "10 10\n20 82 19 82 18 96 40 99 87 2",
"output": "325"
},
{
"input": "10 10\n75 52 78 83 60 31 46 28 33 17",
"output": "233"
},
{
"input": "20 5\n33 45 36 13 46 40 15 11 29 44 43 50 14 19 46 46 46 26 42 6",
"output": "375"
},
{
"input": "20 2\n4 2 6 9 8 4 4 7 2 3 7 7 10 6 3 5 2 9 8 5",
"output": "21"
},
{
"input": "30 3\n20 37 89 77 74 6 52 87 19 58 3 38 40 38 42 12 1 23 29 38 12 65 15 1 92 45 23 94 61 73",
"output": "1021"
},
{
"input": "30 2\n10 5 46 30 28 18 24 35 73 2 10 24 72 86 97 95 71 12 14 57 27 94 81 59 43 77 22 58 16 96",
"output": "1208"
},
{
"input": "50 13\n53 55 51 81 59 22 11 20 30 80 38 17 8 38 69 52 11 74 16 38 80 97 39 74 78 56 75 28 4 58 80 88 78 89 95 8 13 70 36 29 49 15 74 44 19 52 42 59 92 37",
"output": "1012"
},
{
"input": "100 33\n84 70 12 53 10 38 4 66 42 1 100 98 42 10 31 26 22 94 19 43 86 5 37 64 77 98 81 40 17 66 52 43 5 7 79 92 44 78 9 95 10 86 42 56 34 91 12 17 26 16 24 99 11 37 89 100 60 74 32 66 13 29 3 24 41 99 93 87 85 74 5 3 70 46 23 12 43 10 24 32 95 2 57 86 29 100 29 62 17 24 4 40 40 73 29 11 69 89 10 31",
"output": "1467"
},
{
"input": "100 12\n90 59 100 12 82 31 66 28 7 13 43 42 48 94 60 32 20 92 37 39 22 55 14 23 77 56 21 55 10 89 93 79 5 80 40 80 6 15 56 82 68 61 32 100 23 7 13 92 32 82 17 85 49 85 13 75 4 7 42 14 84 22 50 12 11 75 4 85 32 96 56 13 34 100 66 37 58 58 24 58 81 63 59 55 89 97 90 69 29 11 71 58 58 43 72 96 81 72 14 64",
"output": "2377"
},
{
"input": "100 3\n92 51 91 67 32 97 40 24 78 72 93 90 57 77 66 13 55 24 17 90 65 35 69 97 79 31 85 2 90 80 49 44 73 77 34 45 74 75 35 14 34 56 60 54 36 55 16 49 12 54 92 68 70 71 5 79 67 89 64 80 20 84 4 39 55 84 53 59 68 11 89 89 15 73 67 86 91 78 49 24 58 83 55 34 82 97 27 29 78 15 20 48 9 87 41 34 91 76 82 44",
"output": "4839"
},
{
"input": "100 1\n85 75 55 65 39 26 47 16 9 11 3 4 70 23 56 64 36 34 16 13 18 28 32 80 8 79 76 4 21 75 93 51 85 86 100 88 91 71 97 28 66 22 47 87 91 95 3 56 81 53 88 90 21 30 74 45 58 73 36 40 70 51 28 75 20 54 69 52 14 48 52 53 91 81 32 68 16 48 60 66 91 32 55 42 93 51 3 46 23 64 39 1 30 42 20 83 99 29 35 59",
"output": "4801"
}
] | 1,647,664,176
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 122
| 0
|
fin = open('input.txt', 'r')
fout = open('output.txt', 'w')
n, k = list(map(int, fin.readline().split()))
arr = list(map(int, fin.readline().split()))
sum = 0
for e in arr:
if (e//k) > 3:
sum += e - 3*k
else:
sum += e%k
fout.write(str(sum))
fout.close()
fin.close()
|
Title: Winnie-the-Pooh and honey
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As we all know, Winnie-the-Pooh just adores honey. Ones he and the Piglet found out that the Rabbit has recently gotten hold of an impressive amount of this sweet and healthy snack. As you may guess, Winnie and the Piglet asked to come at the Rabbit's place. Thus, there are *n* jars of honey lined up in front of Winnie-the-Pooh, jar number *i* contains *a**i* kilos of honey. Winnie-the-Pooh eats the honey like that: each time he chooses a jar containing most honey. If the jar has less that *k* kilos of honey or if Winnie-the-Pooh has already eaten from it three times, he gives the jar to Piglet. Otherwise he eats exactly *k* kilos of honey from the jar and puts it back. Winnie does so until he gives all jars to the Piglet. Count how much honey Piglet will overall get after Winnie satisfies his hunger.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, separated by spaces (1<=≤<=*a**i*<=≤<=100).
Output Specification:
Print a single number — how many kilos of honey gets Piglet.
Demo Input:
['3 3\n15 8 10\n']
Demo Output:
['9\n']
Note:
none
|
```python
fin = open('input.txt', 'r')
fout = open('output.txt', 'w')
n, k = list(map(int, fin.readline().split()))
arr = list(map(int, fin.readline().split()))
sum = 0
for e in arr:
if (e//k) > 3:
sum += e - 3*k
else:
sum += e%k
fout.write(str(sum))
fout.close()
fin.close()
```
| 3
|
|
52
|
A
|
123-sequence
|
PROGRAMMING
| 900
|
[
"implementation"
] |
A. 123-sequence
|
2
|
256
|
There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3).
|
Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal.
|
[
"9\n1 3 2 2 2 1 1 2 3\n"
] |
[
"5\n"
] |
In the example all the numbers equal to 1 and 3 should be replaced by 2.
| 500
|
[
{
"input": "9\n1 3 2 2 2 1 1 2 3",
"output": "5"
},
{
"input": "6\n3 3 2 2 1 3",
"output": "3"
},
{
"input": "12\n3 1 3 1 2 1 3 2 2 1 2 1",
"output": "7"
},
{
"input": "15\n3 2 1 1 1 1 3 2 2 3 3 1 2 3 2",
"output": "10"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n3 2",
"output": "1"
},
{
"input": "2\n3 1",
"output": "1"
},
{
"input": "18\n2 3 2 1 2 3 2 1 2 3 3 3 1 2 3 3 3 2",
"output": "10"
},
{
"input": "30\n2 1 3 2 3 2 2 2 2 3 2 2 3 2 1 1 3 1 3 2 1 2 3 1 1 3 3 1 3 1",
"output": "19"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
}
] | 1,695,646,572
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 23
| 528
| 97,484,800
|
n=int(input())
a=list(map(int,input().split()))[:n]
x=0
y=0
z=0
for i in range(n):
if a[i]==1:
x+=1
elif a[i]==2:
y+=1
else:
z+=1
if x==y and x==z:
print(n-x)
else:
if x>=y and x>=z:
print(n-x)
elif y>=x and y>=z:
print(n-y)
else:
print(n-z)
|
Title: 123-sequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3).
Output Specification:
Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal.
Demo Input:
['9\n1 3 2 2 2 1 1 2 3\n']
Demo Output:
['5\n']
Note:
In the example all the numbers equal to 1 and 3 should be replaced by 2.
|
```python
n=int(input())
a=list(map(int,input().split()))[:n]
x=0
y=0
z=0
for i in range(n):
if a[i]==1:
x+=1
elif a[i]==2:
y+=1
else:
z+=1
if x==y and x==z:
print(n-x)
else:
if x>=y and x>=z:
print(n-x)
elif y>=x and y>=z:
print(n-y)
else:
print(n-z)
```
| 3.68642
|
551
|
A
|
GukiZ and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
|
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
|
[
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] |
[
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] |
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
| 500
|
[
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,504,557,250
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 77
| 307,200
|
n = int(input())
ratings = [(i,int(x)) for i,x in enumerate(input().split())]
out = [0]*n
ratings = sorted(ratings, key = lambda x: x[1], reverse=True)
pos = 0
score = 0
count = 1
for r in ratings:
r_score = r[1]
if r_score != score:
score = r_score
pos +=count
count = 1
else:
count += 1
out[r[0]] = pos
print (' '.join(str(x) for x in out))
|
Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
|
```python
n = int(input())
ratings = [(i,int(x)) for i,x in enumerate(input().split())]
out = [0]*n
ratings = sorted(ratings, key = lambda x: x[1], reverse=True)
pos = 0
score = 0
count = 1
for r in ratings:
r_score = r[1]
if r_score != score:
score = r_score
pos +=count
count = 1
else:
count += 1
out[r[0]] = pos
print (' '.join(str(x) for x in out))
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,674,627,693
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 62
| 0
|
# -*- coding: utf-8 -*-
# @Author: Fei_xiangShi
# @Date: 2023-01-25 14:18:18
# @Last Modified by: FXS
# @Last Modified time: 2023-01-25 14:21:29
n = int(input())
for _ in range(n):
a = input()
if len(a) < 11:
print(a)
else:
print(a[0]+str(len(a)-2)+a[-1])
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
# @Author: Fei_xiangShi
# @Date: 2023-01-25 14:18:18
# @Last Modified by: FXS
# @Last Modified time: 2023-01-25 14:21:29
n = int(input())
for _ in range(n):
a = input()
if len(a) < 11:
print(a)
else:
print(a[0]+str(len(a)-2)+a[-1])
```
| 3.969
|
137
|
B
|
Permutation
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
"Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
|
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*).
|
Print the only number — the minimum number of changes needed to get the permutation.
|
[
"3\n3 1 2\n",
"2\n2 2\n",
"5\n5 3 3 3 1\n"
] |
[
"0\n",
"1\n",
"2\n"
] |
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2.
| 1,000
|
[
{
"input": "3\n3 1 2",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "5\n5 3 3 3 1",
"output": "2"
},
{
"input": "5\n6 6 6 6 6",
"output": "5"
},
{
"input": "10\n1 1 2 2 8 8 7 7 9 9",
"output": "5"
},
{
"input": "8\n9 8 7 6 5 4 3 2",
"output": "1"
},
{
"input": "15\n1 2 3 4 5 5 4 3 2 1 1 2 3 4 5",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n5000",
"output": "1"
},
{
"input": "4\n5000 5000 5000 5000",
"output": "4"
},
{
"input": "5\n3366 3461 4 5 4370",
"output": "3"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "0"
},
{
"input": "10\n551 3192 3213 2846 3068 1224 3447 1 10 9",
"output": "7"
},
{
"input": "15\n4 1459 12 4281 3241 2748 10 3590 14 845 3518 1721 2 2880 1974",
"output": "10"
},
{
"input": "15\n15 1 8 2 13 11 12 7 3 14 6 10 9 4 5",
"output": "0"
},
{
"input": "15\n2436 2354 4259 1210 2037 2665 700 3578 2880 973 1317 1024 24 3621 4142",
"output": "15"
},
{
"input": "30\n28 1 3449 9 3242 4735 26 3472 15 21 2698 7 4073 3190 10 3 29 1301 4526 22 345 3876 19 12 4562 2535 2 630 18 27",
"output": "14"
},
{
"input": "100\n50 39 95 30 66 78 2169 4326 81 31 74 34 80 40 19 48 97 63 82 6 88 16 21 57 92 77 10 1213 17 93 32 91 38 4375 29 75 44 22 4 45 14 2395 3254 59 3379 2 85 96 8 83 27 94 1512 2960 100 9 73 79 7 25 55 69 90 99 51 87 98 62 18 35 43 4376 4668 28 72 56 4070 61 65 36 54 4106 11 24 15 86 70 71 4087 23 13 76 20 4694 26 4962 4726 37 14 64",
"output": "18"
},
{
"input": "100\n340 14 3275 2283 2673 1107 817 2243 1226 32 2382 3638 4652 418 68 4962 387 764 4647 159 1846 225 2760 4904 3150 403 3 2439 91 4428 92 4705 75 348 1566 1465 69 6 49 4 62 4643 564 1090 3447 1871 2255 139 24 99 2669 969 86 61 4550 158 4537 3993 1589 872 2907 1888 401 80 1825 1483 63 1 2264 4068 4113 2548 41 885 4806 36 67 167 4447 34 1248 2593 82 202 81 1783 1284 4973 16 43 95 7 865 2091 3008 1793 20 947 4912 3604",
"output": "70"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "2\n5000 5000",
"output": "2"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
},
{
"input": "2\n3 4",
"output": "2"
},
{
"input": "10\n1 2 3 4 5 6 7 1000 10 10",
"output": "2"
}
] | 1,619,336,452
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 124
| 409,600
|
n=int(input())
a={*map(int,input().split())}
k=0
for i in range(1,n+1):
if i not in a:k+=1
print(k)
|
Title: Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
Input Specification:
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*).
Output Specification:
Print the only number — the minimum number of changes needed to get the permutation.
Demo Input:
['3\n3 1 2\n', '2\n2 2\n', '5\n5 3 3 3 1\n']
Demo Output:
['0\n', '1\n', '2\n']
Note:
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2.
|
```python
n=int(input())
a={*map(int,input().split())}
k=0
for i in range(1,n+1):
if i not in a:k+=1
print(k)
```
| 3
|
|
764
|
B
|
Timofey and cubes
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"implementation"
] | null | null |
Young Timofey has a birthday today! He got kit of *n* cubes as a birthday present from his parents. Every cube has a number *a**i*, which is written on it. Timofey put all the cubes in a row and went to unpack other presents.
In this time, Timofey's elder brother, Dima reordered the cubes using the following rule. Suppose the cubes are numbered from 1 to *n* in their order. Dima performs several steps, on step *i* he reverses the segment of cubes from *i*-th to (*n*<=-<=*i*<=+<=1)-th. He does this while *i*<=≤<=*n*<=-<=*i*<=+<=1.
After performing the operations Dima went away, being very proud of himself. When Timofey returned to his cubes, he understood that their order was changed. Help Timofey as fast as you can and save the holiday — restore the initial order of the cubes using information of their current location.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of cubes.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109), where *a**i* is the number written on the *i*-th cube after Dima has changed their order.
|
Print *n* integers, separated by spaces — the numbers written on the cubes in their initial order.
It can be shown that the answer is unique.
|
[
"7\n4 3 7 6 9 1 2\n",
"8\n6 1 4 2 5 6 9 2\n"
] |
[
"2 3 9 6 7 1 4",
"2 1 6 2 5 4 9 6"
] |
Consider the first sample.
1. At the begining row was [2, 3, 9, 6, 7, 1, 4]. 1. After first operation row was [4, 1, 7, 6, 9, 3, 2]. 1. After second operation row was [4, 3, 9, 6, 7, 1, 2]. 1. After third operation row was [4, 3, 7, 6, 9, 1, 2]. 1. At fourth operation we reverse just middle element, so nothing has changed. The final row is [4, 3, 7, 6, 9, 1, 2]. So the answer for this case is row [2, 3, 9, 6, 7, 1, 4].
| 1,000
|
[
{
"input": "7\n4 3 7 6 9 1 2",
"output": "2 3 9 6 7 1 4"
},
{
"input": "8\n6 1 4 2 5 6 9 2",
"output": "2 1 6 2 5 4 9 6"
},
{
"input": "1\n1424",
"output": "1424"
},
{
"input": "9\n-7 9 -4 9 -6 11 15 2 -10",
"output": "-10 9 15 9 -6 11 -4 2 -7"
},
{
"input": "2\n21968 5686",
"output": "5686 21968"
},
{
"input": "5\n241218936 -825949895 -84926813 491336344 -872198236",
"output": "-872198236 -825949895 -84926813 491336344 241218936"
},
{
"input": "42\n-557774624 828320986 -345782722 -62979938 -681259411 -945983652 -139095040 832293378 -82572118 432027535 88438103 568183540 961782904 73543295 615958219 -5050584 322982437 -146046730 759453379 129267920 -819827396 -348156048 805080102 390723009 -771277251 -79011872 -592313207 528489973 656201270 -127795621 17284747 145139617 -565641608 83452176 -223074608 545811186 -657981923 -204657836 154779765 -476867246 180386291 202782486",
"output": "202782486 828320986 -476867246 -62979938 -204657836 -945983652 545811186 832293378 83452176 432027535 145139617 568183540 -127795621 73543295 528489973 -5050584 -79011872 -146046730 390723009 129267920 -348156048 -819827396 805080102 759453379 -771277251 322982437 -592313207 615958219 656201270 961782904 17284747 88438103 -565641608 -82572118 -223074608 -139095040 -657981923 -681259411 154779765 -345782722 180386291 -557774624"
},
{
"input": "2\n1 2",
"output": "2 1"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 2 4 3 5 1"
},
{
"input": "4\n0 1 2 3",
"output": "3 1 2 0"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10 2 8 4 6 5 7 3 9 1"
},
{
"input": "2\n4 5",
"output": "5 4"
},
{
"input": "2\n1 5",
"output": "5 1"
},
{
"input": "2\n2 5",
"output": "5 2"
},
{
"input": "2\n3 4",
"output": "4 3"
},
{
"input": "2\n10 0",
"output": "0 10"
},
{
"input": "66\n8229 5299 5562 1259 2258 1126 5026 8796 3497 7111 6680 1180 1426 4821 3322 3502 400 2951 4187 417 5234 1266 7525 7648 417 9297 174 670 1790 4121 9737 938 4616 3402 2009 2461 474 3728 327 3353 9773 6818 8781 874 2209 1260 1647 6126 9287 9638 5049 1256 4459 863 1835 4822 6809 348 5053 7784 6927 2140 9173 7817 5095 4184",
"output": "4184 5299 7817 1259 2140 1126 7784 8796 348 7111 4822 1180 863 4821 1256 3502 9638 2951 6126 417 1260 1266 874 7648 6818 9297 3353 670 3728 4121 2461 938 3402 4616 2009 9737 474 1790 327 174 9773 417 8781 7525 2209 5234 1647 4187 9287 400 5049 3322 4459 1426 1835 6680 6809 3497 5053 5026 6927 2258 9173 5562 5095 8229"
}
] | 1,510,233,313
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 764
| 20,070,400
|
n = int(input())
a = list(map(int, input().split()))
if n % 2 == 0:
for i in range(n//2):
if i % 2 == 0:
print(a[-i - 1], end=' ')
else:
print(a[i], end=' ')
for i in range(n//2, n):
if i % 2 == 0:
print(a[i], end=' ')
else:
print(a[-i - 1], end=' ')
else:
for i in range(n):
if i % 2 == 0:
print(a[-i - 1], end=' ')
else:
print(a[i], end=' ')
|
Title: Timofey and cubes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Young Timofey has a birthday today! He got kit of *n* cubes as a birthday present from his parents. Every cube has a number *a**i*, which is written on it. Timofey put all the cubes in a row and went to unpack other presents.
In this time, Timofey's elder brother, Dima reordered the cubes using the following rule. Suppose the cubes are numbered from 1 to *n* in their order. Dima performs several steps, on step *i* he reverses the segment of cubes from *i*-th to (*n*<=-<=*i*<=+<=1)-th. He does this while *i*<=≤<=*n*<=-<=*i*<=+<=1.
After performing the operations Dima went away, being very proud of himself. When Timofey returned to his cubes, he understood that their order was changed. Help Timofey as fast as you can and save the holiday — restore the initial order of the cubes using information of their current location.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of cubes.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109), where *a**i* is the number written on the *i*-th cube after Dima has changed their order.
Output Specification:
Print *n* integers, separated by spaces — the numbers written on the cubes in their initial order.
It can be shown that the answer is unique.
Demo Input:
['7\n4 3 7 6 9 1 2\n', '8\n6 1 4 2 5 6 9 2\n']
Demo Output:
['2 3 9 6 7 1 4', '2 1 6 2 5 4 9 6']
Note:
Consider the first sample.
1. At the begining row was [2, 3, 9, 6, 7, 1, 4]. 1. After first operation row was [4, 1, 7, 6, 9, 3, 2]. 1. After second operation row was [4, 3, 9, 6, 7, 1, 2]. 1. After third operation row was [4, 3, 7, 6, 9, 1, 2]. 1. At fourth operation we reverse just middle element, so nothing has changed. The final row is [4, 3, 7, 6, 9, 1, 2]. So the answer for this case is row [2, 3, 9, 6, 7, 1, 4].
|
```python
n = int(input())
a = list(map(int, input().split()))
if n % 2 == 0:
for i in range(n//2):
if i % 2 == 0:
print(a[-i - 1], end=' ')
else:
print(a[i], end=' ')
for i in range(n//2, n):
if i % 2 == 0:
print(a[i], end=' ')
else:
print(a[-i - 1], end=' ')
else:
for i in range(n):
if i % 2 == 0:
print(a[-i - 1], end=' ')
else:
print(a[i], end=' ')
```
| 3
|
|
382
|
A
|
Ksenia and Pan Scales
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
|
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
|
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
|
[
"AC|T\nL\n",
"|ABC\nXYZ\n",
"W|T\nF\n",
"ABC|\nD\n"
] |
[
"AC|TL\n",
"XYZ|ABC\n",
"Impossible\n",
"Impossible\n"
] |
none
| 500
|
[
{
"input": "AC|T\nL",
"output": "AC|TL"
},
{
"input": "|ABC\nXYZ",
"output": "XYZ|ABC"
},
{
"input": "W|T\nF",
"output": "Impossible"
},
{
"input": "ABC|\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDEF",
"output": "ADF|BCE"
},
{
"input": "|\nABC",
"output": "Impossible"
},
{
"input": "|\nZXCVBANMIO",
"output": "XVAMO|ZCBNI"
},
{
"input": "|C\nA",
"output": "A|C"
},
{
"input": "|\nAB",
"output": "B|A"
},
{
"input": "A|XYZ\nUIOPL",
"output": "Impossible"
},
{
"input": "K|B\nY",
"output": "Impossible"
},
{
"input": "EQJWDOHKZRBISPLXUYVCMNFGT|\nA",
"output": "Impossible"
},
{
"input": "|MACKERIGZPVHNDYXJBUFLWSO\nQT",
"output": "Impossible"
},
{
"input": "ERACGIZOVPT|WXUYMDLJNQS\nKB",
"output": "ERACGIZOVPTB|WXUYMDLJNQSK"
},
{
"input": "CKQHRUZMISGE|FBVWPXDLTJYN\nOA",
"output": "CKQHRUZMISGEA|FBVWPXDLTJYNO"
},
{
"input": "V|CMOEUTAXBFWSK\nDLRZJGIYNQHP",
"output": "VDLRZJGIYNQHP|CMOEUTAXBFWSK"
},
{
"input": "QWHNMALDGKTJ|\nPBRYVXZUESCOIF",
"output": "QWHNMALDGKTJF|PBRYVXZUESCOI"
},
{
"input": "|\nFXCVMUEWZAHNDOSITPRLKQJYBG",
"output": "XVUWANOIPLQYG|FCMEZHDSTRKJB"
},
{
"input": "IB|PCGHZ\nFXWTJQNEKAUM",
"output": "Impossible"
},
{
"input": "EC|IWAXQ\nJUHSRKGZTOMYN",
"output": "ECJUHRGTMN|IWAXQSKZOY"
},
{
"input": "VDINYMA|UQKWBCLRHZJ\nXEGOF",
"output": "Impossible"
},
{
"input": "ZLTPSIQUBAR|XFDEMYC\nHNOJWG",
"output": "ZLTPSIQUBARG|XFDEMYCHNOJW"
},
{
"input": "R|FLZOTJNU\nGIYHKVX",
"output": "RGIYHKVX|FLZOTJNU"
},
{
"input": "W|TL\nQROFSADYPKHEJNMXBZVUCIG",
"output": "WQOSDPHJMBVCG|TLRFAYKENXZUI"
},
{
"input": "NRDFQSEKLAYMOT|ZH\nGUXIBJCVPW",
"output": "Impossible"
},
{
"input": "FGRT|\nAC",
"output": "Impossible"
},
{
"input": "|FGRT\nAC",
"output": "Impossible"
},
{
"input": "A|\nB",
"output": "A|B"
},
{
"input": "|A\nB",
"output": "B|A"
},
{
"input": "|\nA",
"output": "Impossible"
},
{
"input": "|\nQWERTYUIOPASDFGHJKLZXCVBNM",
"output": "WRYIPSFHKZCBM|QETUOADGJLXVN"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBN|\nM",
"output": "Impossible"
},
{
"input": "QWERTY|VBN\nUIOPASDFGHJKLZXC",
"output": "Impossible"
},
{
"input": "ABC|D\nKSL",
"output": "Impossible"
},
{
"input": "A|BCDEF\nGH",
"output": "Impossible"
},
{
"input": "|ABC\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDE",
"output": "Impossible"
},
{
"input": "|ASD\nX",
"output": "Impossible"
},
{
"input": "AB|CDEF\nXYZRT",
"output": "Impossible"
}
] | 1,443,869,360
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 62
| 0
|
def main():
mode="filee"
if mode=="file":f=open("test.txt","r")
#f.readline()
#input()
get = lambda :[str(x) for x in (f.readline()[:-1] if mode=="file" else input()).split("|")]
scale = get()
q = input()
if abs(len(scale[0]) - len(scale[1]))%2 != len(q)%2 or abs(len(scale[0]) - len(scale[1]))>len(q):
print("Impossible")
return
if len(scale[0])<len(scale[1]):
mid = len(scale[1])-len(scale[0])
scale[0]+=q[:mid]
else:
mid = len(scale[0])-len(scale[1])
scale[1]+=q[:mid]
for z in range(mid,len(q),2):
scale[0]+=q[z]
scale[1]+=q[z+1]
print("|".join(scale))
if mode=="file":f.close()
if __name__=="__main__":
main()
|
Title: Ksenia and Pan Scales
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
Input Specification:
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
Output Specification:
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
Demo Input:
['AC|T\nL\n', '|ABC\nXYZ\n', 'W|T\nF\n', 'ABC|\nD\n']
Demo Output:
['AC|TL\n', 'XYZ|ABC\n', 'Impossible\n', 'Impossible\n']
Note:
none
|
```python
def main():
mode="filee"
if mode=="file":f=open("test.txt","r")
#f.readline()
#input()
get = lambda :[str(x) for x in (f.readline()[:-1] if mode=="file" else input()).split("|")]
scale = get()
q = input()
if abs(len(scale[0]) - len(scale[1]))%2 != len(q)%2 or abs(len(scale[0]) - len(scale[1]))>len(q):
print("Impossible")
return
if len(scale[0])<len(scale[1]):
mid = len(scale[1])-len(scale[0])
scale[0]+=q[:mid]
else:
mid = len(scale[0])-len(scale[1])
scale[1]+=q[:mid]
for z in range(mid,len(q),2):
scale[0]+=q[z]
scale[1]+=q[z+1]
print("|".join(scale))
if mode=="file":f.close()
if __name__=="__main__":
main()
```
| 3
|
|
620
|
A
|
Professor GukiZ's Robot
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
|
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
|
Print the only integer *d* — the minimal number of steps to get the finish position.
|
[
"0 0\n4 5\n",
"3 4\n6 1\n"
] |
[
"5\n",
"3\n"
] |
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
| 0
|
[
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,649,393,381
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 75
| 62
| 409,600
|
#!/usr/bin/env python
import math
import sys
import itertools
import fractions
if __name__ == '__main__':
wtf = sys.stdin.read()
wtf = wtf.strip().split('\n')
x1,y1 = map(int, wtf[0].split())
x2,y2 = map(int, wtf[1].split())
print(max(abs(y1-y2),abs(x1-x2)))
|
Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Output Specification:
Print the only integer *d* — the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
|
```python
#!/usr/bin/env python
import math
import sys
import itertools
import fractions
if __name__ == '__main__':
wtf = sys.stdin.read()
wtf = wtf.strip().split('\n')
x1,y1 = map(int, wtf[0].split())
x2,y2 = map(int, wtf[1].split())
print(max(abs(y1-y2),abs(x1-x2)))
```
| 3
|
|
614
|
B
|
Gena's Code
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
It's the year 4527 and the tanks game that we all know and love still exists. There also exists Great Gena's code, written in 2016. The problem this code solves is: given the number of tanks that go into the battle from each country, find their product. If it is turns to be too large, then the servers might have not enough time to assign tanks into teams and the whole game will collapse!
There are exactly *n* distinct countries in the world and the *i*-th country added *a**i* tanks to the game. As the developers of the game are perfectionists, the number of tanks from each country is beautiful. A beautiful number, according to the developers, is such number that its decimal representation consists only of digits '1' and '0', moreover it contains at most one digit '1'. However, due to complaints from players, some number of tanks of one country was removed from the game, hence the number of tanks of this country may not remain beautiful.
Your task is to write the program that solves exactly the same problem in order to verify Gena's code correctness. Just in case.
|
The first line of the input contains the number of countries *n* (1<=≤<=*n*<=≤<=100<=000). The second line contains *n* non-negative integers *a**i* without leading zeroes — the number of tanks of the *i*-th country.
It is guaranteed that the second line contains at least *n*<=-<=1 beautiful numbers and the total length of all these number's representations doesn't exceed 100<=000.
|
Print a single number without leading zeroes — the product of the number of tanks presented by each country.
|
[
"3\n5 10 1\n",
"4\n1 1 10 11\n",
"5\n0 3 1 100 1\n"
] |
[
"50",
"110",
"0"
] |
In sample 1 numbers 10 and 1 are beautiful, number 5 is not not.
In sample 2 number 11 is not beautiful (contains two '1's), all others are beautiful.
In sample 3 number 3 is not beautiful, all others are beautiful.
| 1,000
|
[
{
"input": "3\n5 10 1",
"output": "50"
},
{
"input": "4\n1 1 10 11",
"output": "110"
},
{
"input": "5\n0 3 1 100 1",
"output": "0"
},
{
"input": "40\n10 100 10 1 10 10 100 10 10 100 10 100 100 10 1824868942 100 100 1 10 100 100 10 100 100 10 100 10 1 10 100 100 100 10 1 10 1 10 10 100 100",
"output": "1824868942000000000000000000000000000000000000000000000000000"
},
{
"input": "6\n1000000000000000000000000000000000000 6643573784 1000000000000000000000000000000000000 1000000000000000000000000000000000000 1000000000000000000000000000000000000 1000000000000000000000000000000000000",
"output": "6643573784000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n9",
"output": "9"
},
{
"input": "2\n10 50",
"output": "500"
},
{
"input": "3\n500 1 10",
"output": "5000"
}
] | 1,693,621,994
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 265
| 2,560,000
|
# LUOGU_RID: 123536784
n=int(input())
ans=1
x=list(input().split());
while n>0:
n-=1
ans*=int(x[n])
print(ans)
|
Title: Gena's Code
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's the year 4527 and the tanks game that we all know and love still exists. There also exists Great Gena's code, written in 2016. The problem this code solves is: given the number of tanks that go into the battle from each country, find their product. If it is turns to be too large, then the servers might have not enough time to assign tanks into teams and the whole game will collapse!
There are exactly *n* distinct countries in the world and the *i*-th country added *a**i* tanks to the game. As the developers of the game are perfectionists, the number of tanks from each country is beautiful. A beautiful number, according to the developers, is such number that its decimal representation consists only of digits '1' and '0', moreover it contains at most one digit '1'. However, due to complaints from players, some number of tanks of one country was removed from the game, hence the number of tanks of this country may not remain beautiful.
Your task is to write the program that solves exactly the same problem in order to verify Gena's code correctness. Just in case.
Input Specification:
The first line of the input contains the number of countries *n* (1<=≤<=*n*<=≤<=100<=000). The second line contains *n* non-negative integers *a**i* without leading zeroes — the number of tanks of the *i*-th country.
It is guaranteed that the second line contains at least *n*<=-<=1 beautiful numbers and the total length of all these number's representations doesn't exceed 100<=000.
Output Specification:
Print a single number without leading zeroes — the product of the number of tanks presented by each country.
Demo Input:
['3\n5 10 1\n', '4\n1 1 10 11\n', '5\n0 3 1 100 1\n']
Demo Output:
['50', '110', '0']
Note:
In sample 1 numbers 10 and 1 are beautiful, number 5 is not not.
In sample 2 number 11 is not beautiful (contains two '1's), all others are beautiful.
In sample 3 number 3 is not beautiful, all others are beautiful.
|
```python
# LUOGU_RID: 123536784
n=int(input())
ans=1
x=list(input().split());
while n>0:
n-=1
ans*=int(x[n])
print(ans)
```
| 3
|
|
488
|
A
|
Giga Tower
|
PROGRAMMING
| 1,100
|
[
"brute force"
] | null | null |
Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view.
In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?).
Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number.
|
The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109).
|
Print the minimum *b* in a line.
|
[
"179\n",
"-1\n",
"18\n"
] |
[
"1\n",
"9\n",
"10\n"
] |
For the first sample, he has to arrive at the floor numbered 180.
For the second sample, he will arrive at 8.
Note that *b* should be positive, so the answer for the third sample is 10, not 0.
| 500
|
[
{
"input": "179",
"output": "1"
},
{
"input": "-1",
"output": "9"
},
{
"input": "18",
"output": "10"
},
{
"input": "-410058385",
"output": "1"
},
{
"input": "-586825624",
"output": "1"
},
{
"input": "852318890",
"output": "1"
},
{
"input": "919067153",
"output": "5"
},
{
"input": "690422411",
"output": "7"
},
{
"input": "-408490162",
"output": "1"
},
{
"input": "-8",
"output": "16"
},
{
"input": "-6",
"output": "14"
},
{
"input": "-4",
"output": "12"
},
{
"input": "-2",
"output": "10"
},
{
"input": "0",
"output": "8"
},
{
"input": "2",
"output": "6"
},
{
"input": "4",
"output": "4"
},
{
"input": "6",
"output": "2"
},
{
"input": "8",
"output": "10"
},
{
"input": "1000000000",
"output": "8"
},
{
"input": "-1000000000",
"output": "2"
},
{
"input": "88888",
"output": "1"
},
{
"input": "89",
"output": "9"
},
{
"input": "-80000000",
"output": "2"
},
{
"input": "-8888",
"output": "1"
},
{
"input": "-17",
"output": "9"
},
{
"input": "78",
"output": "2"
},
{
"input": "-19",
"output": "1"
},
{
"input": "-999999998",
"output": "9"
},
{
"input": "-999999997",
"output": "8"
},
{
"input": "999999997",
"output": "1"
},
{
"input": "811111111",
"output": "1"
},
{
"input": "-8",
"output": "16"
},
{
"input": "-5",
"output": "13"
},
{
"input": "-7",
"output": "15"
},
{
"input": "1000000000",
"output": "8"
}
] | 1,522,530,869
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 93
| 7,065,600
|
n=int(input())
i=n+1
while True:
d=str(i)
if d.count('8')>=1:
print(i-n)
break
else:
i+=1
|
Title: Giga Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view.
In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?).
Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number.
Input Specification:
The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109).
Output Specification:
Print the minimum *b* in a line.
Demo Input:
['179\n', '-1\n', '18\n']
Demo Output:
['1\n', '9\n', '10\n']
Note:
For the first sample, he has to arrive at the floor numbered 180.
For the second sample, he will arrive at 8.
Note that *b* should be positive, so the answer for the third sample is 10, not 0.
|
```python
n=int(input())
i=n+1
while True:
d=str(i)
if d.count('8')>=1:
print(i-n)
break
else:
i+=1
```
| 3
|
|
981
|
A
|
Antipalindrome
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not.
A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$.
Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all.
Some time ago Ann read the word $s$. What is the word she changed it into?
|
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
|
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$.
Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
|
[
"mew\n",
"wuffuw\n",
"qqqqqqqq\n"
] |
[
"3\n",
"5\n",
"0\n"
] |
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$.
The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$.
All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
| 500
|
[
{
"input": "mew",
"output": "3"
},
{
"input": "wuffuw",
"output": "5"
},
{
"input": "qqqqqqqq",
"output": "0"
},
{
"input": "ijvji",
"output": "4"
},
{
"input": "iiiiiii",
"output": "0"
},
{
"input": "wobervhvvkihcuyjtmqhaaigvvgiaahqmtjyuchikvvhvrebow",
"output": "49"
},
{
"input": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww",
"output": "0"
},
{
"input": "wobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy",
"output": "50"
},
{
"input": "ijvxljt",
"output": "7"
},
{
"input": "fyhcncnchyf",
"output": "10"
},
{
"input": "ffffffffffff",
"output": "0"
},
{
"input": "fyhcncfsepqj",
"output": "12"
},
{
"input": "ybejrrlbcinttnicblrrjeby",
"output": "23"
},
{
"input": "yyyyyyyyyyyyyyyyyyyyyyyyy",
"output": "0"
},
{
"input": "ybejrrlbcintahovgjddrqatv",
"output": "25"
},
{
"input": "oftmhcmclgyqaojljoaqyglcmchmtfo",
"output": "30"
},
{
"input": "oooooooooooooooooooooooooooooooo",
"output": "0"
},
{
"input": "oftmhcmclgyqaojllbotztajglsmcilv",
"output": "32"
},
{
"input": "gxandbtgpbknxvnkjaajknvxnkbpgtbdnaxg",
"output": "35"
},
{
"input": "gggggggggggggggggggggggggggggggggggg",
"output": "0"
},
{
"input": "gxandbtgpbknxvnkjaygommzqitqzjfalfkk",
"output": "36"
},
{
"input": "fcliblymyqckxvieotjooojtoeivxkcqymylbilcf",
"output": "40"
},
{
"input": "fffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "fcliblymyqckxvieotjootiqwtyznhhvuhbaixwqnsy",
"output": "43"
},
{
"input": "rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr",
"output": "0"
},
{
"input": "rajccqwqnqmshmerpvjyfepxwpxyldzpzhctqjnstxyfmlhiy",
"output": "49"
},
{
"input": "a",
"output": "0"
},
{
"input": "abca",
"output": "4"
},
{
"input": "aaaaabaaaaa",
"output": "10"
},
{
"input": "aba",
"output": "2"
},
{
"input": "asaa",
"output": "4"
},
{
"input": "aabaa",
"output": "4"
},
{
"input": "aabbaa",
"output": "5"
},
{
"input": "abcdaaa",
"output": "7"
},
{
"input": "aaholaa",
"output": "7"
},
{
"input": "abcdefghijka",
"output": "12"
},
{
"input": "aaadcba",
"output": "7"
},
{
"input": "aaaabaaaa",
"output": "8"
},
{
"input": "abaa",
"output": "4"
},
{
"input": "abcbaa",
"output": "6"
},
{
"input": "ab",
"output": "2"
},
{
"input": "l",
"output": "0"
},
{
"input": "aaaabcaaaa",
"output": "10"
},
{
"input": "abbaaaaaabba",
"output": "11"
},
{
"input": "abaaa",
"output": "5"
},
{
"input": "baa",
"output": "3"
},
{
"input": "aaaaaaabbba",
"output": "11"
},
{
"input": "ccbcc",
"output": "4"
},
{
"input": "bbbaaab",
"output": "7"
},
{
"input": "abaaaaaaaa",
"output": "10"
},
{
"input": "abaaba",
"output": "5"
},
{
"input": "aabsdfaaaa",
"output": "10"
},
{
"input": "aaaba",
"output": "5"
},
{
"input": "aaabaaa",
"output": "6"
},
{
"input": "baaabbb",
"output": "7"
},
{
"input": "ccbbabbcc",
"output": "8"
},
{
"input": "cabc",
"output": "4"
},
{
"input": "aabcd",
"output": "5"
},
{
"input": "abcdea",
"output": "6"
},
{
"input": "bbabb",
"output": "4"
},
{
"input": "aaaaabababaaaaa",
"output": "14"
},
{
"input": "bbabbb",
"output": "6"
},
{
"input": "aababd",
"output": "6"
},
{
"input": "abaaaa",
"output": "6"
},
{
"input": "aaaaaaaabbba",
"output": "12"
},
{
"input": "aabca",
"output": "5"
},
{
"input": "aaabccbaaa",
"output": "9"
},
{
"input": "aaaaaaaaaaaaaaaaaaaab",
"output": "21"
},
{
"input": "babb",
"output": "4"
},
{
"input": "abcaa",
"output": "5"
},
{
"input": "qwqq",
"output": "4"
},
{
"input": "aaaaaaaaaaabbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaa",
"output": "48"
},
{
"input": "aaab",
"output": "4"
},
{
"input": "aaaaaabaaaaa",
"output": "12"
},
{
"input": "wwuww",
"output": "4"
},
{
"input": "aaaaabcbaaaaa",
"output": "12"
},
{
"input": "aaabbbaaa",
"output": "8"
},
{
"input": "aabcbaa",
"output": "6"
},
{
"input": "abccdefccba",
"output": "11"
},
{
"input": "aabbcbbaa",
"output": "8"
},
{
"input": "aaaabbaaaa",
"output": "9"
},
{
"input": "aabcda",
"output": "6"
},
{
"input": "abbca",
"output": "5"
},
{
"input": "aaaaaabbaaa",
"output": "11"
},
{
"input": "sssssspssssss",
"output": "12"
},
{
"input": "sdnmsdcs",
"output": "8"
},
{
"input": "aaabbbccbbbaaa",
"output": "13"
},
{
"input": "cbdbdc",
"output": "6"
},
{
"input": "abb",
"output": "3"
},
{
"input": "abcdefaaaa",
"output": "10"
},
{
"input": "abbbaaa",
"output": "7"
},
{
"input": "v",
"output": "0"
},
{
"input": "abccbba",
"output": "7"
},
{
"input": "axyza",
"output": "5"
},
{
"input": "abcdefgaaaa",
"output": "11"
},
{
"input": "aaabcdaaa",
"output": "9"
},
{
"input": "aaaacaaaa",
"output": "8"
},
{
"input": "aaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaa",
"output": "42"
},
{
"input": "abbbaa",
"output": "6"
},
{
"input": "abcdee",
"output": "6"
},
{
"input": "oom",
"output": "3"
},
{
"input": "aabcaa",
"output": "6"
},
{
"input": "abba",
"output": "3"
},
{
"input": "aaca",
"output": "4"
},
{
"input": "aacbca",
"output": "6"
},
{
"input": "ababa",
"output": "4"
},
{
"input": "abcda",
"output": "5"
},
{
"input": "cccaaccc",
"output": "7"
},
{
"input": "aaabcda",
"output": "7"
},
{
"input": "aa",
"output": "0"
},
{
"input": "aabaaaa",
"output": "7"
},
{
"input": "abbaaaa",
"output": "7"
},
{
"input": "aaabcbaaa",
"output": "8"
},
{
"input": "aabba",
"output": "5"
},
{
"input": "xyxx",
"output": "4"
},
{
"input": "aaaaaaaaaaaabc",
"output": "14"
},
{
"input": "bbaaaabb",
"output": "7"
},
{
"input": "aaabaa",
"output": "6"
},
{
"input": "sssssabsssss",
"output": "12"
},
{
"input": "bbbaaaabbb",
"output": "9"
},
{
"input": "abbbbaaaa",
"output": "9"
},
{
"input": "wwufuww",
"output": "6"
},
{
"input": "oowoo",
"output": "4"
},
{
"input": "cccaccc",
"output": "6"
},
{
"input": "aaa",
"output": "0"
},
{
"input": "bbbcc",
"output": "5"
},
{
"input": "abcdef",
"output": "6"
},
{
"input": "abbba",
"output": "4"
},
{
"input": "aab",
"output": "3"
},
{
"input": "aaba",
"output": "4"
},
{
"input": "azbyaaa",
"output": "7"
},
{
"input": "oooooiooooo",
"output": "10"
},
{
"input": "aabbbbbaaaaaa",
"output": "13"
}
] | 1,527,436,104
| 3,504
|
Python 3
|
OK
|
TESTS
| 133
| 93
| 0
|
def is_palindrome(s):
for i in range(len(s) // 2):
if s[i] != s[~i]:
return False
return True
def max_anti(s, visited):
if len(s) <= 1:
return 0
ts = tuple(s)
if ts in visited:
return 0
visited.add(ts)
if is_palindrome(s):
return max(max_anti(s[1:], visited), max_anti(s[:-1], visited))
return len(s)
def solve(s):
if len(set(s)) <= 1:
return 0
visited = set()
return max_anti([x for x in s], visited)
def main():
s = input().strip()
result = solve(s)
print(result)
if __name__ == '__main__':
main()
|
Title: Antipalindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not.
A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$.
Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all.
Some time ago Ann read the word $s$. What is the word she changed it into?
Input Specification:
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
Output Specification:
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$.
Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
Demo Input:
['mew\n', 'wuffuw\n', 'qqqqqqqq\n']
Demo Output:
['3\n', '5\n', '0\n']
Note:
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$.
The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$.
All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
|
```python
def is_palindrome(s):
for i in range(len(s) // 2):
if s[i] != s[~i]:
return False
return True
def max_anti(s, visited):
if len(s) <= 1:
return 0
ts = tuple(s)
if ts in visited:
return 0
visited.add(ts)
if is_palindrome(s):
return max(max_anti(s[1:], visited), max_anti(s[:-1], visited))
return len(s)
def solve(s):
if len(set(s)) <= 1:
return 0
visited = set()
return max_anti([x for x in s], visited)
def main():
s = input().strip()
result = solve(s)
print(result)
if __name__ == '__main__':
main()
```
| 3
|
|
53
|
D
|
Physical Education
|
PROGRAMMING
| 1,500
|
[
"sortings"
] |
D. Physical Education
|
2
|
256
|
Vasya is a school PE teacher. Unlike other PE teachers, Vasya doesn't like it when the students stand in line according to their height. Instead, he demands that the children stand in the following order: *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the height of the *i*-th student in the line and *n* is the number of students in the line. The children find it hard to keep in mind this strange arrangement, and today they formed the line in the following order: *b*1,<=*b*2,<=...,<=*b**n*, which upset Vasya immensely. Now Vasya wants to rearrange the children so that the resulting order is like this: *a*1,<=*a*2,<=...,<=*a**n*. During each move Vasya can swap two people who stand next to each other in the line. Help Vasya, find the sequence of swaps leading to the arrangement Vasya needs. It is not required to minimize the number of moves.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=300) which is the number of students. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=109) which represent the height of the student occupying the *i*-th place must possess. The third line contains *n* space-separated integers *b**i* (1<=≤<=*b**i*<=≤<=109) which represent the height of the student occupying the *i*-th place in the initial arrangement. It is possible that some students possess similar heights. It is guaranteed that it is possible to arrange the children in the required order, i.e. *a* and *b* coincide as multisets.
|
In the first line print an integer *k* (0<=≤<=*k*<=≤<=106) which is the number of moves. It is not required to minimize *k* but it must not exceed 106. Then print *k* lines each containing two space-separated integers. Line *p**i*, *p**i*<=+<=1 (1<=≤<=*p**i*<=≤<=*n*<=-<=1) means that Vasya should swap students occupying places *p**i* and *p**i*<=+<=1.
|
[
"4\n1 2 3 2\n3 2 1 2\n",
"2\n1 100500\n1 100500\n"
] |
[
"4\n2 3\n1 2\n3 4\n2 3\n",
"0\n"
] |
none
| 2,000
|
[
{
"input": "4\n1 2 3 2\n3 2 1 2",
"output": "4\n2 3\n1 2\n3 4\n2 3"
},
{
"input": "2\n1 100500\n1 100500",
"output": "0"
},
{
"input": "3\n652586118 652586118 652586118\n652586118 652586118 652586118",
"output": "3\n2 3\n1 2\n2 3"
},
{
"input": "4\n681106577 681106577 675077178 675077178\n675077178 681106577 681106577 675077178",
"output": "4\n2 3\n1 2\n2 3\n3 4"
},
{
"input": "5\n470138369 747764103 729004864 491957578 874531368\n874531368 729004864 491957578 747764103 470138369",
"output": "9\n4 5\n3 4\n2 3\n1 2\n4 5\n3 4\n2 3\n3 4\n4 5"
},
{
"input": "6\n590202194 293471749 259345095 293471749 18056518 293471749\n293471749 293471749 293471749 18056518 259345095 590202194",
"output": "12\n5 6\n4 5\n3 4\n2 3\n1 2\n3 4\n2 3\n5 6\n4 5\n3 4\n4 5\n5 6"
},
{
"input": "1\n873725529\n873725529",
"output": "0"
},
{
"input": "1\n800950546\n800950546",
"output": "0"
},
{
"input": "2\n344379439 344379439\n344379439 344379439",
"output": "1\n1 2"
},
{
"input": "2\n305292852 305292852\n305292852 305292852",
"output": "1\n1 2"
}
] | 1,652,221,425
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 186
| 102,400
|
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
x = []
y = []
f = 0
for i in range(n):
for j in range(i,n):
if a[i] == b[j]:
f = j
break
# print(f)
for j in range(f, i, -1):
temp = b[j]
b[j] = b[j-1]
b[j-1] = temp
x.append(j-1)
y.append(j)
print(len(x))
for i in range(len(x)):
print(x[i]+1, y[i]+1)
|
Title: Physical Education
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is a school PE teacher. Unlike other PE teachers, Vasya doesn't like it when the students stand in line according to their height. Instead, he demands that the children stand in the following order: *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the height of the *i*-th student in the line and *n* is the number of students in the line. The children find it hard to keep in mind this strange arrangement, and today they formed the line in the following order: *b*1,<=*b*2,<=...,<=*b**n*, which upset Vasya immensely. Now Vasya wants to rearrange the children so that the resulting order is like this: *a*1,<=*a*2,<=...,<=*a**n*. During each move Vasya can swap two people who stand next to each other in the line. Help Vasya, find the sequence of swaps leading to the arrangement Vasya needs. It is not required to minimize the number of moves.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=300) which is the number of students. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=109) which represent the height of the student occupying the *i*-th place must possess. The third line contains *n* space-separated integers *b**i* (1<=≤<=*b**i*<=≤<=109) which represent the height of the student occupying the *i*-th place in the initial arrangement. It is possible that some students possess similar heights. It is guaranteed that it is possible to arrange the children in the required order, i.e. *a* and *b* coincide as multisets.
Output Specification:
In the first line print an integer *k* (0<=≤<=*k*<=≤<=106) which is the number of moves. It is not required to minimize *k* but it must not exceed 106. Then print *k* lines each containing two space-separated integers. Line *p**i*, *p**i*<=+<=1 (1<=≤<=*p**i*<=≤<=*n*<=-<=1) means that Vasya should swap students occupying places *p**i* and *p**i*<=+<=1.
Demo Input:
['4\n1 2 3 2\n3 2 1 2\n', '2\n1 100500\n1 100500\n']
Demo Output:
['4\n2 3\n1 2\n3 4\n2 3\n', '0\n']
Note:
none
|
```python
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
x = []
y = []
f = 0
for i in range(n):
for j in range(i,n):
if a[i] == b[j]:
f = j
break
# print(f)
for j in range(f, i, -1):
temp = b[j]
b[j] = b[j-1]
b[j-1] = temp
x.append(j-1)
y.append(j)
print(len(x))
for i in range(len(x)):
print(x[i]+1, y[i]+1)
```
| 3.953309
|
68
|
A
|
Irrational problem
|
PROGRAMMING
| 1,100
|
[
"implementation",
"number theory"
] |
A. Irrational problem
|
2
|
256
|
Little Petya was given this problem for homework:
You are given function (here represents the operation of taking the remainder). His task is to count the number of integers *x* in range [*a*;*b*] with property *f*(*x*)<==<=*x*.
It is a pity that Petya forgot the order in which the remainders should be taken and wrote down only 4 numbers. Each of 24 possible orders of taking the remainder has equal probability of being chosen. For example, if Petya has numbers 1, 2, 3, 4 then he can take remainders in that order or first take remainder modulo 4, then modulo 2, 3, 1. There also are 22 other permutations of these numbers that represent orders in which remainder can be taken. In this problem 4 numbers wrote down by Petya will be pairwise distinct.
Now it is impossible for Petya to complete the task given by teacher but just for fun he decided to find the number of integers with property that probability that *f*(*x*)<==<=*x* is not less than 31.4159265352718281828459045%. In other words, Petya will pick up the number *x* if there exist at least 7 permutations of numbers *p*1,<=*p*2,<=*p*3,<=*p*4, for which *f*(*x*)<==<=*x*.
|
First line of the input will contain 6 integers, separated by spaces: *p*1,<=*p*2,<=*p*3,<=*p*4,<=*a*,<=*b* (1<=≤<=*p*1,<=*p*2,<=*p*3,<=*p*4<=≤<=1000,<=0<=≤<=*a*<=≤<=*b*<=≤<=31415).
It is guaranteed that numbers *p*1,<=*p*2,<=*p*3,<=*p*4 will be pairwise distinct.
|
Output the number of integers in the given range that have the given property.
|
[
"2 7 1 8 2 8\n",
"20 30 40 50 0 100\n",
"31 41 59 26 17 43\n"
] |
[
"0\n",
"20\n",
"9\n"
] |
none
| 500
|
[
{
"input": "2 7 1 8 2 8",
"output": "0"
},
{
"input": "20 30 40 50 0 100",
"output": "20"
},
{
"input": "31 41 59 26 17 43",
"output": "9"
},
{
"input": "1 2 3 4 0 0",
"output": "1"
},
{
"input": "1 2 3 4 1 1",
"output": "0"
},
{
"input": "1 2 999 1000 30 40",
"output": "0"
},
{
"input": "17 18 19 20 17 20",
"output": "0"
},
{
"input": "17 18 19 20 16 20",
"output": "1"
},
{
"input": "41 449 328 474 150 709",
"output": "0"
},
{
"input": "467 329 936 440 117 700",
"output": "212"
},
{
"input": "258 811 952 491 931 993",
"output": "0"
},
{
"input": "823 431 359 590 153 899",
"output": "206"
},
{
"input": "292 370 404 698 699 876",
"output": "0"
},
{
"input": "442 705 757 527 868 893",
"output": "0"
},
{
"input": "642 273 18 885 675 788",
"output": "0"
},
{
"input": "291 303 656 660 126 704",
"output": "165"
},
{
"input": "225 862 522 617 630 725",
"output": "0"
},
{
"input": "17 847 715 732 502 778",
"output": "0"
},
{
"input": "41 449 328 474 15724 19169",
"output": "0"
},
{
"input": "467 329 936 440 5705 28145",
"output": "0"
},
{
"input": "258 811 952 491 2995 11942",
"output": "0"
},
{
"input": "823 431 359 590 153 3902",
"output": "206"
},
{
"input": "292 370 404 698 19718 19895",
"output": "0"
},
{
"input": "442 705 757 527 1869 19912",
"output": "0"
},
{
"input": "642 273 18 885 23811 28703",
"output": "0"
},
{
"input": "291 303 656 660 7711 15141",
"output": "0"
},
{
"input": "225 862 522 617 1246 1341",
"output": "0"
},
{
"input": "17 847 715 732 778 27529",
"output": "0"
},
{
"input": "997 998 999 1000 0 31415",
"output": "997"
},
{
"input": "1 2 3 4 0 31415",
"output": "1"
},
{
"input": "541 931 822 948 131 193",
"output": "63"
},
{
"input": "956 800 909 916 89 194",
"output": "106"
},
{
"input": "735 794 942 991 419 490",
"output": "72"
},
{
"input": "818 926 827 575 153 395",
"output": "243"
},
{
"input": "792 858 887 679 179 356",
"output": "178"
},
{
"input": "937 683 742 515 366 373",
"output": "8"
},
{
"input": "616 747 501 875 146 264",
"output": "119"
},
{
"input": "760 773 638 655 111 196",
"output": "86"
},
{
"input": "697 855 997 589 97 192",
"output": "96"
},
{
"input": "998 834 706 722 277 475",
"output": "199"
},
{
"input": "100 101 102 103 10 20",
"output": "11"
}
] | 1,570,519,215
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 248
| 0
|
q=input()
p1,p2,p3,p4,a,b=map(int,q.split())
p=min(p1,p2,p3,p4)
c=0
if p>b:
c=b-a+1
elif p>a:
c=p-a
else:
c=0
print(c)
|
Title: Irrational problem
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya was given this problem for homework:
You are given function (here represents the operation of taking the remainder). His task is to count the number of integers *x* in range [*a*;*b*] with property *f*(*x*)<==<=*x*.
It is a pity that Petya forgot the order in which the remainders should be taken and wrote down only 4 numbers. Each of 24 possible orders of taking the remainder has equal probability of being chosen. For example, if Petya has numbers 1, 2, 3, 4 then he can take remainders in that order or first take remainder modulo 4, then modulo 2, 3, 1. There also are 22 other permutations of these numbers that represent orders in which remainder can be taken. In this problem 4 numbers wrote down by Petya will be pairwise distinct.
Now it is impossible for Petya to complete the task given by teacher but just for fun he decided to find the number of integers with property that probability that *f*(*x*)<==<=*x* is not less than 31.4159265352718281828459045%. In other words, Petya will pick up the number *x* if there exist at least 7 permutations of numbers *p*1,<=*p*2,<=*p*3,<=*p*4, for which *f*(*x*)<==<=*x*.
Input Specification:
First line of the input will contain 6 integers, separated by spaces: *p*1,<=*p*2,<=*p*3,<=*p*4,<=*a*,<=*b* (1<=≤<=*p*1,<=*p*2,<=*p*3,<=*p*4<=≤<=1000,<=0<=≤<=*a*<=≤<=*b*<=≤<=31415).
It is guaranteed that numbers *p*1,<=*p*2,<=*p*3,<=*p*4 will be pairwise distinct.
Output Specification:
Output the number of integers in the given range that have the given property.
Demo Input:
['2 7 1 8 2 8\n', '20 30 40 50 0 100\n', '31 41 59 26 17 43\n']
Demo Output:
['0\n', '20\n', '9\n']
Note:
none
|
```python
q=input()
p1,p2,p3,p4,a,b=map(int,q.split())
p=min(p1,p2,p3,p4)
c=0
if p>b:
c=b-a+1
elif p>a:
c=p-a
else:
c=0
print(c)
```
| 3.938
|
405
|
A
|
Gravity Flip
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity.
There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange.
Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
|
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
|
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
|
[
"4\n3 2 1 2\n",
"3\n2 3 8\n"
] |
[
"1 2 2 3 \n",
"2 3 8 \n"
] |
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column.
In the second example case the gravity switch does not change the heights of the columns.
| 500
|
[
{
"input": "4\n3 2 1 2",
"output": "1 2 2 3 "
},
{
"input": "3\n2 3 8",
"output": "2 3 8 "
},
{
"input": "5\n2 1 2 1 2",
"output": "1 1 2 2 2 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n4 3",
"output": "3 4 "
},
{
"input": "6\n100 40 60 20 1 80",
"output": "1 20 40 60 80 100 "
},
{
"input": "10\n10 8 6 7 5 3 4 2 9 1",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91",
"output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 "
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 "
},
{
"input": "10\n1 9 7 6 2 4 7 8 1 3",
"output": "1 1 2 3 4 6 7 7 8 9 "
},
{
"input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59",
"output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 "
},
{
"input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12",
"output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 "
},
{
"input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84",
"output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 "
},
{
"input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52",
"output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 "
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3",
"output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 "
},
{
"input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32",
"output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 "
},
{
"input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41",
"output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 "
},
{
"input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82",
"output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 "
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50",
"output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 "
},
{
"input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 "
},
{
"input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88",
"output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 "
},
{
"input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 "
},
{
"input": "10\n100 90 80 70 60 50 40 30 20 10",
"output": "10 20 30 40 50 60 70 80 90 100 "
},
{
"input": "1\n10",
"output": "10 "
}
] | 1,694,940,971
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 32
| 62
| 0
|
k = int(input())
n = list(map(int, input().split()))
n.sort()
g = ''
for i in range(k):
g += str(n[i])+ ' '
print(g)
|
Title: Gravity Flip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity.
There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange.
Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
Input Specification:
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
Output Specification:
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
Demo Input:
['4\n3 2 1 2\n', '3\n2 3 8\n']
Demo Output:
['1 2 2 3 \n', '2 3 8 \n']
Note:
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column.
In the second example case the gravity switch does not change the heights of the columns.
|
```python
k = int(input())
n = list(map(int, input().split()))
n.sort()
g = ''
for i in range(k):
g += str(n[i])+ ' '
print(g)
```
| 3
|
|
465
|
A
|
inc ARG
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit.
Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded.
Sergey wrote certain values of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell.
The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
|
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
|
[
"4\n1100\n",
"4\n1111\n"
] |
[
"3\n",
"4\n"
] |
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
| 500
|
[
{
"input": "4\n1100",
"output": "3"
},
{
"input": "4\n1111",
"output": "4"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n00",
"output": "1"
},
{
"input": "2\n01",
"output": "1"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n11",
"output": "2"
},
{
"input": "10\n0000000000",
"output": "1"
},
{
"input": "20\n11111111110110001100",
"output": "11"
},
{
"input": "50\n01011110100010000001010000100001001101001101101011",
"output": "1"
},
{
"input": "60\n111111111101111111111111111111111111111111111111111111111111",
"output": "11"
},
{
"input": "60\n111111111111111111111111111111111111111111111111111111111111",
"output": "60"
},
{
"input": "66\n111111010010011001110011000111000100011110011001111110011111111101",
"output": "7"
},
{
"input": "90\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "91\n1011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "2"
},
{
"input": "92\n11111111101011111011111111111111111111111011101111111111011111111111111101111111101011111101",
"output": "10"
},
{
"input": "100\n0001011110100011001100100010111001000001111101101001001001001011110100101101010000000110100101110010",
"output": "1"
},
{
"input": "100\n0111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "1"
},
{
"input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "100"
},
{
"input": "100\n1011001110001000011111110011000100001110010110111101110110011011011000010100110001111100000010110010",
"output": "2"
},
{
"input": "100\n1101111011001111111111110011110111101110111111111111111111111111111111011111111111110111111111111111",
"output": "3"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "100"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110",
"output": "100"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111101",
"output": "99"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111100000",
"output": "96"
},
{
"input": "100\n1111111111111111111111111111111110011000110110001010101100100100001000010010010010000100110000010101",
"output": "34"
}
] | 1,619,081,664
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 0
|
n = int(input())
string = input()
x = 1
for i in range(n):
if string[i] == '1':
x += 1
else:
print(x)
exit()
print(x - 1)
|
Title: inc ARG
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit.
Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded.
Sergey wrote certain values of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell.
The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
Output Specification:
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
Demo Input:
['4\n1100\n', '4\n1111\n']
Demo Output:
['3\n', '4\n']
Note:
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
|
```python
n = int(input())
string = input()
x = 1
for i in range(n):
if string[i] == '1':
x += 1
else:
print(x)
exit()
print(x - 1)
```
| 3
|
|
3
|
A
|
Shortest path of the king
|
PROGRAMMING
| 1,000
|
[
"greedy",
"shortest paths"
] |
A. Shortest path of the king
|
1
|
64
|
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this.
In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
|
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*.
Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
|
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD.
L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
|
[
"a8\nh1\n"
] |
[
"7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n"
] |
none
| 0
|
[
{
"input": "a8\nh1",
"output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD"
},
{
"input": "b2\nb4",
"output": "2\nU\nU"
},
{
"input": "a5\na5",
"output": "0"
},
{
"input": "h1\nb2",
"output": "6\nLU\nL\nL\nL\nL\nL"
},
{
"input": "c5\nh2",
"output": "5\nRD\nRD\nRD\nR\nR"
},
{
"input": "e1\nf2",
"output": "1\nRU"
},
{
"input": "g4\nd2",
"output": "3\nLD\nLD\nL"
},
{
"input": "a8\nb2",
"output": "6\nRD\nD\nD\nD\nD\nD"
},
{
"input": "d4\nh2",
"output": "4\nRD\nRD\nR\nR"
},
{
"input": "c5\na2",
"output": "3\nLD\nLD\nD"
},
{
"input": "h5\nf8",
"output": "3\nLU\nLU\nU"
},
{
"input": "e6\nb6",
"output": "3\nL\nL\nL"
},
{
"input": "a6\ng4",
"output": "6\nRD\nRD\nR\nR\nR\nR"
},
{
"input": "f7\nc2",
"output": "5\nLD\nLD\nLD\nD\nD"
},
{
"input": "b7\nh8",
"output": "6\nRU\nR\nR\nR\nR\nR"
},
{
"input": "g7\nd6",
"output": "3\nLD\nL\nL"
},
{
"input": "c8\na3",
"output": "5\nLD\nLD\nD\nD\nD"
},
{
"input": "h8\nf1",
"output": "7\nLD\nLD\nD\nD\nD\nD\nD"
},
{
"input": "d1\nb7",
"output": "6\nLU\nLU\nU\nU\nU\nU"
},
{
"input": "a7\ne5",
"output": "4\nRD\nRD\nR\nR"
},
{
"input": "d6\nb1",
"output": "5\nLD\nLD\nD\nD\nD"
},
{
"input": "f5\ng5",
"output": "1\nR"
},
{
"input": "h4\nd1",
"output": "4\nLD\nLD\nLD\nL"
},
{
"input": "b3\na5",
"output": "2\nLU\nU"
},
{
"input": "d2\nf1",
"output": "2\nRD\nR"
},
{
"input": "f1\nc5",
"output": "4\nLU\nLU\nLU\nU"
},
{
"input": "a8\nh1",
"output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD"
},
{
"input": "c7\ne5",
"output": "2\nRD\nRD"
},
{
"input": "e7\nb1",
"output": "6\nLD\nLD\nLD\nD\nD\nD"
},
{
"input": "g8\na8",
"output": "6\nL\nL\nL\nL\nL\nL"
},
{
"input": "g6\nf2",
"output": "4\nLD\nD\nD\nD"
},
{
"input": "g4\nc4",
"output": "4\nL\nL\nL\nL"
},
{
"input": "g2\na6",
"output": "6\nLU\nLU\nLU\nLU\nL\nL"
},
{
"input": "f8\nf8",
"output": "0"
},
{
"input": "f5\nd2",
"output": "3\nLD\nLD\nD"
}
] | 1,653,928,517
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
s, t = input(), input()
s = [ord(s[0]) - ord('a') + 1, int(s[1])]
t = [ord(t[0]) - ord('a') + 1, int(t[1])]
count = 0
p = []
while (s != t):
if (s[0] != t[0] and s[1] != t[1]):
if (s[0] < t[0]):
if (s[1] < t[1]):
s[0] += 1
s[1] += 1
p.append("RU")
else:
s[0] += 1
s[1] -= 1
p.append("RD")
else:
if (s[1] < t[1]):
s[0] -= 1
s[1] += 1
p.append("LU")
else:
s[0] -= 1
s[1] -= 1
p.append("LD")
else:
if (s[1] < t[1]):
s[1] += 1
p.append("U")
elif (s[1] > t[1]):
s[1] -= 1
p.append("D")
elif (s[0] < t[0]):
s[0] += 1
p.append("R")
else:
s[0] -= 1
p.append("L")
count += 1
print(count)
print(*p, sep="\n")
|
Title: Shortest path of the king
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this.
In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
Input Specification:
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*.
Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
Output Specification:
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD.
L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
Demo Input:
['a8\nh1\n']
Demo Output:
['7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n']
Note:
none
|
```python
s, t = input(), input()
s = [ord(s[0]) - ord('a') + 1, int(s[1])]
t = [ord(t[0]) - ord('a') + 1, int(t[1])]
count = 0
p = []
while (s != t):
if (s[0] != t[0] and s[1] != t[1]):
if (s[0] < t[0]):
if (s[1] < t[1]):
s[0] += 1
s[1] += 1
p.append("RU")
else:
s[0] += 1
s[1] -= 1
p.append("RD")
else:
if (s[1] < t[1]):
s[0] -= 1
s[1] += 1
p.append("LU")
else:
s[0] -= 1
s[1] -= 1
p.append("LD")
else:
if (s[1] < t[1]):
s[1] += 1
p.append("U")
elif (s[1] > t[1]):
s[1] -= 1
p.append("D")
elif (s[0] < t[0]):
s[0] += 1
p.append("R")
else:
s[0] -= 1
p.append("L")
count += 1
print(count)
print(*p, sep="\n")
```
| 3.954
|
207
|
D4
|
The Beaver's Problem - 3
|
PROGRAMMING
| 2,100
|
[] | null | null |
The Smart Beaver from ABBYY came up with another splendid problem for the ABBYY Cup participants! This time the Beaver invites the contest participants to check out a problem on sorting documents by their subjects. Let's describe the problem:
You've got some training set of documents. For each document you know its subject. The subject in this problem is an integer from 1 to 3. Each of these numbers has a physical meaning. For instance, all documents with subject 3 are about trade.
You can download the training set of documents at the following link: http://download4.abbyy.com/a2/X2RZ2ZWXBG5VYWAL61H76ZQM/train.zip. The archive contains three directories with names "1", "2", "3". Directory named "1" contains documents on the 1-st subject, directory "2" contains documents on the 2-nd subject, and directory "3" contains documents on the 3-rd subject. Each document corresponds to exactly one file from some directory.
All documents have the following format: the first line contains the document identifier, the second line contains the name of the document, all subsequent lines contain the text of the document. The document identifier is used to make installing the problem more convenient and has no useful information for the participants.
You need to write a program that should indicate the subject for a given document. It is guaranteed that all documents given as input to your program correspond to one of the three subjects of the training set.
|
The first line contains integer *id* (0<=≤<=*id*<=≤<=106) — the document identifier. The second line contains the name of the document. The third and the subsequent lines contain the text of the document. It is guaranteed that the size of any given document will not exceed 10 kilobytes.
The tests for this problem are divided into 10 groups. Documents of groups 1 and 2 are taken from the training set, but their identifiers will not match the identifiers specified in the training set. Groups from the 3-rd to the 10-th are roughly sorted by the author in ascending order of difficulty (these groups contain documents which aren't present in the training set).
|
Print an integer from 1 to 3, inclusive — the number of the subject the given document corresponds to.
|
[] |
[] |
none
| 10
|
[
{
"input": "19000\nGROUP OF FIVE MEETING ENDS\nWASHINGTON, April 8 - A meeting of finance ministers and\ncentral bankers of the Group of Five ended after nearly three\nand a half hours.\nWest German Finance Minister Gerhard Stoltenberg and\nBritish Chancellor of the Exchequer Nigel Lawson declined to\ncomment on the meeting as they emerged from the U.S. Treasury.\nA European monetary official said the ministers of the\nGroup of Seven countries would gather at about three p.m. local\n(1900 GMT) at the Treasury.",
"output": "1"
},
{
"input": "21000\nSWISS TO LAUNCH NEW SERIES OF MONEY MARKET PAPER\nZURICH, April 9 - The Swiss Federal Government will launch\na new series of three month money market certificates totalling\naround 150 mln Swiss francs, the National Bank said.\nSubscriptions close April 14 and payment date is April 16.\nThe last series of three month paper issued in March raised\n147.3 mln francs at an issue price of 99.142 pct, giving an\naverage annual yield of 3.501 pct.",
"output": "1"
}
] | 1,673,005,805
| 2,147,483,647
|
Python 3
|
OK
|
TESTS4
| 5
| 46
| 0
|
# LUOGU_RID: 98853652
print(1)########
|
Title: The Beaver's Problem - 3
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Smart Beaver from ABBYY came up with another splendid problem for the ABBYY Cup participants! This time the Beaver invites the contest participants to check out a problem on sorting documents by their subjects. Let's describe the problem:
You've got some training set of documents. For each document you know its subject. The subject in this problem is an integer from 1 to 3. Each of these numbers has a physical meaning. For instance, all documents with subject 3 are about trade.
You can download the training set of documents at the following link: http://download4.abbyy.com/a2/X2RZ2ZWXBG5VYWAL61H76ZQM/train.zip. The archive contains three directories with names "1", "2", "3". Directory named "1" contains documents on the 1-st subject, directory "2" contains documents on the 2-nd subject, and directory "3" contains documents on the 3-rd subject. Each document corresponds to exactly one file from some directory.
All documents have the following format: the first line contains the document identifier, the second line contains the name of the document, all subsequent lines contain the text of the document. The document identifier is used to make installing the problem more convenient and has no useful information for the participants.
You need to write a program that should indicate the subject for a given document. It is guaranteed that all documents given as input to your program correspond to one of the three subjects of the training set.
Input Specification:
The first line contains integer *id* (0<=≤<=*id*<=≤<=106) — the document identifier. The second line contains the name of the document. The third and the subsequent lines contain the text of the document. It is guaranteed that the size of any given document will not exceed 10 kilobytes.
The tests for this problem are divided into 10 groups. Documents of groups 1 and 2 are taken from the training set, but their identifiers will not match the identifiers specified in the training set. Groups from the 3-rd to the 10-th are roughly sorted by the author in ascending order of difficulty (these groups contain documents which aren't present in the training set).
Output Specification:
Print an integer from 1 to 3, inclusive — the number of the subject the given document corresponds to.
Note:
none
|
```python
# LUOGU_RID: 98853652
print(1)########
```
| 3
|
|
94
|
A
|
Restoring Password
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Restoring Password
|
2
|
256
|
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
|
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
|
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
|
[
"01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n",
"10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n"
] |
[
"12345678\n",
"30234919\n"
] |
none
| 500
|
[
{
"input": "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110",
"output": "12345678"
},
{
"input": "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000",
"output": "30234919"
},
{
"input": "00010101101110110101100110101100010101100010101111000101011010011010110010000011\n0101010110\n0001001101\n1001101011\n0000100011\n0010101111\n1110110101\n0001010110\n0110111000\n0000111110\n0010000011",
"output": "65264629"
},
{
"input": "10100100010010010011011001101000100100110110011010011001101011000100110110011010\n1111110011\n1001000111\n1001000100\n1100010011\n0110011010\n0010000001\n1110101110\n0010000110\n0010010011\n1010010001",
"output": "98484434"
},
{
"input": "00101100011111010001001000000110110000000110010011001111111010110010001011000000\n0010000001\n0110010011\n0010000010\n1011001000\n0011111110\n0110001000\n1111010001\n1011000000\n0000100110\n0010110001",
"output": "96071437"
},
{
"input": "10001110111110000001000010001010001110110000100010100010111101101101010000100010\n0000010110\n1101010111\n1000101111\n0001011110\n0011110101\n0101100100\n0110110101\n0000100010\n1000111011\n1110000001",
"output": "89787267"
},
{
"input": "10010100011001010001010101001101010100110100111011001010111100011001000010100000\n0011100000\n1001100100\n0001100100\n0010100000\n0101010011\n0010101110\n0010101111\n0100111011\n1001010001\n1111111110",
"output": "88447623"
},
{
"input": "01101100111000000101011011001110000001011111111000111111100001011010001001011001\n1000000101\n0101101000\n0101110101\n1101011110\n0000101100\n1111111000\n0001001101\n0110111011\n0110110011\n1001011001",
"output": "80805519"
},
{
"input": "11100011000100010110010011101010101010011110001100011010111110011000011010110111\n1110001100\n0110101111\n0100111010\n0101000000\n1001100001\n1010101001\n0000100010\n1010110111\n1100011100\n0100010110",
"output": "09250147"
},
{
"input": "10000110110000010100000010001000111101110110101011110111000100001101000000100010\n0000010100\n0000110001\n0110101011\n1101110001\n1000011011\n0000110100\n0011110111\n1000110010\n0000100010\n0000011011",
"output": "40862358"
},
{
"input": "01000000010000000110100101000110110000100100000001101100001000011111111001010001\n1011000010\n1111101010\n0111110011\n0000000110\n0000001001\n0001111111\n0110010010\n0100000001\n1011001000\n1001010001",
"output": "73907059"
},
{
"input": "01111000111110011001110101110011110000111110010001101100110110100111101011001101\n1110010001\n1001100000\n1100001000\n1010011110\n1011001101\n0111100011\n1101011100\n1110011001\n1111000011\n0010000101",
"output": "57680434"
},
{
"input": "01001100101000100010001011110001000101001001100010010000001001001100101001011111\n1001011111\n1110010111\n0111101011\n1000100010\n0011100101\n0100000010\n0010111100\n0100010100\n1001100010\n0100110010",
"output": "93678590"
},
{
"input": "01110111110000111011101010110110101011010100110111000011101101110101011101001000\n0110000101\n1010101101\n1101010111\n1101011100\n0100110111\n0111011111\n1100011001\n0111010101\n0000111011\n1101001000",
"output": "58114879"
},
{
"input": "11101001111100110101110011010100110011011110100111010110110011000111000011001101\n1100011100\n1100110101\n1011101000\n0011011110\n0011001101\n0100010001\n1110100111\n1010101100\n1110110100\n0101101100",
"output": "61146904"
},
{
"input": "10101010001011010001001001011000100101100001011011101010101110101010001010101000\n0010110101\n1010011010\n1010101000\n1011010001\n1010101011\n0010010110\n0110100010\n1010100101\n0001011011\n0110100001",
"output": "23558422"
},
{
"input": "11110101001100010000110100001110101011011111010100110001000001001010001001101111\n0101101100\n1001101111\n1010101101\n0100101000\n1111110000\n0101010010\n1100010000\n1111010100\n1101000011\n1011111111",
"output": "76827631"
},
{
"input": "10001100110000110111100011001101111110110011110101000011011100001101110000110111\n0011110101\n0101100011\n1000110011\n1011011001\n0111111011\n0101111011\n0000110111\n0100001110\n1000000111\n0110110111",
"output": "26240666"
},
{
"input": "10000100010000111101100100111101111011101000001001100001000110000010010000111101\n1001001111\n0000111101\n1000010001\n0110011101\n0110101000\n1011111001\n0111101110\n1000001001\n1101011111\n0001010100",
"output": "21067271"
},
{
"input": "01101111000110111100011011110001101111001010001100101000110001010101100100000010\n1010001100\n0011010011\n0101010110\n1111001100\n1100011000\n0100101100\n1001100101\n0110111100\n0011001101\n0100000010",
"output": "77770029"
},
{
"input": "10100111011010001011111000000111100000010101000011000010111101010000111010011101\n1010011101\n1010111111\n0110100110\n1111000100\n1110000001\n0000101111\n0011111000\n1000110001\n0101000011\n1010001011",
"output": "09448580"
},
{
"input": "10000111111000011111001010101010010011111001001111000010010100100011000010001100\n1101101110\n1001001111\n0000100101\n1100111010\n0010101010\n1110000110\n1100111101\n0010001100\n1110000001\n1000011111",
"output": "99411277"
},
{
"input": "10110110111011001111101100111100111111011011011011001111110110010011100010000111\n0111010011\n0111101100\n1001101010\n0101000101\n0010000111\n0011111101\n1011001111\n1101111000\n1011011011\n1001001110",
"output": "86658594"
},
{
"input": "01001001100101100011110110111100000110001111001000100000110111110010000000011000\n0100100110\n1000001011\n1000111110\n0000011000\n0101100011\n1101101111\n1111001000\n1011011001\n1000001101\n0010101000",
"output": "04536863"
},
{
"input": "10010100011101000011100100001100101111000010111100000010010000001001001101011101\n1001000011\n1101000011\n1001010001\n1101011101\n1000010110\n0011111101\n0010111100\n0000100100\n1010001000\n0101000110",
"output": "21066773"
},
{
"input": "01111111110101111111011111111111010010000001100000101000100100111001011010001001\n0111111111\n0101111111\n0100101101\n0001100000\n0011000101\n0011100101\n1101001000\n0010111110\n1010001001\n1111000111",
"output": "01063858"
},
{
"input": "00100011111001001010001111000011101000001110100000000100101011101000001001001010\n0010001111\n1001001010\n1010011001\n0011100111\n1000111000\n0011110000\n0000100010\n0001001010\n1111110111\n1110100000",
"output": "01599791"
},
{
"input": "11011101000100110100110011010101100011111010011010010011010010010010100110101111\n0100110100\n1001001010\n0001111101\n1101011010\n1101110100\n1100110101\n0110101111\n0110001111\n0001101000\n1010011010",
"output": "40579016"
},
{
"input": "10000010111101110110011000111110000011100110001111100100000111000011011000001011\n0111010100\n1010110110\n1000001110\n1110000100\n0110001111\n1101110110\n1100001101\n1000001011\n0000000101\n1001000001",
"output": "75424967"
},
{
"input": "11101100101110111110111011111010001111111111000001001001000010001111111110110010\n0101100001\n1111010011\n1110111110\n0100110100\n1110011111\n1000111111\n0010010000\n1110110010\n0011000010\n1111000001",
"output": "72259657"
},
{
"input": "01011110100101111010011000001001100000101001110011010111101011010000110110010101\n0100111100\n0101110011\n0101111010\n0110000010\n0101001111\n1101000011\n0110010101\n0111011010\n0001101110\n1001110011",
"output": "22339256"
},
{
"input": "01100000100101111000100001100010000110000010100100100001100000110011101001110000\n0101111000\n1001110000\n0001000101\n0110110111\n0010100100\n1000011000\n1101110110\n0110000010\n0001011010\n0011001110",
"output": "70554591"
},
{
"input": "11110011011000001001111100110101001000010100100000110011001110011111100100100001\n1010011000\n1111001101\n0100100001\n1111010011\n0100100000\n1001111110\n1010100111\n1000100111\n1000001001\n1100110011",
"output": "18124952"
},
{
"input": "10001001011000100101010110011101011001110010000001010110000101000100101111101010\n0101100001\n1100001100\n1111101010\n1000100101\n0010000001\n0100010010\n0010110110\n0101100111\n0000001110\n1101001110",
"output": "33774052"
},
{
"input": "00110010000111001001001100100010010111101011011110001011111100000101000100000001\n0100000001\n1011011110\n0010111111\n0111100111\n0100111001\n0000010100\n1001011110\n0111001001\n0100010011\n0011001000",
"output": "97961250"
},
{
"input": "01101100001000110101101100101111101110010011010111100011010100010001101000110101\n1001101001\n1000110101\n0110110000\n0111100100\n0011010111\n1110111001\n0001000110\n0000000100\n0001101001\n1011001011",
"output": "21954161"
},
{
"input": "10101110000011010110101011100000101101000110100000101101101101110101000011110010\n0110100000\n1011011011\n0011110010\n0001110110\n0010110100\n1100010010\n0001101011\n1010111000\n0011010110\n0111010100",
"output": "78740192"
},
{
"input": "11000101011100100111010000010001000001001100101100000011000000001100000101011010\n1100010101\n1111101011\n0101011010\n0100000100\n1000110111\n1100100111\n1100101100\n0111001000\n0000110000\n0110011111",
"output": "05336882"
},
{
"input": "11110100010000101110010110001000001011100101100010110011011011111110001100110110\n0101100010\n0100010001\n0000101110\n1100110110\n0101000101\n0011001011\n1111010001\n1000110010\n1111111000\n1010011111",
"output": "62020383"
},
{
"input": "00011001111110000011101011010001010111100110100101000110011111011001100000001100\n0111001101\n0101011110\n0001100111\n1101011111\n1110000011\n0000001100\n0111010001\n1101100110\n1010110100\n0110100101",
"output": "24819275"
},
{
"input": "10111110010011111001001111100101010111010011111001001110101000111110011001111101\n0011111001\n0101011101\n0100001010\n0001110010\n1001111101\n0011101010\n1111001001\n1100100001\n1001101000\n1011111001",
"output": "90010504"
},
{
"input": "01111101111100101010001001011110111001110111110111011111011110110111111011011111\n1111110111\n0010000101\n0110000100\n0111111011\n1011100111\n1100101010\n1011011111\n1100010001\n0111110111\n0010010111",
"output": "85948866"
},
{
"input": "01111100000111110000110010111001111100001001101010110010111010001000101001101010\n0100010101\n1011110101\n1010100100\n1010000001\n1001101010\n0101100110\n1000100010\n0111110000\n1100101110\n0110010110",
"output": "77874864"
},
{
"input": "11100011010000000010011110010111001011111001000111000000001000000000100111100101\n0000000010\n1110001101\n0011010101\n0111100101\n1001000111\n1101001111\n0111010110\n1100101111\n0110000000\n1101101011",
"output": "10374003"
},
{
"input": "01111011100111101110011001000110001111101000111110100100100001011111001011100010\n0110010100\n1100010001\n0111101110\n1001001000\n1010011011\n1000111110\n0010110101\n1011100010\n0101111100\n0110010001",
"output": "22955387"
},
{
"input": "11011010001100000011000100110011010101000110011110110000001100111100001000011111\n0000100010\n1000011111\n1101101000\n0110011110\n0011110000\n1100000011\n0010001100\n0101101000\n0001001100\n1101010100",
"output": "25893541"
},
{
"input": "01011001011111010010101111011001000011001100011101101111011011010011101011110110\n0100001100\n0101100101\n1111111011\n1111010010\n1111101100\n1100011101\n1011000011\n1101001110\n1011110110\n0110001010",
"output": "13805878"
},
{
"input": "11110011011000111111001100111110001111111100000010111100110100110011111111001101\n1111001101\n1001101010\n1100110010\n0011001111\n0001011110\n1000110011\n1000111111\n0110001010\n1001011101\n1100000010",
"output": "06369030"
},
{
"input": "01110011110010000011011001011000001000010110010110011001100001100110001100101000\n0000100001\n0110011000\n1010000010\n1110011101\n0111001111\n1100101000\n0010000011\n0110010000\n1100100101\n0110010110",
"output": "46909115"
},
{
"input": "00001011001111110111111111011111111101110101110100010111010010100101100001010110\n1111110111\n0001010110\n0111011011\n0111000001\n1010010110\n0101110100\n0001000101\n0000111000\n0110100001\n0000101100",
"output": "90005541"
}
] | 1,623,707,300
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 154
| 0
|
import sys
def get_ints(): return [int(x) for x in sys.stdin.readline().strip().split()]
def get_string(): return sys.stdin.readline().strip()
s=get_string()
sar=[get_string() for i in range(10)]
for i in range(8):
str=s[i*10:i*10+10]
for j in range(len(sar)):
if(str==sar[j]):
print(j,end="")
break
|
Title: Restoring Password
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
Input Specification:
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
Output Specification:
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
Demo Input:
['01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n', '10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n']
Demo Output:
['12345678\n', '30234919\n']
Note:
none
|
```python
import sys
def get_ints(): return [int(x) for x in sys.stdin.readline().strip().split()]
def get_string(): return sys.stdin.readline().strip()
s=get_string()
sar=[get_string() for i in range(10)]
for i in range(8):
str=s[i*10:i*10+10]
for j in range(len(sar)):
if(str==sar[j]):
print(j,end="")
break
```
| 3.9615
|
300
|
A
|
Array
|
PROGRAMMING
| 1,100
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold:
1. The product of all numbers in the first set is less than zero (<=<<=0). 1. The product of all numbers in the second set is greater than zero (<=><=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set.
Help Vitaly. Divide the given array.
|
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements.
|
In the first line print integer *n*1 (*n*1<=><=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set.
In the next line print integer *n*2 (*n*2<=><=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set.
In the next line print integer *n*3 (*n*3<=><=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set.
The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them.
|
[
"3\n-1 2 0\n",
"4\n-1 -2 -3 0\n"
] |
[
"1 -1\n1 2\n1 0\n",
"1 -1\n2 -3 -2\n1 0\n"
] |
none
| 500
|
[
{
"input": "3\n-1 2 0",
"output": "1 -1\n1 2\n1 0"
},
{
"input": "4\n-1 -2 -3 0",
"output": "1 -1\n2 -3 -2\n1 0"
},
{
"input": "5\n-1 -2 1 2 0",
"output": "1 -1\n2 1 2\n2 0 -2"
},
{
"input": "100\n-64 -51 -75 -98 74 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 52 -35 4 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 86 -25 -94 -56 60 -24 -37 -72 -41 -31 11 -48 28 -38 -42 -39 -33 -70 -84 0 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 17 -2 -63 -89 88 13 -58 -82",
"output": "89 -64 -51 -75 -98 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 -35 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 -25 -94 -56 -24 -37 -72 -41 -31 -48 -38 -42 -39 -33 -70 -84 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 -2 -63 -89 -58 -82\n10 74 52 4 86 60 11 28 17 88 13\n1 0"
},
{
"input": "100\n3 -66 -17 54 24 -29 76 89 32 -37 93 -16 99 -25 51 78 23 68 -95 59 18 34 -45 77 9 39 -10 19 8 73 -5 60 12 31 0 2 26 40 48 30 52 49 27 4 87 57 85 58 -61 50 83 80 69 67 91 97 -96 11 100 56 82 53 13 -92 -72 70 1 -94 -63 47 21 14 74 7 6 33 55 65 64 -41 81 42 36 28 38 20 43 71 90 -88 22 84 -86 15 75 62 44 35 98 46",
"output": "19 -66 -17 -29 -37 -16 -25 -95 -45 -10 -5 -61 -96 -92 -72 -94 -63 -41 -88 -86\n80 3 54 24 76 89 32 93 99 51 78 23 68 59 18 34 77 9 39 19 8 73 60 12 31 2 26 40 48 30 52 49 27 4 87 57 85 58 50 83 80 69 67 91 97 11 100 56 82 53 13 70 1 47 21 14 74 7 6 33 55 65 64 81 42 36 28 38 20 43 71 90 22 84 15 75 62 44 35 98 46\n1 0"
},
{
"input": "100\n-17 16 -70 32 -60 75 -100 -9 -68 -30 -42 86 -88 -98 -47 -5 58 -14 -94 -73 -80 -51 -66 -85 -53 49 -25 -3 -45 -69 -11 -64 83 74 -65 67 13 -91 81 6 -90 -54 -12 -39 0 -24 -71 -41 -44 57 -93 -20 -92 18 -43 -52 -55 -84 -89 -19 40 -4 -99 -26 -87 -36 -56 -61 -62 37 -95 -28 63 23 35 -82 1 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 46 -15 -48 -34 -59 -7 -29 50 -33 -72 -79 22 38",
"output": "75 -17 -70 -60 -100 -9 -68 -30 -42 -88 -98 -47 -5 -14 -94 -73 -80 -51 -66 -85 -53 -25 -3 -45 -69 -11 -64 -65 -91 -90 -54 -12 -39 -24 -71 -41 -44 -93 -20 -92 -43 -52 -55 -84 -89 -19 -4 -99 -26 -87 -36 -56 -61 -62 -95 -28 -82 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 -15 -48 -34 -59 -7 -29 -33 -72 -79\n24 16 32 75 86 58 49 83 74 67 13 81 6 57 18 40 37 63 23 35 1 46 50 22 38\n1 0"
},
{
"input": "100\n-97 -90 61 78 87 -52 -3 65 83 38 30 -60 35 -50 -73 -77 44 -32 -81 17 -67 58 -6 -34 47 -28 71 -45 69 -80 -4 -7 -57 -79 43 -27 -31 29 16 -89 -21 -93 95 -82 74 -5 -70 -20 -18 36 -64 -66 72 53 62 -68 26 15 76 -40 -99 8 59 88 49 -23 9 10 56 -48 -98 0 100 -54 25 94 13 -63 42 39 -1 55 24 -12 75 51 41 84 -96 -85 -2 -92 14 -46 -91 -19 -11 -86 22 -37",
"output": "51 -97 -90 -52 -3 -60 -50 -73 -77 -32 -81 -67 -6 -34 -28 -45 -80 -4 -7 -57 -79 -27 -31 -89 -21 -93 -82 -5 -70 -20 -18 -64 -66 -68 -40 -99 -23 -48 -98 -54 -63 -1 -12 -96 -85 -2 -92 -46 -91 -19 -11 -86\n47 61 78 87 65 83 38 30 35 44 17 58 47 71 69 43 29 16 95 74 36 72 53 62 26 15 76 8 59 88 49 9 10 56 100 25 94 13 42 39 55 24 75 51 41 84 14 22\n2 0 -37"
},
{
"input": "100\n-75 -60 -18 -92 -71 -9 -37 -34 -82 28 -54 93 -83 -76 -58 -88 -17 -97 64 -39 -96 -81 -10 -98 -47 -100 -22 27 14 -33 -19 -99 87 -66 57 -21 -90 -70 -32 -26 24 -77 -74 13 -44 16 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 69 0 -20 -79 59 -48 -4 -72 -67 -46 62 51 -52 -86 -40 56 -53 85 -35 -8 49 50 65 29 11 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 78 94 -23 -63 84 89 -61",
"output": "73 -75 -60 -18 -92 -71 -9 -37 -34 -82 -54 -83 -76 -58 -88 -17 -97 -39 -96 -81 -10 -98 -47 -100 -22 -33 -19 -99 -66 -21 -90 -70 -32 -26 -77 -74 -44 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 -20 -79 -48 -4 -72 -67 -46 -52 -86 -40 -53 -35 -8 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 -23 -63\n25 28 93 64 27 14 87 57 24 13 16 69 59 62 51 56 85 49 50 65 29 11 78 94 84 89\n2 0 -61"
},
{
"input": "100\n-87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 49 38 -20 -45 -64 44 -96 -35 -74 -65 -41 -21 -75 37 -12 -67 0 -3 5 -80 -93 -81 -97 -47 -63 53 -100 95 -79 -83 -90 -32 88 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 60 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 8 -72 18 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 84 -86 -7 -57 -14 40 -33 51 -26 46 59 -31 -58 -66",
"output": "83 -87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 -20 -45 -64 -96 -35 -74 -65 -41 -21 -75 -12 -67 -3 -80 -93 -81 -97 -47 -63 -100 -79 -83 -90 -32 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 -72 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 -86 -7 -57 -14 -33 -26 -31 -58 -66\n16 49 38 44 37 5 53 95 88 60 8 18 84 40 51 46 59\n1 0"
},
{
"input": "100\n-95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 77 -69 -10 -12 -78 -14 -52 -57 -40 -75 4 -98 -6 7 -53 -3 -90 -63 -8 -20 88 -91 -32 -76 -80 -97 -34 -27 -19 0 70 -38 -9 -49 -67 73 -36 2 81 -39 -65 -83 -64 -18 -94 -79 -58 -16 87 -22 -74 -25 -13 -46 -89 -47 5 -15 -54 -99 56 -30 -60 -21 -86 33 -1 -50 -68 -100 -85 -29 92 -48 -61 42 -84 -93 -41 -82",
"output": "85 -95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 -69 -10 -12 -78 -14 -52 -57 -40 -75 -98 -6 -53 -3 -90 -63 -8 -20 -91 -32 -76 -80 -97 -34 -27 -19 -38 -9 -49 -67 -36 -39 -65 -83 -64 -18 -94 -79 -58 -16 -22 -74 -25 -13 -46 -89 -47 -15 -54 -99 -30 -60 -21 -86 -1 -50 -68 -100 -85 -29 -48 -61 -84 -93 -41 -82\n14 77 4 7 88 70 73 2 81 87 5 56 33 92 42\n1 0"
},
{
"input": "100\n-12 -41 57 13 83 -36 53 69 -6 86 -75 87 11 -5 -4 -14 -37 -84 70 2 -73 16 31 34 -45 94 -9 26 27 52 -42 46 96 21 32 7 -18 61 66 -51 95 -48 -76 90 80 -40 89 77 78 54 -30 8 88 33 -24 82 -15 19 1 59 44 64 -97 -60 43 56 35 47 39 50 29 28 -17 -67 74 23 85 -68 79 0 65 55 -3 92 -99 72 93 -71 38 -10 -100 -98 81 62 91 -63 -58 49 -20 22",
"output": "35 -12 -41 -36 -6 -75 -5 -4 -14 -37 -84 -73 -45 -9 -42 -18 -51 -48 -76 -40 -30 -24 -15 -97 -60 -17 -67 -68 -3 -99 -71 -10 -100 -98 -63 -58\n63 57 13 83 53 69 86 87 11 70 2 16 31 34 94 26 27 52 46 96 21 32 7 61 66 95 90 80 89 77 78 54 8 88 33 82 19 1 59 44 64 43 56 35 47 39 50 29 28 74 23 85 79 65 55 92 72 93 38 81 62 91 49 22\n2 0 -20"
},
{
"input": "100\n-34 81 85 -96 50 20 54 86 22 10 -19 52 65 44 30 53 63 71 17 98 -92 4 5 -99 89 -23 48 9 7 33 75 2 47 -56 42 70 -68 57 51 83 82 94 91 45 46 25 95 11 -12 62 -31 -87 58 38 67 97 -60 66 73 -28 13 93 29 59 -49 77 37 -43 -27 0 -16 72 15 79 61 78 35 21 3 8 84 1 -32 36 74 -88 26 100 6 14 40 76 18 90 24 69 80 64 55 41",
"output": "19 -34 -96 -19 -92 -99 -23 -56 -68 -12 -31 -87 -60 -28 -49 -43 -27 -16 -32 -88\n80 81 85 50 20 54 86 22 10 52 65 44 30 53 63 71 17 98 4 5 89 48 9 7 33 75 2 47 42 70 57 51 83 82 94 91 45 46 25 95 11 62 58 38 67 97 66 73 13 93 29 59 77 37 72 15 79 61 78 35 21 3 8 84 1 36 74 26 100 6 14 40 76 18 90 24 69 80 64 55 41\n1 0"
},
{
"input": "100\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952 -935",
"output": "97 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983\n2 -935 -952\n1 0"
},
{
"input": "99\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952",
"output": "95 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941\n2 -952 -983\n2 0 -961"
},
{
"input": "59\n-990 -876 -641 -726 718 -53 803 -954 894 -265 -587 -665 904 349 754 -978 441 794 -768 -428 -569 -476 188 -620 -290 -333 45 705 -201 109 165 446 13 122 714 -562 -15 -86 -960 43 329 578 287 -776 -14 -71 915 886 -259 337 -495 913 -498 -669 -673 818 225 647 0",
"output": "29 -990 -876 -641 -726 -53 -954 -265 -587 -665 -978 -768 -428 -569 -476 -620 -290 -333 -201 -562 -15 -86 -960 -776 -14 -71 -259 -495 -498 -669\n28 718 803 894 904 349 754 441 794 188 45 705 109 165 446 13 122 714 43 329 578 287 915 886 337 913 818 225 647\n2 0 -673"
},
{
"input": "64\n502 885 -631 -906 735 687 642 -29 -696 -165 -524 15 -129 -663 -846 -501 -651 895 -341 -833 -142 33 -847 688 945 -192 -587 -930 603 849 736 676 788 256 863 -509 319 -49 -807 -158 218 -886 -143 -639 118 -156 -291 325 892 -916 -622 -960 -959 -731 -943 436 -535 861 745 589 -159 376 -182 0",
"output": "35 -631 -906 -29 -696 -165 -524 -129 -663 -846 -501 -651 -341 -833 -142 -847 -192 -587 -930 -509 -49 -807 -158 -886 -143 -639 -156 -291 -916 -622 -960 -959 -731 -943 -535 -159\n27 502 885 735 687 642 15 895 33 688 945 603 849 736 676 788 256 863 319 218 118 325 892 436 861 745 589 376\n2 0 -182"
},
{
"input": "5\n-1 -2 -3 -4 0",
"output": "1 -1\n2 -4 -3\n2 0 -2"
},
{
"input": "3\n-101 101 0",
"output": "1 -101\n1 101\n1 0"
},
{
"input": "21\n-100 -200 -300 -400 -500 -600 -700 -800 -900 -1000 0 100 200 300 400 500 600 700 800 900 1000",
"output": "9 -100 -200 -300 -400 -500 -600 -700 -800 -900\n10 100 200 300 400 500 600 700 800 900 1000\n2 0 -1000"
},
{
"input": "4\n0 -1 -2 -3",
"output": "1 -1\n2 -3 -2\n1 0"
}
] | 1,622,894,101
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 218
| 0
|
n=int(input())
arr=list(map(int,input().split(" ")))
pos=[]
neg=[]
zero=[]
for i in range(len(arr)):
if arr[i]>0:
pos.append(arr[i])
elif arr[i]==0:
zero.append(arr[i])
else:
neg.append(arr[i])
if len(pos)==0:
#print("yes no elements in positive")
pos.append(neg[0])
pos.append(neg[1])
neg.pop(1)
neg.pop(0)
if len(neg)%2==0:
#print("yes negative one is even")
zero.append(neg[0])
neg.pop(0)
print(len(neg),end=" ")
for i in range(len(neg)):
print(neg[i],end=" ")
print()
print(len(pos),end=" ")
for i in range(len(pos)):
print(pos[i],end=" ")
print()
print(len(zero),end=" ")
for i in range(len(zero)):
print(zero[i],end=" ")
|
Title: Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold:
1. The product of all numbers in the first set is less than zero (<=<<=0). 1. The product of all numbers in the second set is greater than zero (<=><=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set.
Help Vitaly. Divide the given array.
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements.
Output Specification:
In the first line print integer *n*1 (*n*1<=><=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set.
In the next line print integer *n*2 (*n*2<=><=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set.
In the next line print integer *n*3 (*n*3<=><=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set.
The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them.
Demo Input:
['3\n-1 2 0\n', '4\n-1 -2 -3 0\n']
Demo Output:
['1 -1\n1 2\n1 0\n', '1 -1\n2 -3 -2\n1 0\n']
Note:
none
|
```python
n=int(input())
arr=list(map(int,input().split(" ")))
pos=[]
neg=[]
zero=[]
for i in range(len(arr)):
if arr[i]>0:
pos.append(arr[i])
elif arr[i]==0:
zero.append(arr[i])
else:
neg.append(arr[i])
if len(pos)==0:
#print("yes no elements in positive")
pos.append(neg[0])
pos.append(neg[1])
neg.pop(1)
neg.pop(0)
if len(neg)%2==0:
#print("yes negative one is even")
zero.append(neg[0])
neg.pop(0)
print(len(neg),end=" ")
for i in range(len(neg)):
print(neg[i],end=" ")
print()
print(len(pos),end=" ")
for i in range(len(pos)):
print(pos[i],end=" ")
print()
print(len(zero),end=" ")
for i in range(len(zero)):
print(zero[i],end=" ")
```
| 3
|
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,625,081,191
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 122
| 0
|
s=input()
t=input()
count=0
i=0
x=s[0]
while i<len(t):
if x==t[i]:
count+=1
x=s[count]
i+=1
print(count+1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
s=input()
t=input()
count=0
i=0
x=s[0]
while i<len(t):
if x==t[i]:
count+=1
x=s[count]
i+=1
print(count+1)
```
| 3
|
|
234
|
G
|
Practice
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"divide and conquer",
"implementation"
] | null | null |
Little time is left before Berland annual football championship. Therefore the coach of team "Losewille Rangers" decided to resume the practice, that were indefinitely interrupted for uncertain reasons. Overall there are *n* players in "Losewille Rangers". Each player on the team has a number — a unique integer from 1 to *n*. To prepare for the championship, the coach Mr. Floppe decided to spend some number of practices.
Mr. Floppe spent some long nights of his holiday planning how to conduct the practices. He came to a very complex practice system. Each practice consists of one game, all *n* players of the team take part in the game. The players are sorted into two teams in some way. In this case, the teams may have different numbers of players, but each team must have at least one player.
The coach wants to be sure that after the series of the practice sessions each pair of players had at least one practice, when they played in different teams. As the players' energy is limited, the coach wants to achieve the goal in the least number of practices.
Help him to schedule the practices.
|
A single input line contains integer *n* (2<=≤<=*n*<=≤<=1000).
|
In the first line print *m* — the minimum number of practices the coach will have to schedule. Then print the descriptions of the practices in *m* lines.
In the *i*-th of those lines print *f**i* — the number of players in the first team during the *i*-th practice (1<=≤<=*f**i*<=<<=*n*), and *f**i* numbers from 1 to *n* — the numbers of players in the first team. The rest of the players will play in the second team during this practice. Separate numbers on a line with spaces. Print the numbers of the players in any order. If there are multiple optimal solutions, print any of them.
|
[
"2\n",
"3\n"
] |
[
"1\n1 1\n",
"2\n2 1 2\n1 1\n"
] |
none
| 0
|
[
{
"input": "2",
"output": "1\n1 1"
},
{
"input": "3",
"output": "2\n2 1 2\n1 1"
},
{
"input": "4",
"output": "2\n2 1 2\n2 1 3"
},
{
"input": "5",
"output": "3\n3 1 2 3\n3 1 2 4\n1 1"
},
{
"input": "6",
"output": "3\n3 1 2 3\n4 1 2 4 5\n2 1 4"
},
{
"input": "7",
"output": "3\n4 1 2 3 4\n4 1 2 5 6\n3 1 3 5"
},
{
"input": "8",
"output": "3\n4 1 2 3 4\n4 1 2 5 6\n4 1 3 5 7"
},
{
"input": "9",
"output": "4\n5 1 2 3 4 5\n5 1 2 3 6 7\n5 1 2 4 6 8\n1 1"
},
{
"input": "10",
"output": "4\n5 1 2 3 4 5\n6 1 2 3 6 7 8\n6 1 2 4 6 7 9\n2 1 6"
},
{
"input": "11",
"output": "4\n6 1 2 3 4 5 6\n6 1 2 3 7 8 9\n7 1 2 4 5 7 8 10\n3 1 4 7"
},
{
"input": "13",
"output": "4\n7 1 2 3 4 5 6 7\n7 1 2 3 4 8 9 10\n8 1 2 5 6 8 9 11 12\n5 1 3 5 8 11"
},
{
"input": "15",
"output": "4\n8 1 2 3 4 5 6 7 8\n8 1 2 3 4 9 10 11 12\n8 1 2 5 6 9 10 13 14\n7 1 3 5 7 9 11 13"
},
{
"input": "16",
"output": "4\n8 1 2 3 4 5 6 7 8\n8 1 2 3 4 9 10 11 12\n8 1 2 5 6 9 10 13 14\n8 1 3 5 7 9 11 13 15"
},
{
"input": "18",
"output": "5\n9 1 2 3 4 5 6 7 8 9\n10 1 2 3 4 5 10 11 12 13 14\n10 1 2 3 6 7 10 11 12 15 16\n10 1 2 4 6 8 10 11 13 15 17\n2 1 10"
},
{
"input": "20",
"output": "5\n10 1 2 3 4 5 6 7 8 9 10\n10 1 2 3 4 5 11 12 13 14 15\n12 1 2 3 6 7 8 11 12 13 16 17 18\n12 1 2 4 6 7 9 11 12 14 16 17 19\n4 1 6 11 16"
},
{
"input": "100",
"output": "7\n50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50\n50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75\n52 1 2 3 4 5 6 7 8 9 10 11 12 13 26 27 28 29 30 31 32 33 34 35 36 37 38 51 52 53 54 55 56 57 58 59 60 61 62 63 76 77 78 79 80 81 82 83 84 85 86 87 88\n52 1 2 3 4 5 6 7 14 15 16 17 18 19 26 27 28 29 30 31 32 39 40 41 42..."
},
{
"input": "110",
"output": "7\n55 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55\n56 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83\n56 1 2 3 4 5 6 7 8 9 10 11 12 13 14 29 30 31 32 33 34 35 36 37 38 39 40 41 42 56 57 58 59 60 61 62 63 64 65 66 67 68 69 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n56 1 2 3 4 5 6 7 15 16..."
},
{
"input": "120",
"output": "7\n60 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60\n60 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90\n60 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 91 92 93 94 95 96 97 98 99 10..."
},
{
"input": "140",
"output": "8\n70 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70\n70 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105\n72 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50..."
},
{
"input": "157",
"output": "8\n79 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79\n79 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118\n80 1 2 3 4 5 6 7 8 9 10 1..."
},
{
"input": "171",
"output": "8\n86 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86\n86 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 1..."
},
{
"input": "199",
"output": "8\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 11..."
},
{
"input": "200",
"output": "8\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 11..."
},
{
"input": "213",
"output": "8\n107 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107\n107 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 108 109 110 111 112 113 11..."
},
{
"input": "231",
"output": "8\n116 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116\n116 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51..."
},
{
"input": "240",
"output": "8\n120 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120\n120 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 4..."
},
{
"input": "250",
"output": "8\n125 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125\n126 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39..."
},
{
"input": "253",
"output": "8\n127 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127\n127 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 ..."
},
{
"input": "260",
"output": "9\n130 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130\n130 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 ..."
},
{
"input": "270",
"output": "9\n135 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135\n136 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 2..."
},
{
"input": "271",
"output": "9\n136 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136\n136 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 ..."
},
{
"input": "277",
"output": "9\n139 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139\n139 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 ..."
},
{
"input": "280",
"output": "9\n140 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140\n140 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19..."
},
{
"input": "290",
"output": "9\n145 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145\n146 1 2 3 4 5 6 7 8 9 10 11 12 ..."
},
{
"input": "300",
"output": "9\n150 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150\n150 1 2 3 4..."
},
{
"input": "700",
"output": "10\n350 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "730",
"output": "10\n365 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "766",
"output": "10\n383 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "777",
"output": "10\n389 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "800",
"output": "10\n400 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "832",
"output": "10\n416 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "855",
"output": "10\n428 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "869",
"output": "10\n435 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "888",
"output": "10\n444 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "900",
"output": "10\n450 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "914",
"output": "10\n457 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "930",
"output": "10\n465 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "950",
"output": "10\n475 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "990",
"output": "10\n495 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
},
{
"input": "1000",
"output": "10\n500 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..."
}
] | 1,623,760,413
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 50
| 248
| 3,276,800
|
from math import *
f1=open('input.txt','r')
n=int(f1.readline())
f1.close()
a=[[] for i in range(int(log(n,2))+1)]
def f(l,r,d=0):
global a
if l!=r:
m=(l+r)//2
a[d]+=list(range(l,m+1))
f(l,m,d+1)
f(m+1,r,d+1)
f(1,n)
b=0
for i in range(len(a)):
if a[i]:
a[i]=[len(a[i])]+a[i]
b+=1
f2=open('output.txt','w')
print(b,file=f2)
for i in range(b):
print(*a[i],file=f2)
f2.close()
|
Title: Practice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little time is left before Berland annual football championship. Therefore the coach of team "Losewille Rangers" decided to resume the practice, that were indefinitely interrupted for uncertain reasons. Overall there are *n* players in "Losewille Rangers". Each player on the team has a number — a unique integer from 1 to *n*. To prepare for the championship, the coach Mr. Floppe decided to spend some number of practices.
Mr. Floppe spent some long nights of his holiday planning how to conduct the practices. He came to a very complex practice system. Each practice consists of one game, all *n* players of the team take part in the game. The players are sorted into two teams in some way. In this case, the teams may have different numbers of players, but each team must have at least one player.
The coach wants to be sure that after the series of the practice sessions each pair of players had at least one practice, when they played in different teams. As the players' energy is limited, the coach wants to achieve the goal in the least number of practices.
Help him to schedule the practices.
Input Specification:
A single input line contains integer *n* (2<=≤<=*n*<=≤<=1000).
Output Specification:
In the first line print *m* — the minimum number of practices the coach will have to schedule. Then print the descriptions of the practices in *m* lines.
In the *i*-th of those lines print *f**i* — the number of players in the first team during the *i*-th practice (1<=≤<=*f**i*<=<<=*n*), and *f**i* numbers from 1 to *n* — the numbers of players in the first team. The rest of the players will play in the second team during this practice. Separate numbers on a line with spaces. Print the numbers of the players in any order. If there are multiple optimal solutions, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['1\n1 1\n', '2\n2 1 2\n1 1\n']
Note:
none
|
```python
from math import *
f1=open('input.txt','r')
n=int(f1.readline())
f1.close()
a=[[] for i in range(int(log(n,2))+1)]
def f(l,r,d=0):
global a
if l!=r:
m=(l+r)//2
a[d]+=list(range(l,m+1))
f(l,m,d+1)
f(m+1,r,d+1)
f(1,n)
b=0
for i in range(len(a)):
if a[i]:
a[i]=[len(a[i])]+a[i]
b+=1
f2=open('output.txt','w')
print(b,file=f2)
for i in range(b):
print(*a[i],file=f2)
f2.close()
```
| 3
|
|
225
|
B
|
Well-known Numbers
|
PROGRAMMING
| 1,600
|
[
"binary search",
"greedy",
"number theory"
] | null | null |
Numbers *k*-bonacci (*k* is integer, *k*<=><=1) are a generalization of Fibonacci numbers and are determined as follows:
- *F*(*k*,<=*n*)<==<=0, for integer *n*, 1<=≤<=*n*<=<<=*k*; - *F*(*k*,<=*k*)<==<=1; - *F*(*k*,<=*n*)<==<=*F*(*k*,<=*n*<=-<=1)<=+<=*F*(*k*,<=*n*<=-<=2)<=+<=...<=+<=*F*(*k*,<=*n*<=-<=*k*), for integer *n*, *n*<=><=*k*.
Note that we determine the *k*-bonacci numbers, *F*(*k*,<=*n*), only for integer values of *n* and *k*.
You've got a number *s*, represent it as a sum of several (at least two) distinct *k*-bonacci numbers.
|
The first line contains two integers *s* and *k* (1<=≤<=*s*,<=*k*<=≤<=109; *k*<=><=1).
|
In the first line print an integer *m* (*m*<=≥<=2) that shows how many numbers are in the found representation. In the second line print *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m*. Each printed integer should be a *k*-bonacci number. The sum of printed integers must equal *s*.
It is guaranteed that the answer exists. If there are several possible answers, print any of them.
|
[
"5 2\n",
"21 5\n"
] |
[
"3\n0 2 3\n",
"3\n4 1 16\n"
] |
none
| 1,000
|
[
{
"input": "5 2",
"output": "3\n0 2 3"
},
{
"input": "21 5",
"output": "3\n4 1 16"
},
{
"input": "1 1000",
"output": "2\n1 0 "
},
{
"input": "1000000000 1000000000",
"output": "14\n536870912 268435456 134217728 33554432 16777216 8388608 1048576 524288 131072 32768 16384 2048 512 0 "
},
{
"input": "122 7",
"output": "6\n64 32 16 8 2 0 "
},
{
"input": "4 3",
"output": "2\n4 0 "
},
{
"input": "321123 3211232",
"output": "11\n262144 32768 16384 8192 1024 512 64 32 2 1 0 "
},
{
"input": "1 2",
"output": "2\n1 0 "
},
{
"input": "2 2",
"output": "2\n2 0 "
},
{
"input": "3 2",
"output": "2\n3 0 "
},
{
"input": "8 2",
"output": "2\n8 0 "
},
{
"input": "17 2",
"output": "4\n13 3 1 0 "
},
{
"input": "137 2",
"output": "5\n89 34 13 1 0 "
},
{
"input": "7298 2",
"output": "7\n6765 377 144 8 3 1 0 "
},
{
"input": "76754 2",
"output": "7\n75025 1597 89 34 8 1 0 "
},
{
"input": "12345678 2",
"output": "8\n9227465 2178309 832040 75025 28657 4181 1 0 "
},
{
"input": "987654321 2",
"output": "16\n701408733 267914296 14930352 2178309 832040 317811 46368 17711 6765 1597 233 89 13 3 1 0 "
},
{
"input": "1000000000 2",
"output": "15\n701408733 267914296 24157817 5702887 514229 196418 75025 28657 1597 233 89 13 5 1 0 "
},
{
"input": "701408733 2",
"output": "2\n701408733 0 "
},
{
"input": "1 3",
"output": "2\n1 0 "
},
{
"input": "2 3",
"output": "2\n2 0 "
},
{
"input": "3 3",
"output": "3\n2 1 0 "
},
{
"input": "100 3",
"output": "5\n81 13 4 2 0 "
},
{
"input": "87783 3",
"output": "8\n66012 19513 1705 504 44 4 1 0 "
},
{
"input": "615693473 3",
"output": "23\n334745777 181997601 53798080 29249425 8646064 4700770 1389537 755476 223317 121415 35890 19513 5768 3136 927 504 149 81 24 13 4 2 0 "
},
{
"input": "615693474 3",
"output": "2\n615693474 0 "
},
{
"input": "1000000000 3",
"output": "15\n615693474 334745777 29249425 15902591 2555757 1389537 410744 35890 10609 5768 274 149 4 1 0 "
},
{
"input": "1 4",
"output": "2\n1 0 "
},
{
"input": "2 4",
"output": "2\n2 0 "
},
{
"input": "17 4",
"output": "3\n15 2 0 "
},
{
"input": "234 4",
"output": "6\n208 15 8 2 1 0 "
},
{
"input": "23435345 4",
"output": "13\n14564533 7555935 1055026 147312 76424 20569 10671 2872 1490 401 108 4 0 "
},
{
"input": "989464701 4",
"output": "18\n747044834 201061985 28074040 7555935 3919944 1055026 547337 147312 39648 10671 5536 1490 773 108 56 4 2 0 "
},
{
"input": "464 5",
"output": "2\n464 0 "
},
{
"input": "7647474 5",
"output": "8\n5976577 1546352 103519 13624 6930 464 8 0 "
},
{
"input": "457787655 5",
"output": "14\n345052351 89277256 23099186 203513 103519 26784 13624 6930 3525 912 31 16 8 0 "
},
{
"input": "764747 6",
"output": "13\n463968 233904 59448 3840 1936 976 492 125 32 16 8 2 0 "
},
{
"input": "980765665 7",
"output": "16\n971364608 7805695 987568 495776 62725 31489 15808 1004 504 253 127 64 32 8 4 0 "
},
{
"input": "877655444 8",
"output": "17\n512966536 256993248 64504063 32316160 8111200 2035872 510994 128257 64256 16128 8080 509 128 8 4 1 0 "
},
{
"input": "567886500 9",
"output": "11\n525375999 32965728 8257696 1035269 129792 64960 32512 16272 8144 128 0 "
},
{
"input": "656777660 10",
"output": "13\n531372800 66519472 33276064 16646200 8327186 521472 65280 32656 16336 128 64 2 0 "
},
{
"input": "197445609 11",
"output": "18\n133628064 33423378 16715781 8359937 4180992 1045760 65424 16364 8184 1024 512 128 32 16 8 4 1 0 "
},
{
"input": "647474474 12",
"output": "18\n535625888 66977797 33492993 8375296 2094336 523712 261888 65488 32748 16376 4095 2048 1024 512 256 16 1 0 "
},
{
"input": "856644446 14",
"output": "16\n536592385 268304384 33541120 16771072 1048320 262096 65528 32765 16383 8192 2048 128 16 8 1 0 "
},
{
"input": "980345678 19",
"output": "18\n536864768 268432640 134216448 33554176 4194284 2097144 524287 262144 131072 65536 2048 1024 64 32 8 2 1 0 "
},
{
"input": "561854567 23",
"output": "17\n536870656 16777213 4194304 2097152 1048576 524288 262144 65536 8192 4096 2048 256 64 32 8 2 0 "
},
{
"input": "987654321 27",
"output": "20\n536870904 268435453 134217727 33554432 8388608 4194304 1048576 524288 262144 131072 16384 8192 2048 128 32 16 8 4 1 0 "
},
{
"input": "780787655 29",
"output": "18\n536870911 134217728 67108864 33554432 8388608 524288 65536 32768 16384 4096 2048 1024 512 256 128 64 8 0 "
},
{
"input": "999999999 30",
"output": "22\n536870912 268435456 134217728 33554432 16777216 8388608 1048576 524288 131072 32768 16384 2048 256 128 64 32 16 8 4 2 1 0 "
},
{
"input": "1 50",
"output": "2\n1 0 "
},
{
"input": "5 54",
"output": "3\n4 1 0 "
},
{
"input": "378 83",
"output": "7\n256 64 32 16 8 2 0 "
},
{
"input": "283847 111",
"output": "10\n262144 16384 4096 1024 128 64 4 2 1 0 "
},
{
"input": "38746466 2847",
"output": "14\n33554432 4194304 524288 262144 131072 65536 8192 4096 2048 256 64 32 2 0 "
},
{
"input": "83768466 12345",
"output": "15\n67108864 8388608 4194304 2097152 1048576 524288 262144 131072 8192 4096 1024 128 16 2 0 "
},
{
"input": "987654321 7475657",
"output": "18\n536870912 268435456 134217728 33554432 8388608 4194304 1048576 524288 262144 131072 16384 8192 2048 128 32 16 1 0 "
},
{
"input": "10 174764570",
"output": "3\n8 2 0 "
},
{
"input": "967755664 974301345",
"output": "17\n536870912 268435456 134217728 16777216 8388608 2097152 524288 262144 131072 32768 16384 1024 512 256 128 16 0 "
},
{
"input": "76 758866446",
"output": "4\n64 8 4 0 "
},
{
"input": "1 1000000000",
"output": "2\n1 0 "
},
{
"input": "469766205 719342208",
"output": "10\n268435456 134217728 67108864 4096 32 16 8 4 1 0 "
},
{
"input": "918938066 77",
"output": "17\n536870912 268435456 67108864 33554432 8388608 4194304 262144 65536 32768 16384 8192 256 128 64 16 2 0 "
},
{
"input": "856089381 19",
"output": "15\n536864768 268432640 33554176 16777104 262144 131072 65536 1024 512 256 128 16 4 1 0 "
},
{
"input": "152235195 16",
"output": "16\n134204416 16775936 1048528 131069 65535 8192 1024 256 128 64 32 8 4 2 1 0 "
},
{
"input": "429960894 3101",
"output": "17\n268435456 134217728 16777216 8388608 2097152 32768 8192 2048 1024 512 128 32 16 8 4 2 0 "
},
{
"input": "450695564 7",
"output": "18\n244804400 122895984 61695880 15548665 3918592 987568 495776 248888 62725 31489 3984 1004 504 64 32 8 1 0 "
},
{
"input": "154517270 24",
"output": "18\n134217708 16777215 2097152 1048576 262144 65536 32768 8192 4096 2048 1024 512 256 32 8 2 1 0 "
},
{
"input": "300919980 24",
"output": "20\n268435408 16777215 8388608 4194304 2097152 524288 262144 131072 65536 32768 8192 2048 1024 128 64 16 8 4 1 0 "
},
{
"input": "900077555 2",
"output": "16\n701408733 165580141 24157817 5702887 2178309 832040 196418 17711 2584 610 233 55 13 3 1 0 "
},
{
"input": "172285923 26",
"output": "17\n134217725 33554432 4194304 262144 32768 16384 4096 2048 1024 512 256 128 64 32 4 2 0 "
}
] | 1,441,297,830
| 1,349
|
PyPy 3
|
OK
|
TESTS
| 70
| 218
| 0
|
s,k=list(map(int,input().split(' ')))
a=[0,1,1]
while a[-1]<s:
if len(a)<k:
a.append(sum(a))
else:
t=0
for i in range(k):
t+=a[-i-1]
a.append(t)
if s==a[-1]:
print(2)
print(0,a[-1])
else:
use=[]
for i in range(len(a)):
if s>=a[-i-1]:
s-=a[-i-1]
use.append(a[-i-1])
print(len(use))
for i in use:
print(i,end=' ')
|
Title: Well-known Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Numbers *k*-bonacci (*k* is integer, *k*<=><=1) are a generalization of Fibonacci numbers and are determined as follows:
- *F*(*k*,<=*n*)<==<=0, for integer *n*, 1<=≤<=*n*<=<<=*k*; - *F*(*k*,<=*k*)<==<=1; - *F*(*k*,<=*n*)<==<=*F*(*k*,<=*n*<=-<=1)<=+<=*F*(*k*,<=*n*<=-<=2)<=+<=...<=+<=*F*(*k*,<=*n*<=-<=*k*), for integer *n*, *n*<=><=*k*.
Note that we determine the *k*-bonacci numbers, *F*(*k*,<=*n*), only for integer values of *n* and *k*.
You've got a number *s*, represent it as a sum of several (at least two) distinct *k*-bonacci numbers.
Input Specification:
The first line contains two integers *s* and *k* (1<=≤<=*s*,<=*k*<=≤<=109; *k*<=><=1).
Output Specification:
In the first line print an integer *m* (*m*<=≥<=2) that shows how many numbers are in the found representation. In the second line print *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m*. Each printed integer should be a *k*-bonacci number. The sum of printed integers must equal *s*.
It is guaranteed that the answer exists. If there are several possible answers, print any of them.
Demo Input:
['5 2\n', '21 5\n']
Demo Output:
['3\n0 2 3\n', '3\n4 1 16\n']
Note:
none
|
```python
s,k=list(map(int,input().split(' ')))
a=[0,1,1]
while a[-1]<s:
if len(a)<k:
a.append(sum(a))
else:
t=0
for i in range(k):
t+=a[-i-1]
a.append(t)
if s==a[-1]:
print(2)
print(0,a[-1])
else:
use=[]
for i in range(len(a)):
if s>=a[-i-1]:
s-=a[-i-1]
use.append(a[-i-1])
print(len(use))
for i in use:
print(i,end=' ')
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,610,219,109
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 124
| 0
|
m, n = input().split()
board = int(m) * int(n)
print(int(board / 2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
m, n = input().split()
board = int(m) * int(n)
print(int(board / 2))
```
| 3.969
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=≤<=*a**i*<=≤<=109), the number of answer variants to question *i*.
|
Print a single number — the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
[
"2\n1 1\n",
"2\n2 2\n",
"1\n10\n"
] |
[
"2",
"5",
"10"
] |
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
| 0
|
[
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n2 2",
"output": "5"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n2 4 1",
"output": "10"
},
{
"input": "4\n5 5 3 1",
"output": "22"
},
{
"input": "2\n1000000000 1000000000",
"output": "2999999999"
},
{
"input": "10\n5 7 8 1 10 3 6 4 10 6",
"output": "294"
},
{
"input": "100\n5 7 5 3 5 4 6 5 3 6 4 6 6 2 1 9 6 5 3 8 4 10 1 9 1 3 7 6 5 5 8 8 7 7 8 9 2 10 3 5 4 2 6 10 2 6 9 6 1 9 3 7 7 8 3 9 9 5 10 10 3 10 7 8 3 9 8 3 2 4 10 2 1 1 7 3 9 10 4 6 9 8 2 1 4 10 1 10 6 8 7 5 3 3 6 2 7 10 3 8",
"output": "24212"
},
{
"input": "100\n96 23 25 62 34 30 85 15 26 61 59 87 34 99 60 41 52 73 63 84 50 89 42 29 87 99 19 94 84 43 82 90 41 100 60 61 99 49 26 3 97 5 24 34 51 59 69 61 11 41 72 60 33 36 18 29 82 53 18 80 52 98 38 32 56 95 55 79 32 80 37 64 45 13 62 80 70 29 1 58 88 24 79 68 41 80 12 72 52 39 64 19 54 56 70 58 19 3 83 62",
"output": "261115"
},
{
"input": "100\n883 82 79 535 478 824 700 593 262 385 403 183 176 386 126 648 710 516 922 97 800 728 372 9 954 911 975 526 476 3 74 459 471 174 295 831 698 21 927 698 580 856 712 430 5 473 592 40 301 230 763 266 38 213 393 70 333 779 811 249 130 456 763 657 578 699 939 660 898 918 438 855 892 85 35 232 54 593 849 777 917 979 796 322 473 887 284 105 522 415 86 480 80 592 516 227 680 574 488 644",
"output": "2519223"
},
{
"input": "100\n6659 5574 5804 7566 7431 1431 3871 6703 200 300 3523 3580 8500 2312 4812 3149 3324 5846 8965 5758 5831 1341 7733 4477 355 3024 2941 9938 1494 16 1038 8262 9938 9230 5192 8113 7575 7696 5566 2884 8659 1951 1253 6480 3877 3707 5482 3825 5359 44 3219 3258 1785 5478 4525 5950 2417 1991 8885 4264 8769 2961 7107 8904 5097 2319 5713 8811 9723 8677 2153 3237 7174 9528 9260 7390 3050 6823 6239 5222 4602 933 7823 4198 8304 244 5845 3189 4490 3216 7877 6323 1938 4597 880 1206 1691 1405 4122 5950",
"output": "24496504"
},
{
"input": "50\n515844718 503470143 928669067 209884122 322869098 241621928 844696197 105586164 552680307 968792756 135928721 842094825 298782438 829020472 791637138 285482545 811025527 428952878 887796419 11883658 546401594 6272027 100292274 308219869 372132044 955814846 644008184 521195760 919389466 215065725 687764134 655750167 181397022 404292682 643251185 776299412 741398345 865144798 369796727 673902099 124966684 35796775 794385099 594562033 550366869 868093561 695094388 580789105 755076935 198783899",
"output": "685659563557"
},
{
"input": "10\n12528238 329065023 620046219 303914458 356423530 751571368 72944261 883971060 123105651 868129460",
"output": "27409624352"
},
{
"input": "1\n84355694",
"output": "84355694"
},
{
"input": "2\n885992042 510468669",
"output": "1906929379"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n2 1 2 2 2 2 1 2 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 1 2 1 1 2 1 1 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 2 2 1 1 1 2 2 1 1 2 1 1 2 2 2 2 1 2 2 2 1 2 1 2 2 1 2 1 1 1 2 2 1 2 1 2 1 1 1 2 1 2 2 2 1 1 1",
"output": "2686"
},
{
"input": "100\n1 3 2 1 1 2 1 3 2 2 3 1 1 1 2 2 1 3 3 1 1 2 2 3 2 1 3 1 3 2 1 1 3 3 2 1 2 2 2 3 2 2 3 2 2 3 2 1 3 1 1 2 1 3 2 2 1 1 1 1 1 1 3 1 2 3 1 1 1 1 1 2 3 3 1 1 1 1 2 3 3 1 3 2 2 3 2 1 3 2 2 3 1 1 3 2 3 2 3 1",
"output": "4667"
}
] | 1,430,381,132
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 124
| 4,710,400
|
n=int(input())
p=input().split()
l=[]
i=0
while i<n:
l.append(int(p[i]))
i=i+1
s=l[0]
for i in range(1,n):
s=s+l[i]+i*(l[i]-1)
print(s)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=≤<=*a**i*<=≤<=109), the number of answer variants to question *i*.
Output Specification:
Print a single number — the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['2\n1 1\n', '2\n2 2\n', '1\n10\n']
Demo Output:
['2', '5', '10']
Note:
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
|
```python
n=int(input())
p=input().split()
l=[]
i=0
while i<n:
l.append(int(p[i]))
i=i+1
s=l[0]
for i in range(1,n):
s=s+l[i]+i*(l[i]-1)
print(s)
```
| 3
|
|
672
|
A
|
Summer Camp
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
|
Print the *n*-th digit of the line.
|
[
"3\n",
"11\n"
] |
[
"3\n",
"0\n"
] |
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
| 500
|
[
{
"input": "3",
"output": "3"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "29",
"output": "9"
},
{
"input": "30",
"output": "2"
},
{
"input": "1000",
"output": "3"
},
{
"input": "999",
"output": "9"
},
{
"input": "100",
"output": "5"
},
{
"input": "123",
"output": "6"
},
{
"input": "8",
"output": "8"
},
{
"input": "157",
"output": "3"
},
{
"input": "289",
"output": "1"
},
{
"input": "179",
"output": "4"
},
{
"input": "942",
"output": "0"
},
{
"input": "879",
"output": "9"
},
{
"input": "394",
"output": "1"
},
{
"input": "423",
"output": "7"
},
{
"input": "952",
"output": "3"
},
{
"input": "121",
"output": "5"
},
{
"input": "613",
"output": "2"
},
{
"input": "945",
"output": "1"
},
{
"input": "270",
"output": "6"
},
{
"input": "781",
"output": "2"
},
{
"input": "453",
"output": "7"
},
{
"input": "171",
"output": "0"
},
{
"input": "643",
"output": "2"
},
{
"input": "570",
"output": "6"
},
{
"input": "750",
"output": "6"
},
{
"input": "500",
"output": "0"
},
{
"input": "2",
"output": "2"
},
{
"input": "1",
"output": "1"
},
{
"input": "108",
"output": "5"
},
{
"input": "500",
"output": "0"
},
{
"input": "189",
"output": "9"
},
{
"input": "491",
"output": "0"
},
{
"input": "191",
"output": "0"
}
] | 1,582,170,581
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 109
| 0
|
full = ""
for i in range(1,400):
full += str(i)
n = int(input())
print(full[n-1])
|
Title: Summer Camp
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
Output Specification:
Print the *n*-th digit of the line.
Demo Input:
['3\n', '11\n']
Demo Output:
['3\n', '0\n']
Note:
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
|
```python
full = ""
for i in range(1,400):
full += str(i)
n = int(input())
print(full[n-1])
```
| 3
|
|
999
|
A
|
Mishka and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
|
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
|
Print one integer — the maximum number of problems Mishka can solve.
|
[
"8 4\n4 2 3 1 5 1 6 4\n",
"5 2\n3 1 2 1 3\n",
"5 100\n12 34 55 43 21\n"
] |
[
"5\n",
"0\n",
"5\n"
] |
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
| 0
|
[
{
"input": "8 4\n4 2 3 1 5 1 6 4",
"output": "5"
},
{
"input": "5 2\n3 1 2 1 3",
"output": "0"
},
{
"input": "5 100\n12 34 55 43 21",
"output": "5"
},
{
"input": "100 100\n44 47 36 83 76 94 86 69 31 2 22 77 37 51 10 19 25 78 53 25 1 29 48 95 35 53 22 72 49 86 60 38 13 91 89 18 54 19 71 2 25 33 65 49 53 5 95 90 100 68 25 5 87 48 45 72 34 14 100 44 94 75 80 26 25 7 57 82 49 73 55 43 42 60 34 8 51 11 71 41 81 23 20 89 12 72 68 26 96 92 32 63 13 47 19 9 35 56 79 62",
"output": "100"
},
{
"input": "100 99\n84 82 43 4 71 3 30 92 15 47 76 43 2 17 76 4 1 33 24 96 44 98 75 99 59 11 73 27 67 17 8 88 69 41 44 22 91 48 4 46 42 21 21 67 85 51 57 84 11 100 100 59 39 72 89 82 74 19 98 14 37 97 20 78 38 52 44 83 19 83 69 32 56 6 93 13 98 80 80 2 33 71 11 15 55 51 98 58 16 91 39 32 83 58 77 79 88 81 17 98",
"output": "98"
},
{
"input": "100 69\n80 31 12 89 16 35 8 28 39 12 32 51 42 67 64 53 17 88 63 97 29 41 57 28 51 33 82 75 93 79 57 86 32 100 83 82 99 33 1 27 86 22 65 15 60 100 42 37 38 85 26 43 90 62 91 13 1 92 16 20 100 19 28 30 23 6 5 69 24 22 9 1 10 14 28 14 25 9 32 8 67 4 39 7 10 57 15 7 8 35 62 6 53 59 62 13 24 7 53 2",
"output": "39"
},
{
"input": "100 2\n2 2 2 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 2 1 1 1 2 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 16",
"output": "99"
},
{
"input": "100 3\n86 53 82 40 2 20 59 2 46 63 75 49 24 81 70 22 9 9 93 72 47 23 29 77 78 51 17 59 19 71 35 3 20 60 70 9 11 96 71 94 91 19 88 93 50 49 72 19 53 30 38 67 62 71 81 86 5 26 5 32 63 98 1 97 22 32 87 65 96 55 43 85 56 37 56 67 12 100 98 58 77 54 18 20 33 53 21 66 24 64 42 71 59 32 51 69 49 79 10 1",
"output": "1"
},
{
"input": "13 7\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "1 5\n4",
"output": "1"
},
{
"input": "3 2\n1 4 1",
"output": "2"
},
{
"input": "1 2\n100",
"output": "0"
},
{
"input": "7 4\n4 2 3 4 4 2 3",
"output": "7"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "1 2\n15",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "5 3\n3 4 3 2 1",
"output": "4"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "1 5\n1",
"output": "1"
},
{
"input": "6 6\n7 1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n6 5 5 5 5",
"output": "4"
},
{
"input": "1 4\n2",
"output": "1"
},
{
"input": "9 4\n1 2 1 2 4 2 1 2 1",
"output": "9"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n5",
"output": "1"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "100 10\n2 5 1 10 10 2 7 7 9 4 1 8 1 1 8 4 7 9 10 5 7 9 5 6 7 2 7 5 3 2 1 82 4 80 9 8 6 1 10 7 5 7 1 5 6 7 19 4 2 4 6 2 1 8 31 6 2 2 57 42 3 2 7 1 9 5 10 8 5 4 10 8 3 5 8 7 2 7 6 5 3 3 4 10 6 7 10 8 7 10 7 2 4 6 8 10 10 2 6 4",
"output": "71"
},
{
"input": "100 90\n17 16 5 51 17 62 24 45 49 41 90 30 19 78 67 66 59 34 28 47 42 8 33 77 90 41 61 16 86 33 43 71 90 95 23 9 56 41 24 90 31 12 77 36 90 67 47 15 92 50 79 88 42 19 21 79 86 60 41 26 47 4 70 62 44 90 82 89 84 91 54 16 90 53 29 69 21 44 18 28 88 74 56 43 12 76 10 22 34 24 27 52 28 76 90 75 5 29 50 90",
"output": "63"
},
{
"input": "100 10\n6 4 8 4 1 9 4 8 5 2 2 5 2 6 10 2 2 5 3 5 2 3 10 5 2 9 1 1 6 1 5 9 16 42 33 49 26 31 81 27 53 63 81 90 55 97 70 51 87 21 79 62 60 91 54 95 26 26 30 61 87 79 47 11 59 34 40 82 37 40 81 2 7 1 8 4 10 7 1 10 8 7 3 5 2 8 3 3 9 2 1 1 5 7 8 7 1 10 9 8",
"output": "61"
},
{
"input": "100 90\n45 57 52 69 17 81 85 60 59 39 55 14 87 90 90 31 41 57 35 89 74 20 53 4 33 49 71 11 46 90 71 41 71 90 63 74 51 13 99 92 99 91 100 97 93 40 93 96 100 99 100 92 98 96 78 91 91 91 91 100 94 97 95 97 96 95 17 13 45 35 54 26 2 74 6 51 20 3 73 90 90 42 66 43 86 28 84 70 37 27 90 30 55 80 6 58 57 51 10 22",
"output": "72"
},
{
"input": "100 10\n10 2 10 10 10 10 10 10 10 7 10 10 10 10 10 10 9 10 10 10 10 10 10 10 10 7 9 10 10 10 37 10 4 10 10 10 59 5 95 10 10 10 10 39 10 10 10 10 10 10 10 5 10 10 10 10 10 10 10 10 10 10 10 10 66 10 10 10 10 10 5 10 10 10 10 10 10 44 10 10 10 10 10 10 10 10 10 10 10 7 10 10 10 10 10 10 10 10 10 2",
"output": "52"
},
{
"input": "100 90\n57 90 90 90 90 90 90 90 81 90 3 90 39 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 92 90 90 90 90 90 90 90 90 98 90 90 90 90 90 90 90 90 90 90 90 90 90 54 90 90 90 90 90 62 90 90 91 90 90 90 90 90 90 91 90 90 90 90 90 90 90 3 90 90 90 90 90 90 90 2 90 90 90 90 90 90 90 90 90 2 90 90 90 90 90",
"output": "60"
},
{
"input": "100 10\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 78 90 61 40 87 39 91 50 64 30 10 24 10 55 28 11 28 35 26 26 10 57 45 67 14 99 96 51 67 79 59 11 21 55 70 33 10 16 92 70 38 50 66 52 5 10 10 10 2 4 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 10 10 10 10 8 10 10 10 10 10",
"output": "56"
},
{
"input": "100 90\n90 90 90 90 90 90 55 21 90 90 90 90 90 90 90 90 90 90 69 83 90 90 90 90 90 90 90 90 93 95 92 98 92 97 91 92 92 91 91 95 94 95 100 100 96 97 94 93 90 90 95 95 97 99 90 95 98 91 94 96 99 99 94 95 95 97 99 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 12 90 3 90 90 90 90 90 90 90",
"output": "61"
},
{
"input": "100 49\n71 25 14 36 36 48 36 49 28 40 49 49 49 38 40 49 33 22 49 49 14 46 8 44 49 11 37 49 40 49 2 49 3 49 37 49 49 11 25 49 49 32 49 11 49 30 16 21 49 49 23 24 30 49 49 49 49 49 49 27 49 42 49 49 20 32 30 29 35 49 30 49 9 49 27 25 5 49 49 42 49 20 49 35 49 22 15 49 49 49 19 49 29 28 13 49 22 7 6 24",
"output": "99"
},
{
"input": "100 50\n38 68 9 6 50 18 19 50 50 20 33 34 43 50 24 50 50 2 50 50 50 50 50 21 30 50 41 40 50 50 50 50 50 7 50 21 19 23 1 50 24 50 50 50 25 50 50 50 50 50 50 50 7 24 28 18 50 5 43 50 20 50 13 50 50 16 50 3 2 24 50 50 18 5 50 4 50 50 38 50 33 49 12 33 11 14 50 50 50 33 50 50 50 50 50 50 7 4 50 50",
"output": "99"
},
{
"input": "100 48\n8 6 23 47 29 48 48 48 48 48 48 26 24 48 48 48 3 48 27 28 41 45 9 29 48 48 48 48 48 48 48 48 48 48 47 23 48 48 48 5 48 22 40 48 48 48 20 48 48 57 48 32 19 48 33 2 4 19 48 48 39 48 16 48 48 44 48 48 48 48 29 14 25 43 46 7 48 19 30 48 18 8 39 48 30 47 35 18 48 45 48 48 30 13 48 48 48 17 9 48",
"output": "99"
},
{
"input": "100 57\n57 9 57 4 43 57 57 57 57 26 57 18 57 57 57 57 57 57 57 47 33 57 57 43 57 57 55 57 14 57 57 4 1 57 57 57 57 57 46 26 57 57 57 57 57 57 57 39 57 57 57 5 57 12 11 57 57 57 25 37 34 57 54 18 29 57 39 57 5 57 56 34 57 24 7 57 57 57 2 57 57 57 57 1 55 39 19 57 57 57 57 21 3 40 13 3 57 57 62 57",
"output": "99"
},
{
"input": "100 51\n51 51 38 51 51 45 51 51 51 18 51 36 51 19 51 26 37 51 11 51 45 34 51 21 51 51 33 51 6 51 51 51 21 47 51 13 51 51 30 29 50 51 51 51 51 51 51 45 14 51 2 51 51 23 9 51 50 23 51 29 34 51 40 32 1 36 31 51 11 51 51 47 51 51 51 51 51 51 51 50 39 51 14 4 4 12 3 11 51 51 51 51 41 51 51 51 49 37 5 93",
"output": "99"
},
{
"input": "100 50\n87 91 95 73 50 50 16 97 39 24 58 50 33 89 42 37 50 50 12 71 3 55 50 50 80 10 76 50 52 36 88 44 66 69 86 71 77 50 72 50 21 55 50 50 78 61 75 89 65 2 50 69 62 47 11 92 97 77 41 31 55 29 35 51 36 48 50 91 92 86 50 36 50 94 51 74 4 27 55 63 50 36 87 50 67 7 65 75 20 96 88 50 41 73 35 51 66 21 29 33",
"output": "3"
},
{
"input": "100 50\n50 37 28 92 7 76 50 50 50 76 100 57 50 50 50 32 76 50 8 72 14 8 50 91 67 50 55 82 50 50 24 97 88 50 59 61 68 86 44 15 61 67 88 50 40 50 36 99 1 23 63 50 88 59 76 82 99 76 68 50 50 30 31 68 57 98 71 12 15 60 35 79 90 6 67 50 50 50 50 68 13 6 50 50 16 87 84 50 67 67 50 64 50 58 50 50 77 51 50 51",
"output": "3"
},
{
"input": "100 50\n43 50 50 91 97 67 6 50 86 50 76 60 50 59 4 56 11 38 49 50 37 50 50 20 60 47 33 54 95 58 22 50 77 77 72 9 57 40 81 57 95 50 81 63 62 76 13 87 50 39 74 69 50 99 63 1 11 62 84 31 97 99 56 73 70 36 45 100 28 91 93 9 19 52 73 50 83 58 84 52 86 12 50 44 64 52 97 50 12 71 97 52 87 66 83 66 86 50 9 49",
"output": "6"
},
{
"input": "88 10\n10 8 1 10 10 1 3 7 10 5 8 8 10 2 7 10 10 10 10 10 1 10 10 10 10 1 2 9 10 9 10 10 10 64 100 25 10 12 9 52 13 8 10 56 10 4 10 7 10 3 10 79 74 8 73 10 10 10 9 10 3 5 10 10 10 5 1 10 10 4 3 10 10 10 4 10 6 4 10 10 10 10 3 3 8 5 6 8",
"output": "66"
},
{
"input": "100 50\n80 39 33 69 75 50 23 88 50 50 67 90 87 50 29 15 55 32 60 50 50 50 38 95 62 50 50 88 8 97 45 50 42 12 22 93 49 50 24 50 50 71 60 4 50 72 57 57 50 50 50 83 69 17 1 31 72 55 50 11 50 80 93 41 91 94 20 60 50 50 51 48 53 56 76 73 50 72 19 98 50 50 50 50 50 28 48 45 62 11 16 67 93 88 63 50 50 66 48 95",
"output": "0"
},
{
"input": "100 50\n70 50 38 50 38 50 32 30 50 31 26 42 50 33 34 50 50 50 28 21 50 44 50 47 50 50 9 40 50 50 50 50 50 42 50 50 16 50 50 3 24 50 50 50 4 26 50 2 50 50 33 1 27 50 50 50 8 29 50 23 33 50 6 29 50 50 15 50 50 50 32 50 43 50 50 50 31 50 4 50 50 31 50 50 31 16 50 17 50 17 31 13 25 16 50 10 50 47 50 66",
"output": "0"
},
{
"input": "2 8\n8 8",
"output": "2"
},
{
"input": "1 6\n3",
"output": "1"
},
{
"input": "1 5\n5",
"output": "1"
}
] | 1,623,426,335
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 62
| 0
|
n,p=map(int,input().split())
l=list(map(int,input().split()))
x=0
ans=0
while x<len(l):
if p>=l[x]:
l.pop(x)
ans+=1
else:
break
y=len(l)-1
while y>0:
if p>=l[y]:
ans+=1
l.pop(y)
y-=1
else:
break
print(ans)
|
Title: Mishka and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
Output Specification:
Print one integer — the maximum number of problems Mishka can solve.
Demo Input:
['8 4\n4 2 3 1 5 1 6 4\n', '5 2\n3 1 2 1 3\n', '5 100\n12 34 55 43 21\n']
Demo Output:
['5\n', '0\n', '5\n']
Note:
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
|
```python
n,p=map(int,input().split())
l=list(map(int,input().split()))
x=0
ans=0
while x<len(l):
if p>=l[x]:
l.pop(x)
ans+=1
else:
break
y=len(l)-1
while y>0:
if p>=l[y]:
ans+=1
l.pop(y)
y-=1
else:
break
print(ans)
```
| 3
|
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,689,116,888
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 92
| 0
|
n = int(input())
l = list(map(int, input().split()))
worst, best, am= l[0], l[0], 0
for c in l:
if c > best:
best = c; am += 1
elif c < worst:
worst = c; am += 1
print(am)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
n = int(input())
l = list(map(int, input().split()))
worst, best, am= l[0], l[0], 0
for c in l:
if c > best:
best = c; am += 1
elif c < worst:
worst = c; am += 1
print(am)
```
| 3
|
|
932
|
A
|
Palindromic Supersequence
|
PROGRAMMING
| 800
|
[
"constructive algorithms"
] | null | null |
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
|
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
|
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
|
[
"aba\n",
"ab\n"
] |
[
"aba",
"aabaa"
] |
In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
| 500
|
[
{
"input": "aba",
"output": "abaaba"
},
{
"input": "ab",
"output": "abba"
},
{
"input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa",
"output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..."
},
{
"input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco",
"output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..."
},
{
"input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar",
"output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..."
},
{
"input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg",
"output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..."
},
{
"input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm",
"output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..."
},
{
"input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj",
"output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..."
},
{
"input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd",
"output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..."
},
{
"input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig",
"output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..."
},
{
"input": "abcab",
"output": "abcabbacba"
},
{
"input": "baaaaaaa",
"output": "baaaaaaaaaaaaaab"
},
{
"input": "baaaaaa",
"output": "baaaaaaaaaaaab"
},
{
"input": "baaaaaaaaa",
"output": "baaaaaaaaaaaaaaaaaab"
},
{
"input": "baaaaaaaa",
"output": "baaaaaaaaaaaaaaaab"
}
] | 1,518,706,265
| 965
|
Python 3
|
OK
|
TESTS
| 48
| 62
| 5,632,000
|
def pal(s):
if(s==s[::-1]):
return 1;
else:
return 0
k=input()
if(pal(k)==1):
print(k)
else:
print(k+k[::-1])
|
Title: Palindromic Supersequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
Input Specification:
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output Specification:
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
Demo Input:
['aba\n', 'ab\n']
Demo Output:
['aba', 'aabaa']
Note:
In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
|
```python
def pal(s):
if(s==s[::-1]):
return 1;
else:
return 0
k=input()
if(pal(k)==1):
print(k)
else:
print(k+k[::-1])
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,619,506,870
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 154
| 0
|
word = input()
c=0
y=False
cl=''
for i in range(0, len(word)):
cl = word[i]
y = cl.isupper()
if y == True:
c = c+1
if c > (len(word)/2):
print(word.upper())
else:
print(word.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word = input()
c=0
y=False
cl=''
for i in range(0, len(word)):
cl = word[i]
y = cl.isupper()
if y == True:
c = c+1
if c > (len(word)/2):
print(word.upper())
else:
print(word.lower())
```
| 3.9615
|
26
|
B
|
Regular Bracket Sequence
|
PROGRAMMING
| 1,400
|
[
"greedy"
] |
B. Regular Bracket Sequence
|
5
|
256
|
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
|
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
|
Output the maximum possible length of a regular bracket sequence.
|
[
"(()))(\n",
"((()())\n"
] |
[
"4\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "(()))(",
"output": "4"
},
{
"input": "((()())",
"output": "6"
},
{
"input": "(",
"output": "0"
},
{
"input": ")",
"output": "0"
},
{
"input": ")(()(",
"output": "2"
},
{
"input": "))))))(",
"output": "0"
},
{
"input": "()()(()(((",
"output": "6"
},
{
"input": "()))(()((((()(())",
"output": "10"
},
{
"input": "())))((()())())))))())",
"output": "14"
},
{
"input": ")))((((())(()((()((((()()())((",
"output": "16"
},
{
"input": "))()()((()()))())()(((((((())((((((((())()()((())(",
"output": "32"
},
{
"input": "))())))))))())))))()()))()()))))())))))()))))))))))))(()))())(()))))(()))))())))((((()()))))()))()))",
"output": "48"
}
] | 1,513,929,150
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 998
| 16,588,800
|
m=input()
cont=0
cont2=0
B=[]
C=[]
for i in m :
if i == "(" :
B.append(i)
if i == ")" :
if len(B)!=0:
if B.pop() == "(" :
cont+=1
else:cont2+=1
print(cont*2)
|
Title: Regular Bracket Sequence
Time Limit: 5 seconds
Memory Limit: 256 megabytes
Problem Description:
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
Input Specification:
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Output the maximum possible length of a regular bracket sequence.
Demo Input:
['(()))(\n', '((()())\n']
Demo Output:
['4\n', '6\n']
Note:
none
|
```python
m=input()
cont=0
cont2=0
B=[]
C=[]
for i in m :
if i == "(" :
B.append(i)
if i == ")" :
if len(B)!=0:
if B.pop() == "(" :
cont+=1
else:cont2+=1
print(cont*2)
```
| 3.869301
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Gerald got a very curious hexagon for his birthday. The boy found out that all the angles of the hexagon are equal to . Then he measured the length of its sides, and found that each of them is equal to an integer number of centimeters. There the properties of the hexagon ended and Gerald decided to draw on it.
He painted a few lines, parallel to the sides of the hexagon. The lines split the hexagon into regular triangles with sides of 1 centimeter. Now Gerald wonders how many triangles he has got. But there were so many of them that Gerald lost the track of his counting. Help the boy count the triangles.
|
The first and the single line of the input contains 6 space-separated integers *a*1,<=*a*2,<=*a*3,<=*a*4,<=*a*5 and *a*6 (1<=≤<=*a**i*<=≤<=1000) — the lengths of the sides of the hexagons in centimeters in the clockwise order. It is guaranteed that the hexagon with the indicated properties and the exactly such sides exists.
|
Print a single integer — the number of triangles with the sides of one 1 centimeter, into which the hexagon is split.
|
[
"1 1 1 1 1 1\n",
"1 2 1 2 1 2\n"
] |
[
"6\n",
"13\n"
] |
This is what Gerald's hexagon looks like in the first sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/84d193e27b02c38eb1eadc536602a2ec0b9f9519.png" style="max-width: 100.0%;max-height: 100.0%;"/>
And that's what it looks like in the second sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/e29076a96da8ca864654cc6195654d9bf07d31ce.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 0
|
[
{
"input": "1 1 1 1 1 1",
"output": "6"
},
{
"input": "1 2 1 2 1 2",
"output": "13"
},
{
"input": "2 4 5 3 3 6",
"output": "83"
},
{
"input": "45 19 48 18 46 21",
"output": "6099"
},
{
"input": "66 6 65 6 66 5",
"output": "5832"
},
{
"input": "7 5 4 8 4 5",
"output": "175"
},
{
"input": "3 2 1 4 1 2",
"output": "25"
},
{
"input": "7 1 7 3 5 3",
"output": "102"
},
{
"input": "9 2 9 3 8 3",
"output": "174"
},
{
"input": "1 6 1 5 2 5",
"output": "58"
},
{
"input": "41 64 48 61 44 68",
"output": "17488"
},
{
"input": "1 59 2 59 1 60",
"output": "3838"
},
{
"input": "30 36 36 32 34 38",
"output": "7052"
},
{
"input": "50 40 46 38 52 34",
"output": "11176"
},
{
"input": "4 60 4 60 4 60",
"output": "4576"
},
{
"input": "718 466 729 470 714 481",
"output": "2102808"
},
{
"input": "131 425 143 461 95 473",
"output": "441966"
},
{
"input": "125 7 128 8 124 11",
"output": "20215"
},
{
"input": "677 303 685 288 692 296",
"output": "1365807"
},
{
"input": "1 577 7 576 2 582",
"output": "342171"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "6000000"
},
{
"input": "1 1 1000 1 1 1000",
"output": "4002"
},
{
"input": "1000 1000 1 1000 1000 1",
"output": "2004000"
},
{
"input": "1000 1 1000 999 2 999",
"output": "2003997"
},
{
"input": "1 1000 1 1 1000 1",
"output": "4002"
},
{
"input": "888 888 888 887 889 887",
"output": "4729487"
}
] | 1,437,582,481
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 62
| 0
|
import sys
(a1, a2, a3, a4, a5, a6) = map(int, input().split())
def calc(h):
res = 0
cur = 1
while cur <= h:
res += cur + cur - 1
cur += 1
return res
ax1 = a4
ax2 = a6
ans = calc(ax1 + ax2 + a5) - calc(ax1) - calc(ax2) - calc(a2)
print(ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald got a very curious hexagon for his birthday. The boy found out that all the angles of the hexagon are equal to . Then he measured the length of its sides, and found that each of them is equal to an integer number of centimeters. There the properties of the hexagon ended and Gerald decided to draw on it.
He painted a few lines, parallel to the sides of the hexagon. The lines split the hexagon into regular triangles with sides of 1 centimeter. Now Gerald wonders how many triangles he has got. But there were so many of them that Gerald lost the track of his counting. Help the boy count the triangles.
Input Specification:
The first and the single line of the input contains 6 space-separated integers *a*1,<=*a*2,<=*a*3,<=*a*4,<=*a*5 and *a*6 (1<=≤<=*a**i*<=≤<=1000) — the lengths of the sides of the hexagons in centimeters in the clockwise order. It is guaranteed that the hexagon with the indicated properties and the exactly such sides exists.
Output Specification:
Print a single integer — the number of triangles with the sides of one 1 centimeter, into which the hexagon is split.
Demo Input:
['1 1 1 1 1 1\n', '1 2 1 2 1 2\n']
Demo Output:
['6\n', '13\n']
Note:
This is what Gerald's hexagon looks like in the first sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/84d193e27b02c38eb1eadc536602a2ec0b9f9519.png" style="max-width: 100.0%;max-height: 100.0%;"/>
And that's what it looks like in the second sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/e29076a96da8ca864654cc6195654d9bf07d31ce.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
import sys
(a1, a2, a3, a4, a5, a6) = map(int, input().split())
def calc(h):
res = 0
cur = 1
while cur <= h:
res += cur + cur - 1
cur += 1
return res
ax1 = a4
ax2 = a6
ans = calc(ax1 + ax2 + a5) - calc(ax1) - calc(ax2) - calc(a2)
print(ans)
```
| 3
|
|
843
|
B
|
Interactive LowerBound
|
PROGRAMMING
| 2,000
|
[
"brute force",
"interactive",
"probabilities"
] | null | null |
This is an interactive problem.
You are given a sorted in increasing order singly linked list. You should find the minimum integer in the list which is greater than or equal to *x*.
More formally, there is a singly liked list built on an array of *n* elements. Element with index *i* contains two integers: *value**i* is the integer value in this element, and *next**i* that is the index of the next element of the singly linked list (or -1, if the current element is the last). The list is sorted, i.e. if *next**i*<=≠<=<=-<=1, then *value**next**i*<=><=*value**i*.
You are given the number of elements in the list *n*, the index of the first element *start*, and the integer *x*.
You can make up to 2000 queries of the following two types:
- ? i (1<=≤<=*i*<=≤<=*n*) — ask the values *value**i* and *next**i*, - ! ans — give the answer for the problem: the minimum integer, greater than or equal to *x*, or ! -1, if there are no such integers. Your program should terminate after this query.
Write a program that solves this problem.
|
The first line contains three integers *n*, *start*, *x* (1<=≤<=*n*<=≤<=50000, 1<=≤<=*start*<=≤<=*n*, 0<=≤<=*x*<=≤<=109) — the number of elements in the list, the index of the first element and the integer *x*.
|
To print the answer for the problem, print ! ans, where ans is the minimum integer in the list greater than or equal to *x*, or -1, if there is no such integer.
|
[
"5 3 80\n97 -1\n58 5\n16 2\n81 1\n79 4\n"
] |
[
"? 1\n? 2\n? 3\n? 4\n? 5\n! 81"
] |
You can read more about singly linked list by the following link: [https://en.wikipedia.org/wiki/Linked_list#Singly_linked_list](https://en.wikipedia.org/wiki/Linked_list#Singly_linked_list)
The illustration for the first sample case. Start and finish elements are marked dark. <img class="tex-graphics" src="https://espresso.codeforces.com/5202ec3b5e896b7db692ff7b80457c26cf6adb32.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "5 3 80\n97 -1\n58 5\n16 2\n81 1\n79 4",
"output": "81\n1003"
},
{
"input": "5 1 6\n1 2\n2 3\n3 4\n4 5\n5 -1",
"output": "-1\n1002"
},
{
"input": "1 1 0\n0 -1",
"output": "0\n2"
},
{
"input": "1 1 2\n0 -1",
"output": "-1\n1002"
},
{
"input": "1 1 1000000000\n0 -1",
"output": "-1\n1002"
},
{
"input": "5 3 3\n3 5\n2 1\n0 4\n1 2\n4 -1",
"output": "3\n1003"
},
{
"input": "5 3 145337745\n619347297 5\n344132479 1\n122841322 4\n169280018 2\n740666615 -1",
"output": "169280018\n1003"
},
{
"input": "5 3 315433300\n411188472 5\n316581280 1\n200698791 4\n314885421 2\n759386148 -1",
"output": "316581280\n1003"
},
{
"input": "5 3 381735506\n469559901 5\n359493082 1\n137017061 4\n202768106 2\n955698260 -1",
"output": "469559901\n1003"
},
{
"input": "5 3 587634055\n563214082 5\n404100743 1\n179733654 4\n236438578 2\n673892808 -1",
"output": "673892808\n1003"
},
{
"input": "5 3 974128233\n547205043 5\n318213550 1\n122625404 4\n184874700 2\n669820978 -1",
"output": "-1\n1002"
},
{
"input": "10 3 2\n3 9\n9 -1\n0 7\n6 8\n5 4\n8 2\n1 10\n7 6\n4 5\n2 1",
"output": "2\n1003"
},
{
"input": "10 3 632584719\n378382911 9\n978367651 -1\n176599346 7\n557138623 8\n441019502 4\n823417558 2\n244832688 10\n702148024 6\n385598339 5\n357778234 1",
"output": "702148024\n1003"
},
{
"input": "1 1 50\n60 -1",
"output": "60\n2"
},
{
"input": "5 1 100\n200 2\n300 3\n400 4\n500 5\n600 -1",
"output": "200\n2"
}
] | 1,509,454,736
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 171
| 139
| 716,800
|
from random import sample
from sys import stdout
read=lambda :map(int,input().split())
def ask(x):
print('? {}'.format(x))
stdout.flush()
return tuple(read())
def answer(x):
print('! {}'.format(x))
stdout.flush()
exit(0)
n,st,x=read()
a=[ask(st)]
if a[0][0]>=x: answer(a[0][0])
for i in sample(range(1,n+1),min(n,999)):
b=ask(i)
if b[0]<x: a.append(b)
elif b[0]==x: answer(x)
b=max(a)
while True:
if b[0]>=x: answer(b[0])
if b[1]==-1: break
else: b=ask(b[1])
answer(-1)
|
Title: Interactive LowerBound
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This is an interactive problem.
You are given a sorted in increasing order singly linked list. You should find the minimum integer in the list which is greater than or equal to *x*.
More formally, there is a singly liked list built on an array of *n* elements. Element with index *i* contains two integers: *value**i* is the integer value in this element, and *next**i* that is the index of the next element of the singly linked list (or -1, if the current element is the last). The list is sorted, i.e. if *next**i*<=≠<=<=-<=1, then *value**next**i*<=><=*value**i*.
You are given the number of elements in the list *n*, the index of the first element *start*, and the integer *x*.
You can make up to 2000 queries of the following two types:
- ? i (1<=≤<=*i*<=≤<=*n*) — ask the values *value**i* and *next**i*, - ! ans — give the answer for the problem: the minimum integer, greater than or equal to *x*, or ! -1, if there are no such integers. Your program should terminate after this query.
Write a program that solves this problem.
Input Specification:
The first line contains three integers *n*, *start*, *x* (1<=≤<=*n*<=≤<=50000, 1<=≤<=*start*<=≤<=*n*, 0<=≤<=*x*<=≤<=109) — the number of elements in the list, the index of the first element and the integer *x*.
Output Specification:
To print the answer for the problem, print ! ans, where ans is the minimum integer in the list greater than or equal to *x*, or -1, if there is no such integer.
Demo Input:
['5 3 80\n97 -1\n58 5\n16 2\n81 1\n79 4\n']
Demo Output:
['? 1\n? 2\n? 3\n? 4\n? 5\n! 81']
Note:
You can read more about singly linked list by the following link: [https://en.wikipedia.org/wiki/Linked_list#Singly_linked_list](https://en.wikipedia.org/wiki/Linked_list#Singly_linked_list)
The illustration for the first sample case. Start and finish elements are marked dark. <img class="tex-graphics" src="https://espresso.codeforces.com/5202ec3b5e896b7db692ff7b80457c26cf6adb32.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
from random import sample
from sys import stdout
read=lambda :map(int,input().split())
def ask(x):
print('? {}'.format(x))
stdout.flush()
return tuple(read())
def answer(x):
print('! {}'.format(x))
stdout.flush()
exit(0)
n,st,x=read()
a=[ask(st)]
if a[0][0]>=x: answer(a[0][0])
for i in sample(range(1,n+1),min(n,999)):
b=ask(i)
if b[0]<x: a.append(b)
elif b[0]==x: answer(x)
b=max(a)
while True:
if b[0]>=x: answer(b[0])
if b[1]==-1: break
else: b=ask(b[1])
answer(-1)
```
| 3
|
|
791
|
A
|
Bear and Big Brother
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
|
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
|
[
"4 7\n",
"4 9\n",
"1 1\n"
] |
[
"2\n",
"3\n",
"1\n"
] |
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
| 500
|
[
{
"input": "4 7",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "4"
},
{
"input": "1 6",
"output": "5"
},
{
"input": "1 7",
"output": "5"
},
{
"input": "1 8",
"output": "6"
},
{
"input": "1 9",
"output": "6"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "2 4",
"output": "2"
},
{
"input": "2 5",
"output": "3"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "4"
},
{
"input": "2 8",
"output": "4"
},
{
"input": "2 9",
"output": "4"
},
{
"input": "2 10",
"output": "4"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "3 4",
"output": "1"
},
{
"input": "3 5",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "3"
},
{
"input": "3 8",
"output": "3"
},
{
"input": "3 9",
"output": "3"
},
{
"input": "3 10",
"output": "3"
},
{
"input": "4 4",
"output": "1"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "4 10",
"output": "3"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "1"
},
{
"input": "5 7",
"output": "1"
},
{
"input": "5 8",
"output": "2"
},
{
"input": "5 9",
"output": "2"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "6 9",
"output": "2"
},
{
"input": "6 10",
"output": "2"
},
{
"input": "7 7",
"output": "1"
},
{
"input": "7 8",
"output": "1"
},
{
"input": "7 9",
"output": "1"
},
{
"input": "7 10",
"output": "1"
},
{
"input": "8 8",
"output": "1"
},
{
"input": "8 9",
"output": "1"
},
{
"input": "8 10",
"output": "1"
},
{
"input": "9 9",
"output": "1"
},
{
"input": "9 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "1 2",
"output": "2"
}
] | 1,698,145,849
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 46
| 0
|
l, b = map(int, input().split())
years = 1
while l <= b:
l = 3 * l
b = 2 * b
years += 1
print(years - 1)
|
Title: Bear and Big Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Output Specification:
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
Demo Input:
['4 7\n', '4 9\n', '1 1\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
|
```python
l, b = map(int, input().split())
years = 1
while l <= b:
l = 3 * l
b = 2 * b
years += 1
print(years - 1)
```
| 3
|
|
791
|
A
|
Bear and Big Brother
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
|
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
|
[
"4 7\n",
"4 9\n",
"1 1\n"
] |
[
"2\n",
"3\n",
"1\n"
] |
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
| 500
|
[
{
"input": "4 7",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "4"
},
{
"input": "1 6",
"output": "5"
},
{
"input": "1 7",
"output": "5"
},
{
"input": "1 8",
"output": "6"
},
{
"input": "1 9",
"output": "6"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "2 4",
"output": "2"
},
{
"input": "2 5",
"output": "3"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "4"
},
{
"input": "2 8",
"output": "4"
},
{
"input": "2 9",
"output": "4"
},
{
"input": "2 10",
"output": "4"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "3 4",
"output": "1"
},
{
"input": "3 5",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "3"
},
{
"input": "3 8",
"output": "3"
},
{
"input": "3 9",
"output": "3"
},
{
"input": "3 10",
"output": "3"
},
{
"input": "4 4",
"output": "1"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "4 10",
"output": "3"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "1"
},
{
"input": "5 7",
"output": "1"
},
{
"input": "5 8",
"output": "2"
},
{
"input": "5 9",
"output": "2"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "6 9",
"output": "2"
},
{
"input": "6 10",
"output": "2"
},
{
"input": "7 7",
"output": "1"
},
{
"input": "7 8",
"output": "1"
},
{
"input": "7 9",
"output": "1"
},
{
"input": "7 10",
"output": "1"
},
{
"input": "8 8",
"output": "1"
},
{
"input": "8 9",
"output": "1"
},
{
"input": "8 10",
"output": "1"
},
{
"input": "9 9",
"output": "1"
},
{
"input": "9 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "1 2",
"output": "2"
}
] | 1,694,017,696
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 62
| 62
| 0
|
d,e=map(int,input().split())
cnt=0
while d<=e:
d=d*3
e=e*2
cnt+=1
print(cnt)
|
Title: Bear and Big Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Output Specification:
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
Demo Input:
['4 7\n', '4 9\n', '1 1\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
|
```python
d,e=map(int,input().split())
cnt=0
while d<=e:
d=d*3
e=e*2
cnt+=1
print(cnt)
```
| 3
|
|
268
|
A
|
Games
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
|
In a single line print the number of games where the host team is going to play in the guest uniform.
|
[
"3\n1 2\n2 4\n3 4\n",
"4\n100 42\n42 100\n5 42\n100 5\n",
"2\n1 2\n1 2\n"
] |
[
"1\n",
"5\n",
"0\n"
] |
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
| 500
|
[
{
"input": "3\n1 2\n2 4\n3 4",
"output": "1"
},
{
"input": "4\n100 42\n42 100\n5 42\n100 5",
"output": "5"
},
{
"input": "2\n1 2\n1 2",
"output": "0"
},
{
"input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52",
"output": "6"
},
{
"input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28",
"output": "1"
},
{
"input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77",
"output": "6"
},
{
"input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35",
"output": "4"
},
{
"input": "2\n46 6\n6 46",
"output": "2"
},
{
"input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11",
"output": "10"
},
{
"input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33",
"output": "6"
},
{
"input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73",
"output": "0"
},
{
"input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2",
"output": "1"
},
{
"input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100",
"output": "8"
},
{
"input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "450"
},
{
"input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3",
"output": "0"
},
{
"input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5",
"output": "20"
},
{
"input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2",
"output": "108"
},
{
"input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2",
"output": "312"
},
{
"input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6",
"output": "96"
},
{
"input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97",
"output": "210"
},
{
"input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78",
"output": "73"
},
{
"input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80",
"output": "277"
},
{
"input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21",
"output": "154"
},
{
"input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17",
"output": "418"
},
{
"input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80",
"output": "74"
},
{
"input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9",
"output": "59"
},
{
"input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67",
"output": "100"
},
{
"input": "4\n8 7\n8 7\n7 8\n7 8",
"output": "8"
},
{
"input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1",
"output": "10"
},
{
"input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "72"
},
{
"input": "4\n1 2\n1 2\n2 1\n2 1",
"output": "8"
}
] | 1,677,487,628
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n = int(input())
home = []
guest = {}
for i in range(n):
h,a = input().split()
h = int(h)
a = int(a)
home.append(h)
if guest.get(a) == None:
guest[a] = 1
else:
guest[a] += 1
count = 0
for i in home:
if guest.get(i) != None:
count += guest[i]
print(count)
|
Title: Games
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
Output Specification:
In a single line print the number of games where the host team is going to play in the guest uniform.
Demo Input:
['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n']
Demo Output:
['1\n', '5\n', '0\n']
Note:
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
|
```python
n = int(input())
home = []
guest = {}
for i in range(n):
h,a = input().split()
h = int(h)
a = int(a)
home.append(h)
if guest.get(a) == None:
guest[a] = 1
else:
guest[a] += 1
count = 0
for i in home:
if guest.get(i) != None:
count += guest[i]
print(count)
```
| 3
|
|
322
|
A
|
Ciel and Dancing
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
|
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
|
[
"2 1\n",
"2 2\n"
] |
[
"2\n1 1\n2 1\n",
"3\n1 1\n1 2\n2 2\n"
] |
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3.
| 500
|
[
{
"input": "2 1",
"output": "2\n1 1\n2 1"
},
{
"input": "2 2",
"output": "3\n1 1\n1 2\n2 2"
},
{
"input": "1 1",
"output": "1\n1 1"
},
{
"input": "2 3",
"output": "4\n1 1\n1 2\n1 3\n2 3"
},
{
"input": "4 4",
"output": "7\n1 1\n1 2\n1 3\n1 4\n4 4\n3 4\n2 4"
},
{
"input": "1 12",
"output": "12\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12"
},
{
"input": "12 1",
"output": "12\n1 1\n12 1\n11 1\n10 1\n9 1\n8 1\n7 1\n6 1\n5 1\n4 1\n3 1\n2 1"
},
{
"input": "100 100",
"output": "199\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "24 6",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n24 6\n23 6\n22 6\n21 6\n20 6\n19 6\n18 6\n17 6\n16 6\n15 6\n14 6\n13 6\n12 6\n11 6\n10 6\n9 6\n8 6\n7 6\n6 6\n5 6\n4 6\n3 6\n2 6"
},
{
"input": "7 59",
"output": "65\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n7 59\n6 59\n5 59\n4 59\n3 59\n2 59"
},
{
"input": "26 75",
"output": "100\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n26 75\n25 75\n24 75\n23 75\n22 75\n21 75\n20 75\n19 75\n18 75\n17..."
},
{
"input": "32 87",
"output": "118\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 51",
"output": "92\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n42 51\n41 51\n40 51\n39 51\n38 51\n37 51\n36 51\n35 51\n34 51\n33 51\n32 51\n31 51\n30 51\n29 51\n28 51\n27 51\n26 51\n25 51\n24 51\n23 51\n22 51\n21 51\n20 51\n19 51\n18 51\n17 51\n16 51\n15 51\n14 51\n13 51\n..."
},
{
"input": "4 63",
"output": "66\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n4 63\n3 63\n2 63"
},
{
"input": "10 79",
"output": "88\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n10 79\n9 79\n8 79\n7 79\n6 79\n5 79\n4 79\n..."
},
{
"input": "20 95",
"output": "114\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "35 55",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n35 55\n34 55\n33 55\n32 55\n31 55\n30 55\n29 55\n28 55\n27 55\n26 55\n25 55\n24 55\n23 55\n22 55\n21 55\n20 55\n19 55\n18 55\n17 55\n16 55\n15 55\n14 55\n13 55\n12 55\n11 55\n10 55\n9 55..."
},
{
"input": "45 71",
"output": "115\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n45 71\n44 71\n43 71\n42 71\n41 71\n40 71\n39 71\n38 71\n37 71\n36 71\n35 71\n34 71\n33 71..."
},
{
"input": "7 83",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n7 83\n6 83\n5 83\n..."
},
{
"input": "32 100",
"output": "131\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 17",
"output": "58\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n42 17\n41 17\n40 17\n39 17\n38 17\n37 17\n36 17\n35 17\n34 17\n33 17\n32 17\n31 17\n30 17\n29 17\n28 17\n27 17\n26 17\n25 17\n24 17\n23 17\n22 17\n21 17\n20 17\n19 17\n18 17\n17 17\n16 17\n15 17\n14 17\n13 17\n12 17\n11 17\n10 17\n9 17\n8 17\n7 17\n6 17\n5 17\n4 17\n3 17\n2 17"
},
{
"input": "1 77",
"output": "77\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77"
},
{
"input": "19 93",
"output": "111\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "25 5",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n25 5\n24 5\n23 5\n22 5\n21 5\n20 5\n19 5\n18 5\n17 5\n16 5\n15 5\n14 5\n13 5\n12 5\n11 5\n10 5\n9 5\n8 5\n7 5\n6 5\n5 5\n4 5\n3 5\n2 5"
},
{
"input": "35 21",
"output": "55\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n35 21\n34 21\n33 21\n32 21\n31 21\n30 21\n29 21\n28 21\n27 21\n26 21\n25 21\n24 21\n23 21\n22 21\n21 21\n20 21\n19 21\n18 21\n17 21\n16 21\n15 21\n14 21\n13 21\n12 21\n11 21\n10 21\n9 21\n8 21\n7 21\n6 21\n5 21\n4 21\n3 21\n2 21"
},
{
"input": "99 99",
"output": "197\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "99 100",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "100 99",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
}
] | 1,569,616,023
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 248
| 0
|
n,m=map(int,input().split())
print(m+n-1)
for i in range(1,m+1):
print(1,i)
for i in range(2,n+1):
print(i,1)
|
Title: Ciel and Dancing
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
Output Specification:
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
Demo Input:
['2 1\n', '2 2\n']
Demo Output:
['2\n1 1\n2 1\n', '3\n1 1\n1 2\n2 2\n']
Note:
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3.
|
```python
n,m=map(int,input().split())
print(m+n-1)
for i in range(1,m+1):
print(1,i)
for i in range(2,n+1):
print(i,1)
```
| 3
|
|
602
|
B
|
Approximating a Constant Range
|
PROGRAMMING
| 1,400
|
[
"dp",
"implementation",
"two pointers"
] | null | null |
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
|
Print a single number — the maximum length of an almost constant range of the given sequence.
|
[
"5\n1 2 3 3 2\n",
"11\n5 4 5 5 6 7 8 8 8 7 6\n"
] |
[
"4\n",
"5\n"
] |
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
| 1,000
|
[
{
"input": "5\n1 2 3 3 2",
"output": "4"
},
{
"input": "11\n5 4 5 5 6 7 8 8 8 7 6",
"output": "5"
},
{
"input": "2\n3 2",
"output": "2"
},
{
"input": "4\n1001 1000 1000 1001",
"output": "4"
},
{
"input": "4\n1 1 2 3",
"output": "3"
},
{
"input": "3\n1 2 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "18\n10 9 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "3"
},
{
"input": "4\n10 9 10 9",
"output": "4"
},
{
"input": "4\n4 3 2 3",
"output": "3"
},
{
"input": "4\n8 8 7 7",
"output": "4"
},
{
"input": "3\n99998 99999 100000",
"output": "2"
},
{
"input": "3\n100000 99999 99998",
"output": "2"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "2\n99999 100000",
"output": "2"
},
{
"input": "2\n100000 100000",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "15\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "15"
}
] | 1,679,262,119
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 107
| 264
| 7,065,600
|
n = int(input())
a = [int(x) for x in input().split()]
d = {}
for x in a:
d[x] = 0
ans = 0
j = 0
m = 0
for i in range(n):
while j < n and m <= 2:
if d[a[j]] == 0 and m == 2:
break
elif d[a[j]] == 0:
m += 1
d[a[j]] += 1
j += 1
ans = max(ans, j - i)
d[a[i]] -= 1
if d[a[i]] == 0:
m -= 1
print(ans)
|
Title: Approximating a Constant Range
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
Output Specification:
Print a single number — the maximum length of an almost constant range of the given sequence.
Demo Input:
['5\n1 2 3 3 2\n', '11\n5 4 5 5 6 7 8 8 8 7 6\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
|
```python
n = int(input())
a = [int(x) for x in input().split()]
d = {}
for x in a:
d[x] = 0
ans = 0
j = 0
m = 0
for i in range(n):
while j < n and m <= 2:
if d[a[j]] == 0 and m == 2:
break
elif d[a[j]] == 0:
m += 1
d[a[j]] += 1
j += 1
ans = max(ans, j - i)
d[a[i]] -= 1
if d[a[i]] == 0:
m -= 1
print(ans)
```
| 3
|
|
992
|
A
|
Nastya and an Array
|
PROGRAMMING
| 800
|
[
"implementation",
"sortings"
] | null | null |
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties:
- In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes.
Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array.
|
Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero.
|
[
"5\n1 1 1 1 1\n",
"3\n2 0 -1\n",
"4\n5 -6 -5 1\n"
] |
[
"1\n",
"2\n",
"4\n"
] |
In the first example you can add - 1 to all non-zero elements in one second and make them equal to zero.
In the second example you can add - 2 on the first second, then the array becomes equal to [0, 0, - 3]. On the second second you can add 3 to the third (the only non-zero) element.
| 500
|
[
{
"input": "5\n1 1 1 1 1",
"output": "1"
},
{
"input": "3\n2 0 -1",
"output": "2"
},
{
"input": "4\n5 -6 -5 1",
"output": "4"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n21794 -79194",
"output": "2"
},
{
"input": "3\n-63526 95085 -5239",
"output": "3"
},
{
"input": "3\n0 53372 -20572",
"output": "2"
},
{
"input": "13\n-2075 -32242 27034 -37618 -96962 82203 64846 48249 -71761 28908 -21222 -61370 46899",
"output": "13"
},
{
"input": "5\n806 0 1308 1954 683",
"output": "4"
},
{
"input": "8\n-26 0 -249 -289 -126 -206 288 -11",
"output": "7"
},
{
"input": "10\n2 2 2 1 2 -1 0 2 -1 1",
"output": "3"
},
{
"input": "1\n8",
"output": "1"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "5\n2 0 -1 0 0",
"output": "2"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0",
"output": "0"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n-1 0",
"output": "1"
},
{
"input": "4\n0 0 0 0",
"output": "0"
},
{
"input": "8\n10 9 -1 0 0 3 2 3",
"output": "5"
},
{
"input": "5\n5 0 1 2 3",
"output": "4"
},
{
"input": "3\n1 1 0",
"output": "1"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "5\n1 2 0 0 0",
"output": "2"
},
{
"input": "5\n1 0 0 0 0",
"output": "1"
},
{
"input": "5\n4 5 6 0 0",
"output": "3"
},
{
"input": "4\n-1 0 0 1",
"output": "2"
},
{
"input": "5\n3 0 0 4 5",
"output": "3"
},
{
"input": "3\n0 0 2",
"output": "1"
},
{
"input": "3\n1 0 0",
"output": "1"
},
{
"input": "4\n0 0 0 4",
"output": "1"
},
{
"input": "5\n-1 0 0 0 0",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "10\n0 0 0 0 0 1 2 3 0 0",
"output": "3"
},
{
"input": "4\n0 1 2 3",
"output": "3"
},
{
"input": "3\n0 1 2",
"output": "2"
},
{
"input": "4\n2 0 0 -1",
"output": "2"
}
] | 1,619,520,922
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 79
| 156
| 7,782,400
|
n=int(input())
li=list(map(int,input().split()))
li.sort()
if(len(set(li))==1 and li[0]!=0):
print(1)
elif(len(set(li))==1 and li[0]==0):
print(0)
else:
c=0
for i in set(li):
if i!=0:
c=c+1
print(c)
|
Title: Nastya and an Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties:
- In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes.
Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array.
Output Specification:
Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero.
Demo Input:
['5\n1 1 1 1 1\n', '3\n2 0 -1\n', '4\n5 -6 -5 1\n']
Demo Output:
['1\n', '2\n', '4\n']
Note:
In the first example you can add - 1 to all non-zero elements in one second and make them equal to zero.
In the second example you can add - 2 on the first second, then the array becomes equal to [0, 0, - 3]. On the second second you can add 3 to the third (the only non-zero) element.
|
```python
n=int(input())
li=list(map(int,input().split()))
li.sort()
if(len(set(li))==1 and li[0]!=0):
print(1)
elif(len(set(li))==1 and li[0]==0):
print(0)
else:
c=0
for i in set(li):
if i!=0:
c=c+1
print(c)
```
| 3
|
|
711
|
A
|
Bus to Udayland
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied.
ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit?
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus.
Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row.
Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details.
|
If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output).
If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line.
If there are multiple solutions, you may print any of them.
|
[
"6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n",
"4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n",
"5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n"
] |
[
"YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n",
"NO\n",
"YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n"
] |
Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair.
O+|+X
XO|XX
OX|OO
XX|OX
OO|OO
OO|XX
| 500
|
[
{
"input": "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX",
"output": "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX"
},
{
"input": "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX",
"output": "NO"
},
{
"input": "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO",
"output": "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO"
},
{
"input": "1\nXO|OX",
"output": "NO"
},
{
"input": "1\nOO|OO",
"output": "YES\n++|OO"
},
{
"input": "4\nXO|XX\nXX|XO\nOX|XX\nXO|XO",
"output": "NO"
},
{
"input": "9\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|OO\nOX|OX\nOX|XO\nOX|OX",
"output": "YES\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|++\nOX|OX\nOX|XO\nOX|OX"
},
{
"input": "61\nOX|XX\nOX|XX\nOX|XX\nXO|XO\nXX|XO\nXX|XX\nXX|XX\nOX|XX\nXO|XO\nOX|XO\nXO|OX\nXX|XX\nXX|XX\nOX|OX\nXX|OX\nOX|XO\nOX|XO\nXO|OX\nXO|XX\nOX|XX\nOX|XX\nXO|OX\nXO|XX\nXO|XX\nOX|XX\nXX|XX\nXX|XO\nXO|XX\nXX|XX\nXO|OX\nXX|XO\nXO|XX\nXO|XO\nXO|OX\nXX|OX\nXO|OX\nOX|XX\nXX|OX\nXX|XX\nOX|XO\nOX|XX\nXO|OX\nOX|XX\nOX|XX\nXO|XO\nXO|XX\nOX|XX\nXO|XO\nOX|XX\nXX|XX\nOX|XO\nXO|XO\nXO|XO\nOX|OX\nXX|OX\nXX|OX\nOX|XO\nOX|XX\nOX|OX\nXO|XX\nOX|XX",
"output": "NO"
},
{
"input": "1\nOO|XX",
"output": "YES\n++|XX"
},
{
"input": "10\nOO|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX",
"output": "YES\n++|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX"
},
{
"input": "10\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|OO",
"output": "YES\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|++"
},
{
"input": "5\nXX|XX\nXX|XX\nXO|OX\nOO|OX\nOX|XO",
"output": "YES\nXX|XX\nXX|XX\nXO|OX\n++|OX\nOX|XO"
},
{
"input": "6\nOO|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX",
"output": "YES\n++|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX"
}
] | 1,697,831,071
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 46
| 102,400
|
n = int(input())
a = []
flag = 1
for i in range(n):
row = list(input())
a.append(row)
if row[0] == 'O' and row[1] == 'O' and flag:
flag = 0
row[0] = row[1] = '+'
elif row[3] == 'O' and row[4] == 'O' and flag:
flag = 0
row[3] = row[4] = '+'
if flag:
print("NO")
else:
print("YES")
for i in range(n):
print("".join(a[i]))
|
Title: Bus to Udayland
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied.
ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus.
Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row.
Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details.
Output Specification:
If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output).
If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line.
If there are multiple solutions, you may print any of them.
Demo Input:
['6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', '4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n', '5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n']
Demo Output:
['YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', 'NO\n', 'YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n']
Note:
Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair.
O+|+X
XO|XX
OX|OO
XX|OX
OO|OO
OO|XX
|
```python
n = int(input())
a = []
flag = 1
for i in range(n):
row = list(input())
a.append(row)
if row[0] == 'O' and row[1] == 'O' and flag:
flag = 0
row[0] = row[1] = '+'
elif row[3] == 'O' and row[4] == 'O' and flag:
flag = 0
row[3] = row[4] = '+'
if flag:
print("NO")
else:
print("YES")
for i in range(n):
print("".join(a[i]))
```
| 3
|
|
476
|
B
|
Dreamoon and WiFi
|
PROGRAMMING
| 1,300
|
[
"bitmasks",
"brute force",
"combinatorics",
"dp",
"math",
"probabilities"
] | null | null |
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them.
Each command is one of the following two types:
1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-'
But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5).
You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
|
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}.
The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command.
Lengths of two strings are equal and do not exceed 10.
|
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
|
[
"++-+-\n+-+-+\n",
"+-+-\n+-??\n",
"+++\n??-\n"
] |
[
"1.000000000000\n",
"0.500000000000\n",
"0.000000000000\n"
] |
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position + 1.
For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5.
For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position + 3 is 0.
| 1,500
|
[
{
"input": "++-+-\n+-+-+",
"output": "1.000000000000"
},
{
"input": "+-+-\n+-??",
"output": "0.500000000000"
},
{
"input": "+++\n??-",
"output": "0.000000000000"
},
{
"input": "++++++++++\n+++??++?++",
"output": "0.125000000000"
},
{
"input": "--+++---+-\n??????????",
"output": "0.205078125000"
},
{
"input": "+--+++--+-\n??????????",
"output": "0.246093750000"
},
{
"input": "+\n+",
"output": "1.000000000000"
},
{
"input": "-\n?",
"output": "0.500000000000"
},
{
"input": "+\n-",
"output": "0.000000000000"
},
{
"input": "-\n-",
"output": "1.000000000000"
},
{
"input": "-\n+",
"output": "0.000000000000"
},
{
"input": "+\n?",
"output": "0.500000000000"
},
{
"input": "++++++++++\n++++++++++",
"output": "1.000000000000"
},
{
"input": "++++++++++\n++++-+++++",
"output": "0.000000000000"
},
{
"input": "----------\n++++++++++",
"output": "0.000000000000"
},
{
"input": "++++++++++\n++++??++++",
"output": "0.250000000000"
},
{
"input": "----------\n+++?++++-+",
"output": "0.000000000000"
},
{
"input": "++++++++++\n++++++++?+",
"output": "0.500000000000"
},
{
"input": "--++++--+\n?-+?-??+-",
"output": "0.250000000000"
},
{
"input": "----------\n??????????",
"output": "0.000976562500"
},
{
"input": "+--++\n+--+-",
"output": "0.000000000000"
},
{
"input": "-----++---\n????????+?",
"output": "0.017578125000"
},
{
"input": "------+--+\n??????????",
"output": "0.043945312500"
},
{
"input": "---++--\n???????",
"output": "0.164062500000"
},
{
"input": "-----++\n???????",
"output": "0.164062500000"
},
{
"input": "+---+--\n???????",
"output": "0.164062500000"
},
{
"input": "---+-+\n??????",
"output": "0.234375000000"
},
{
"input": "+++-+\n---++",
"output": "0.000000000000"
},
{
"input": "++-+--+\n?-?+??+",
"output": "0.375000000000"
},
{
"input": "----+++--\n-+?+++?--",
"output": "0.000000000000"
},
{
"input": "+-----\n+?----",
"output": "0.500000000000"
}
] | 1,698,717,071
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 46
| 0
|
def go(i, pos):
cnt = 0
if i == len(t):
return int(pos == endpos)
if t[i] == '+':
cnt += go(i + 1, pos + 1)
elif t[i] == '-':
cnt += go(i + 1, pos - 1)
else:
cnt += go(i + 1, pos + 1)
cnt += go(i + 1, pos - 1)
return cnt
s = input()
t = input()
endpos = 0
for i in range(len(s)):
endpos += 1 if s[i] == '+' else -1
n = 0
for i in range(len(t)):
if t[i] == '?':
n += 1
result = go(0, 0) / (2 ** n)
print(f"{result:.9f}")
|
Title: Dreamoon and WiFi
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them.
Each command is one of the following two types:
1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-'
But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5).
You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
Input Specification:
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}.
The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command.
Lengths of two strings are equal and do not exceed 10.
Output Specification:
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
Demo Input:
['++-+-\n+-+-+\n', '+-+-\n+-??\n', '+++\n??-\n']
Demo Output:
['1.000000000000\n', '0.500000000000\n', '0.000000000000\n']
Note:
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position + 1.
For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5.
For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position + 3 is 0.
|
```python
def go(i, pos):
cnt = 0
if i == len(t):
return int(pos == endpos)
if t[i] == '+':
cnt += go(i + 1, pos + 1)
elif t[i] == '-':
cnt += go(i + 1, pos - 1)
else:
cnt += go(i + 1, pos + 1)
cnt += go(i + 1, pos - 1)
return cnt
s = input()
t = input()
endpos = 0
for i in range(len(s)):
endpos += 1 if s[i] == '+' else -1
n = 0
for i in range(len(t)):
if t[i] == '?':
n += 1
result = go(0, 0) / (2 ** n)
print(f"{result:.9f}")
```
| 3
|
|
768
|
A
|
Oath of the Night's Watch
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"sortings"
] | null | null |
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath.
With that begins the watch of Jon Snow. He is assigned the task to support the stewards.
This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him.
Can you find how many stewards will Jon support?
|
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow.
Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
|
Output a single integer representing the number of stewards which Jon will feed.
|
[
"2\n1 5\n",
"3\n1 2 5\n"
] |
[
"0",
"1"
] |
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5.
In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
| 500
|
[
{
"input": "2\n1 5",
"output": "0"
},
{
"input": "3\n1 2 5",
"output": "1"
},
{
"input": "4\n1 2 3 4",
"output": "2"
},
{
"input": "8\n7 8 9 4 5 6 1 2",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n100",
"output": "0"
},
{
"input": "205\n5 5 3 3 6 2 9 3 8 9 6 6 10 8 1 5 3 3 1 2 9 9 9 3 9 10 3 9 8 3 5 6 6 4 6 9 2 9 10 9 5 6 6 7 4 2 6 3 4 1 10 1 7 2 7 7 3 2 6 5 5 2 9 3 8 8 7 6 6 4 2 2 6 2 3 5 7 2 2 10 1 4 6 9 2 3 7 2 2 7 4 4 9 10 7 5 8 6 5 3 6 10 2 7 5 6 6 8 3 3 9 4 3 5 7 9 3 2 1 1 3 2 1 9 3 1 4 4 10 2 5 5 8 1 4 8 5 3 1 10 8 6 5 8 3 5 4 5 4 4 6 7 2 8 10 8 7 6 6 9 6 7 1 10 3 2 5 10 4 4 5 4 3 4 8 5 3 8 10 3 10 9 7 2 1 8 6 4 6 5 8 10 2 6 7 4 9 4 5 1 8 7 10 3 1",
"output": "174"
},
{
"input": "4\n1000000000 99999999 1000000000 1000000000",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "3\n1 1 1",
"output": "0"
},
{
"input": "6\n1 1 3 3 2 2",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "4\n1 1 2 5",
"output": "1"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n1 1 1 1 5",
"output": "0"
},
{
"input": "5\n1 1 2 3 3",
"output": "1"
},
{
"input": "3\n1 1 3",
"output": "0"
},
{
"input": "3\n2 2 3",
"output": "0"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "5\n1 5 3 5 1",
"output": "1"
},
{
"input": "7\n1 2 2 2 2 2 3",
"output": "5"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "9\n2 2 2 3 4 5 6 6 6",
"output": "3"
},
{
"input": "10\n1 1 1 2 3 3 3 3 3 3",
"output": "1"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n0 0 1",
"output": "0"
},
{
"input": "9\n1 1 1 2 2 2 3 3 3",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "0"
},
{
"input": "6\n2 2 2 2 2 2",
"output": "0"
},
{
"input": "5\n2 2 2 2 2",
"output": "0"
},
{
"input": "5\n5 5 5 5 5",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "6\n1 2 5 5 5 5",
"output": "1"
},
{
"input": "5\n1 2 3 3 3",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "0"
},
{
"input": "6\n1 1 1 1 1 2",
"output": "0"
},
{
"input": "5\n1 1 2 4 4",
"output": "1"
},
{
"input": "3\n999999 5999999 9999999",
"output": "1"
},
{
"input": "4\n1 1 5 5",
"output": "0"
},
{
"input": "9\n1 1 1 2 2 2 4 4 4",
"output": "3"
},
{
"input": "5\n1 3 4 5 1",
"output": "2"
},
{
"input": "5\n3 3 3 3 3",
"output": "0"
},
{
"input": "5\n1 1 2 2 2",
"output": "0"
},
{
"input": "5\n2 1 1 1 3",
"output": "1"
},
{
"input": "5\n0 0 0 1 2",
"output": "1"
},
{
"input": "4\n2 2 2 3",
"output": "0"
},
{
"input": "7\n1 1 1 1 5 5 5",
"output": "0"
},
{
"input": "5\n1 2 3 4 4",
"output": "2"
},
{
"input": "2\n5 4",
"output": "0"
},
{
"input": "4\n5 5 5 5",
"output": "0"
},
{
"input": "5\n1 1 1 5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "0"
},
{
"input": "4\n1 2 2 2",
"output": "0"
},
{
"input": "8\n1000000000 1000000000 1000000000 999999999 999999999 999999999 999999998 999999998",
"output": "3"
},
{
"input": "5\n1 1 3 4 4",
"output": "1"
},
{
"input": "6\n1 1 2 2 3 3",
"output": "2"
},
{
"input": "4\n1 1 1 1",
"output": "0"
},
{
"input": "9\n1 2 3 4 1 5 6 7 8",
"output": "6"
},
{
"input": "8\n5 4 4 6 6 4 4 3",
"output": "5"
},
{
"input": "8\n4 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "7\n4 3 3 3 3 3 3",
"output": "0"
},
{
"input": "6\n4 3 3 3 3 3",
"output": "0"
},
{
"input": "5\n4 3 3 3 3",
"output": "0"
}
] | 1,663,101,830
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 88
| 93
| 13,516,800
|
n = int(input())
lst = list(map(int, input().split()))
lst.sort()
res = 0
for i in range(n):
if lst[i] != lst[0] and lst[i] != lst[-1]:
res += 1
res += 2
if res < 3:
print(0)
else:
print(res - 2)
|
Title: Oath of the Night's Watch
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath.
With that begins the watch of Jon Snow. He is assigned the task to support the stewards.
This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him.
Can you find how many stewards will Jon support?
Input Specification:
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow.
Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
Output Specification:
Output a single integer representing the number of stewards which Jon will feed.
Demo Input:
['2\n1 5\n', '3\n1 2 5\n']
Demo Output:
['0', '1']
Note:
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5.
In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
|
```python
n = int(input())
lst = list(map(int, input().split()))
lst.sort()
res = 0
for i in range(n):
if lst[i] != lst[0] and lst[i] != lst[-1]:
res += 1
res += 2
if res < 3:
print(0)
else:
print(res - 2)
```
| 3
|
|
190
|
B
|
Surrounded
|
PROGRAMMING
| 1,800
|
[
"geometry"
] | null | null |
So, the Berland is at war with its eternal enemy Flatland again, and Vasya, an accountant, was assigned to fulfil his duty to the nation.
Right now the situation in Berland is dismal — their both cities are surrounded! The armies of flatlanders stand on the borders of circles, the circles' centers are in the surrounded cities. At any moment all points of the flatland ring can begin to move quickly in the direction of the city — that's the strategy the flatlanders usually follow when they besiege cities.
The berlanders are sure that they can repel the enemy's attack if they learn the exact time the attack starts. For that they need to construct a radar that would register any movement at the distance of at most *r* from it. Thus, we can install a radar at such point, that at least one point of the enemy ring will be in its detecting range (that is, at a distance of at most *r*). Then the radar can immediately inform about the enemy's attack.
Due to the newest technologies, we can place a radar at any point without any problems. But the problem is that the berlanders have the time to make only one radar. Besides, the larger the detection radius (*r*) is, the more the radar costs.
That's why Vasya's task (that is, your task) is to find the minimum possible detection radius for the radar. In other words, your task is to find the minimum radius *r* (*r*<=≥<=0) such, that a radar with radius *r* can be installed at some point and it can register the start of the movements of both flatland rings from that point.
In this problem you can consider the cities as material points, the attacking enemy rings - as circles with centers in the cities, the radar's detection range — as a disk (including the border) with the center at the point where the radar is placed.
|
The input files consist of two lines. Each line represents the city and the flatland ring that surrounds it as three space-separated integers *x**i*, *y**i*, *r**i* (|*x**i*|,<=|*y**i*|<=≤<=104; 1<=≤<=*r**i*<=≤<=104) — the city's coordinates and the distance from the city to the flatlanders, correspondingly.
It is guaranteed that the cities are located at different points.
|
Print a single real number — the minimum detection radius of the described radar. The answer is considered correct if the absolute or relative error does not exceed 10<=-<=6.
|
[
"0 0 1\n6 0 3\n",
"-10 10 3\n10 -10 3\n"
] |
[
"1.000000000000000",
"11.142135623730951"
] |
The figure below shows the answer to the first sample. In this sample the best decision is to put the radar at point with coordinates (2, 0).
The figure below shows the answer for the second sample. In this sample the best decision is to put the radar at point with coordinates (0, 0).
| 1,000
|
[
{
"input": "0 0 1\n6 0 3",
"output": "1.000000000000000"
},
{
"input": "-10 10 3\n10 -10 3",
"output": "11.142135623730951"
},
{
"input": "2 1 3\n8 9 5",
"output": "1.000000000000000"
},
{
"input": "0 0 1\n-10 -10 9",
"output": "2.071067811865475"
},
{
"input": "10000 -9268 1\n-9898 9000 10",
"output": "13500.519287710202000"
},
{
"input": "10000 10000 1\n-10000 -10000 1",
"output": "14141.135623730950000"
},
{
"input": "123 21 50\n10 100 1000",
"output": "406.061621719103360"
},
{
"input": "0 3278 2382\n2312 1 1111",
"output": "258.747677968983450"
},
{
"input": "3 4 5\n5 12 13",
"output": "0.000000000000000"
},
{
"input": "-2 7 5\n4 0 6",
"output": "0.000000000000000"
},
{
"input": "4 0 2\n6 -1 10",
"output": "2.881966011250105"
},
{
"input": "41 17 3\n71 -86 10",
"output": "47.140003728560643"
},
{
"input": "761 641 6\n506 -293 5",
"output": "478.592191632957450"
},
{
"input": "-5051 -7339 9\n-9030 755 8",
"output": "4501.080828635849700"
},
{
"input": "0 5 2\n8 -4 94",
"output": "39.979202710603850"
},
{
"input": "83 -64 85\n27 80 89",
"output": "0.000000000000000"
},
{
"input": "-655 -750 68\n905 -161 68",
"output": "765.744715125679250"
},
{
"input": "1055 -5271 60\n-2992 8832 38",
"output": "7287.089182936641900"
},
{
"input": "4 0 201\n-6 4 279",
"output": "33.614835192865499"
},
{
"input": "-34 -5 836\n52 -39 706",
"output": "18.761487913212431"
},
{
"input": "659 -674 277\n-345 -556 127",
"output": "303.455240352694320"
},
{
"input": "4763 2945 956\n3591 9812 180",
"output": "2915.147750239716500"
},
{
"input": "3 -7 5749\n1 -6 9750",
"output": "1999.381966011250100"
},
{
"input": "28 -63 2382\n43 -83 1364",
"output": "496.500000000000000"
},
{
"input": "315 -532 7813\n407 -157 2121",
"output": "2652.939776235497000"
},
{
"input": "-9577 9051 5276\n-4315 -1295 8453",
"output": "0.000000000000000"
},
{
"input": "-7 -10 1\n-4 3 1",
"output": "5.670832032063167"
},
{
"input": "-74 27 535\n18 84 1",
"output": "212.886692948961240"
},
{
"input": "-454 -721 72\n-33 279 911",
"output": "51.003686623418254"
},
{
"input": "-171 762 304\n-428 -85 523",
"output": "29.065814314662131"
},
{
"input": "192 -295 1386\n-54 -78 1",
"output": "528.483994683445640"
},
{
"input": "-5134 -9860 5513\n6291 -855 9034",
"output": "0.093506651303098"
},
{
"input": "6651 8200 610\n-9228 9387 10000",
"output": "2656.651995660197400"
},
{
"input": "6370 7728 933\n4595 3736 2748",
"output": "343.915768575204200"
},
{
"input": "-6 3 8\n7 2 1",
"output": "2.019202405202649"
},
{
"input": "0 -1 1\n1 -1 1",
"output": "0.000000000000000"
},
{
"input": "0 1 3\n1 -1 1",
"output": "0.000000000000000"
},
{
"input": "-2 0 1\n3 -2 1",
"output": "1.692582403567252"
},
{
"input": "-10000 42 10000\n10000 43 10000",
"output": "0.000012499999992"
},
{
"input": "103 104 5\n97 96 5",
"output": "0.000000000000000"
},
{
"input": "2587 4850 3327\n3278 -204 1774",
"output": "0.009605941526345"
},
{
"input": "826 4417 2901\n833 -2286 3802",
"output": "0.001827539409235"
},
{
"input": "1003 -5005 3399\n-6036 -1729 4365",
"output": "0.000032199896827"
}
] | 1,594,384,191
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 109
| 6,963,200
|
x1,y1,r1=list(map(float,input().split()))
x2,y2,r2=list(map(float,input().split()))
if r1>r2:
r2,r1=r1,r2
d=((x2-x1)**2 + (y2-y1)**2)**(0.5)
if d>r1+r2:
print((d-(r1+r2))/2)
elif r2>d+r1:
print((r2-(r1+d))/2)
else:
print(0)
|
Title: Surrounded
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
So, the Berland is at war with its eternal enemy Flatland again, and Vasya, an accountant, was assigned to fulfil his duty to the nation.
Right now the situation in Berland is dismal — their both cities are surrounded! The armies of flatlanders stand on the borders of circles, the circles' centers are in the surrounded cities. At any moment all points of the flatland ring can begin to move quickly in the direction of the city — that's the strategy the flatlanders usually follow when they besiege cities.
The berlanders are sure that they can repel the enemy's attack if they learn the exact time the attack starts. For that they need to construct a radar that would register any movement at the distance of at most *r* from it. Thus, we can install a radar at such point, that at least one point of the enemy ring will be in its detecting range (that is, at a distance of at most *r*). Then the radar can immediately inform about the enemy's attack.
Due to the newest technologies, we can place a radar at any point without any problems. But the problem is that the berlanders have the time to make only one radar. Besides, the larger the detection radius (*r*) is, the more the radar costs.
That's why Vasya's task (that is, your task) is to find the minimum possible detection radius for the radar. In other words, your task is to find the minimum radius *r* (*r*<=≥<=0) such, that a radar with radius *r* can be installed at some point and it can register the start of the movements of both flatland rings from that point.
In this problem you can consider the cities as material points, the attacking enemy rings - as circles with centers in the cities, the radar's detection range — as a disk (including the border) with the center at the point where the radar is placed.
Input Specification:
The input files consist of two lines. Each line represents the city and the flatland ring that surrounds it as three space-separated integers *x**i*, *y**i*, *r**i* (|*x**i*|,<=|*y**i*|<=≤<=104; 1<=≤<=*r**i*<=≤<=104) — the city's coordinates and the distance from the city to the flatlanders, correspondingly.
It is guaranteed that the cities are located at different points.
Output Specification:
Print a single real number — the minimum detection radius of the described radar. The answer is considered correct if the absolute or relative error does not exceed 10<=-<=6.
Demo Input:
['0 0 1\n6 0 3\n', '-10 10 3\n10 -10 3\n']
Demo Output:
['1.000000000000000', '11.142135623730951']
Note:
The figure below shows the answer to the first sample. In this sample the best decision is to put the radar at point with coordinates (2, 0).
The figure below shows the answer for the second sample. In this sample the best decision is to put the radar at point with coordinates (0, 0).
|
```python
x1,y1,r1=list(map(float,input().split()))
x2,y2,r2=list(map(float,input().split()))
if r1>r2:
r2,r1=r1,r2
d=((x2-x1)**2 + (y2-y1)**2)**(0.5)
if d>r1+r2:
print((d-(r1+r2))/2)
elif r2>d+r1:
print((r2-(r1+d))/2)
else:
print(0)
```
| 3
|
|
482
|
A
|
Diverse Permutation
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"greedy"
] | null | null |
Permutation *p* is an ordered set of integers *p*1,<=<=<=*p*2,<=<=<=...,<=<=<=*p**n*, consisting of *n* distinct positive integers not larger than *n*. We'll denote as *n* the length of permutation *p*1,<=<=<=*p*2,<=<=<=...,<=<=<=*p**n*.
Your task is to find such permutation *p* of length *n*, that the group of numbers |*p*1<=-<=*p*2|,<=|*p*2<=-<=*p*3|,<=...,<=|*p**n*<=-<=1<=-<=*p**n*| has exactly *k* distinct elements.
|
The single line of the input contains two space-separated positive integers *n*, *k* (1<=≤<=*k*<=<<=*n*<=≤<=105).
|
Print *n* integers forming the permutation. If there are multiple answers, print any of them.
|
[
"3 2\n",
"3 1\n",
"5 2\n"
] |
[
"1 3 2\n",
"1 2 3\n",
"1 3 2 4 5\n"
] |
By |*x*| we denote the absolute value of number *x*.
| 500
|
[
{
"input": "3 2",
"output": "1 3 2"
},
{
"input": "3 1",
"output": "1 2 3"
},
{
"input": "5 2",
"output": "1 3 2 4 5"
},
{
"input": "5 4",
"output": "1 5 2 4 3"
},
{
"input": "10 4",
"output": "1 10 2 9 8 7 6 5 4 3"
},
{
"input": "10 3",
"output": "1 10 2 3 4 5 6 7 8 9"
},
{
"input": "10 9",
"output": "1 10 2 9 3 8 4 7 5 6"
},
{
"input": "100000 99999",
"output": "1 100000 2 99999 3 99998 4 99997 5 99996 6 99995 7 99994 8 99993 9 99992 10 99991 11 99990 12 99989 13 99988 14 99987 15 99986 16 99985 17 99984 18 99983 19 99982 20 99981 21 99980 22 99979 23 99978 24 99977 25 99976 26 99975 27 99974 28 99973 29 99972 30 99971 31 99970 32 99969 33 99968 34 99967 35 99966 36 99965 37 99964 38 99963 39 99962 40 99961 41 99960 42 99959 43 99958 44 99957 45 99956 46 99955 47 99954 48 99953 49 99952 50 99951 51 99950 52 99949 53 99948 54 99947 55 99946 56 99945 57 99944 58 999..."
},
{
"input": "99999 99998",
"output": "1 99999 2 99998 3 99997 4 99996 5 99995 6 99994 7 99993 8 99992 9 99991 10 99990 11 99989 12 99988 13 99987 14 99986 15 99985 16 99984 17 99983 18 99982 19 99981 20 99980 21 99979 22 99978 23 99977 24 99976 25 99975 26 99974 27 99973 28 99972 29 99971 30 99970 31 99969 32 99968 33 99967 34 99966 35 99965 36 99964 37 99963 38 99962 39 99961 40 99960 41 99959 42 99958 43 99957 44 99956 45 99955 46 99954 47 99953 48 99952 49 99951 50 99950 51 99949 52 99948 53 99947 54 99946 55 99945 56 99944 57 99943 58 9994..."
},
{
"input": "42273 29958",
"output": "1 42273 2 42272 3 42271 4 42270 5 42269 6 42268 7 42267 8 42266 9 42265 10 42264 11 42263 12 42262 13 42261 14 42260 15 42259 16 42258 17 42257 18 42256 19 42255 20 42254 21 42253 22 42252 23 42251 24 42250 25 42249 26 42248 27 42247 28 42246 29 42245 30 42244 31 42243 32 42242 33 42241 34 42240 35 42239 36 42238 37 42237 38 42236 39 42235 40 42234 41 42233 42 42232 43 42231 44 42230 45 42229 46 42228 47 42227 48 42226 49 42225 50 42224 51 42223 52 42222 53 42221 54 42220 55 42219 56 42218 57 42217 58 4221..."
},
{
"input": "29857 9843",
"output": "1 29857 2 29856 3 29855 4 29854 5 29853 6 29852 7 29851 8 29850 9 29849 10 29848 11 29847 12 29846 13 29845 14 29844 15 29843 16 29842 17 29841 18 29840 19 29839 20 29838 21 29837 22 29836 23 29835 24 29834 25 29833 26 29832 27 29831 28 29830 29 29829 30 29828 31 29827 32 29826 33 29825 34 29824 35 29823 36 29822 37 29821 38 29820 39 29819 40 29818 41 29817 42 29816 43 29815 44 29814 45 29813 46 29812 47 29811 48 29810 49 29809 50 29808 51 29807 52 29806 53 29805 54 29804 55 29803 56 29802 57 29801 58 2980..."
},
{
"input": "27687 4031",
"output": "1 27687 2 27686 3 27685 4 27684 5 27683 6 27682 7 27681 8 27680 9 27679 10 27678 11 27677 12 27676 13 27675 14 27674 15 27673 16 27672 17 27671 18 27670 19 27669 20 27668 21 27667 22 27666 23 27665 24 27664 25 27663 26 27662 27 27661 28 27660 29 27659 30 27658 31 27657 32 27656 33 27655 34 27654 35 27653 36 27652 37 27651 38 27650 39 27649 40 27648 41 27647 42 27646 43 27645 44 27644 45 27643 46 27642 47 27641 48 27640 49 27639 50 27638 51 27637 52 27636 53 27635 54 27634 55 27633 56 27632 57 27631 58 2763..."
},
{
"input": "25517 1767",
"output": "1 25517 2 25516 3 25515 4 25514 5 25513 6 25512 7 25511 8 25510 9 25509 10 25508 11 25507 12 25506 13 25505 14 25504 15 25503 16 25502 17 25501 18 25500 19 25499 20 25498 21 25497 22 25496 23 25495 24 25494 25 25493 26 25492 27 25491 28 25490 29 25489 30 25488 31 25487 32 25486 33 25485 34 25484 35 25483 36 25482 37 25481 38 25480 39 25479 40 25478 41 25477 42 25476 43 25475 44 25474 45 25473 46 25472 47 25471 48 25470 49 25469 50 25468 51 25467 52 25466 53 25465 54 25464 55 25463 56 25462 57 25461 58 2546..."
},
{
"input": "23347 20494",
"output": "1 23347 2 23346 3 23345 4 23344 5 23343 6 23342 7 23341 8 23340 9 23339 10 23338 11 23337 12 23336 13 23335 14 23334 15 23333 16 23332 17 23331 18 23330 19 23329 20 23328 21 23327 22 23326 23 23325 24 23324 25 23323 26 23322 27 23321 28 23320 29 23319 30 23318 31 23317 32 23316 33 23315 34 23314 35 23313 36 23312 37 23311 38 23310 39 23309 40 23308 41 23307 42 23306 43 23305 44 23304 45 23303 46 23302 47 23301 48 23300 49 23299 50 23298 51 23297 52 23296 53 23295 54 23294 55 23293 56 23292 57 23291 58 2329..."
},
{
"input": "10931 8824",
"output": "1 10931 2 10930 3 10929 4 10928 5 10927 6 10926 7 10925 8 10924 9 10923 10 10922 11 10921 12 10920 13 10919 14 10918 15 10917 16 10916 17 10915 18 10914 19 10913 20 10912 21 10911 22 10910 23 10909 24 10908 25 10907 26 10906 27 10905 28 10904 29 10903 30 10902 31 10901 32 10900 33 10899 34 10898 35 10897 36 10896 37 10895 38 10894 39 10893 40 10892 41 10891 42 10890 43 10889 44 10888 45 10887 46 10886 47 10885 48 10884 49 10883 50 10882 51 10881 52 10880 53 10879 54 10878 55 10877 56 10876 57 10875 58 1087..."
},
{
"input": "98514 26178",
"output": "1 98514 2 98513 3 98512 4 98511 5 98510 6 98509 7 98508 8 98507 9 98506 10 98505 11 98504 12 98503 13 98502 14 98501 15 98500 16 98499 17 98498 18 98497 19 98496 20 98495 21 98494 22 98493 23 98492 24 98491 25 98490 26 98489 27 98488 28 98487 29 98486 30 98485 31 98484 32 98483 33 98482 34 98481 35 98480 36 98479 37 98478 38 98477 39 98476 40 98475 41 98474 42 98473 43 98472 44 98471 45 98470 46 98469 47 98468 48 98467 49 98466 50 98465 51 98464 52 98463 53 98462 54 98461 55 98460 56 98459 57 98458 58 9845..."
},
{
"input": "6591 407",
"output": "1 6591 2 6590 3 6589 4 6588 5 6587 6 6586 7 6585 8 6584 9 6583 10 6582 11 6581 12 6580 13 6579 14 6578 15 6577 16 6576 17 6575 18 6574 19 6573 20 6572 21 6571 22 6570 23 6569 24 6568 25 6567 26 6566 27 6565 28 6564 29 6563 30 6562 31 6561 32 6560 33 6559 34 6558 35 6557 36 6556 37 6555 38 6554 39 6553 40 6552 41 6551 42 6550 43 6549 44 6548 45 6547 46 6546 47 6545 48 6544 49 6543 50 6542 51 6541 52 6540 53 6539 54 6538 55 6537 56 6536 57 6535 58 6534 59 6533 60 6532 61 6531 62 6530 63 6529 64 6528 65 6527 ..."
},
{
"input": "94174 30132",
"output": "1 94174 2 94173 3 94172 4 94171 5 94170 6 94169 7 94168 8 94167 9 94166 10 94165 11 94164 12 94163 13 94162 14 94161 15 94160 16 94159 17 94158 18 94157 19 94156 20 94155 21 94154 22 94153 23 94152 24 94151 25 94150 26 94149 27 94148 28 94147 29 94146 30 94145 31 94144 32 94143 33 94142 34 94141 35 94140 36 94139 37 94138 38 94137 39 94136 40 94135 41 94134 42 94133 43 94132 44 94131 45 94130 46 94129 47 94128 48 94127 49 94126 50 94125 51 94124 52 94123 53 94122 54 94121 55 94120 56 94119 57 94118 58 9411..."
},
{
"input": "92004 85348",
"output": "1 92004 2 92003 3 92002 4 92001 5 92000 6 91999 7 91998 8 91997 9 91996 10 91995 11 91994 12 91993 13 91992 14 91991 15 91990 16 91989 17 91988 18 91987 19 91986 20 91985 21 91984 22 91983 23 91982 24 91981 25 91980 26 91979 27 91978 28 91977 29 91976 30 91975 31 91974 32 91973 33 91972 34 91971 35 91970 36 91969 37 91968 38 91967 39 91966 40 91965 41 91964 42 91963 43 91962 44 91961 45 91960 46 91959 47 91958 48 91957 49 91956 50 91955 51 91954 52 91953 53 91952 54 91951 55 91950 56 91949 57 91948 58 9194..."
},
{
"input": "59221 29504",
"output": "1 59221 2 59220 3 59219 4 59218 5 59217 6 59216 7 59215 8 59214 9 59213 10 59212 11 59211 12 59210 13 59209 14 59208 15 59207 16 59206 17 59205 18 59204 19 59203 20 59202 21 59201 22 59200 23 59199 24 59198 25 59197 26 59196 27 59195 28 59194 29 59193 30 59192 31 59191 32 59190 33 59189 34 59188 35 59187 36 59186 37 59185 38 59184 39 59183 40 59182 41 59181 42 59180 43 59179 44 59178 45 59177 46 59176 47 59175 48 59174 49 59173 50 59172 51 59171 52 59170 53 59169 54 59168 55 59167 56 59166 57 59165 58 5916..."
},
{
"input": "2 1",
"output": "1 2"
},
{
"input": "4 1",
"output": "1 2 3 4"
},
{
"input": "4 2",
"output": "1 4 3 2"
},
{
"input": "100000 1",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "99999 1",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "99998 2",
"output": "1 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 99915 99914..."
},
{
"input": "99999 5000",
"output": "1 99999 2 99998 3 99997 4 99996 5 99995 6 99994 7 99993 8 99992 9 99991 10 99990 11 99989 12 99988 13 99987 14 99986 15 99985 16 99984 17 99983 18 99982 19 99981 20 99980 21 99979 22 99978 23 99977 24 99976 25 99975 26 99974 27 99973 28 99972 29 99971 30 99970 31 99969 32 99968 33 99967 34 99966 35 99965 36 99964 37 99963 38 99962 39 99961 40 99960 41 99959 42 99958 43 99957 44 99956 45 99955 46 99954 47 99953 48 99952 49 99951 50 99950 51 99949 52 99948 53 99947 54 99946 55 99945 56 99944 57 99943 58 9994..."
},
{
"input": "100000 99998",
"output": "1 100000 2 99999 3 99998 4 99997 5 99996 6 99995 7 99994 8 99993 9 99992 10 99991 11 99990 12 99989 13 99988 14 99987 15 99986 16 99985 17 99984 18 99983 19 99982 20 99981 21 99980 22 99979 23 99978 24 99977 25 99976 26 99975 27 99974 28 99973 29 99972 30 99971 31 99970 32 99969 33 99968 34 99967 35 99966 36 99965 37 99964 38 99963 39 99962 40 99961 41 99960 42 99959 43 99958 44 99957 45 99956 46 99955 47 99954 48 99953 49 99952 50 99951 51 99950 52 99949 53 99948 54 99947 55 99946 56 99945 57 99944 58 999..."
},
{
"input": "3222 311",
"output": "1 3222 2 3221 3 3220 4 3219 5 3218 6 3217 7 3216 8 3215 9 3214 10 3213 11 3212 12 3211 13 3210 14 3209 15 3208 16 3207 17 3206 18 3205 19 3204 20 3203 21 3202 22 3201 23 3200 24 3199 25 3198 26 3197 27 3196 28 3195 29 3194 30 3193 31 3192 32 3191 33 3190 34 3189 35 3188 36 3187 37 3186 38 3185 39 3184 40 3183 41 3182 42 3181 43 3180 44 3179 45 3178 46 3177 47 3176 48 3175 49 3174 50 3173 51 3172 52 3171 53 3170 54 3169 55 3168 56 3167 57 3166 58 3165 59 3164 60 3163 61 3162 62 3161 63 3160 64 3159 65 3158 ..."
},
{
"input": "32244 222",
"output": "1 32244 2 32243 3 32242 4 32241 5 32240 6 32239 7 32238 8 32237 9 32236 10 32235 11 32234 12 32233 13 32232 14 32231 15 32230 16 32229 17 32228 18 32227 19 32226 20 32225 21 32224 22 32223 23 32222 24 32221 25 32220 26 32219 27 32218 28 32217 29 32216 30 32215 31 32214 32 32213 33 32212 34 32211 35 32210 36 32209 37 32208 38 32207 39 32206 40 32205 41 32204 42 32203 43 32202 44 32201 45 32200 46 32199 47 32198 48 32197 49 32196 50 32195 51 32194 52 32193 53 32192 54 32191 55 32190 56 32189 57 32188 58 3218..."
},
{
"input": "1111 122",
"output": "1 1111 2 1110 3 1109 4 1108 5 1107 6 1106 7 1105 8 1104 9 1103 10 1102 11 1101 12 1100 13 1099 14 1098 15 1097 16 1096 17 1095 18 1094 19 1093 20 1092 21 1091 22 1090 23 1089 24 1088 25 1087 26 1086 27 1085 28 1084 29 1083 30 1082 31 1081 32 1080 33 1079 34 1078 35 1077 36 1076 37 1075 38 1074 39 1073 40 1072 41 1071 42 1070 43 1069 44 1068 45 1067 46 1066 47 1065 48 1064 49 1063 50 1062 51 1061 52 1060 53 1059 54 1058 55 1057 56 1056 57 1055 58 1054 59 1053 60 1052 61 1051 1050 1049 1048 1047 1046 1045 10..."
},
{
"input": "32342 1221",
"output": "1 32342 2 32341 3 32340 4 32339 5 32338 6 32337 7 32336 8 32335 9 32334 10 32333 11 32332 12 32331 13 32330 14 32329 15 32328 16 32327 17 32326 18 32325 19 32324 20 32323 21 32322 22 32321 23 32320 24 32319 25 32318 26 32317 27 32316 28 32315 29 32314 30 32313 31 32312 32 32311 33 32310 34 32309 35 32308 36 32307 37 32306 38 32305 39 32304 40 32303 41 32302 42 32301 43 32300 44 32299 45 32298 46 32297 47 32296 48 32295 49 32294 50 32293 51 32292 52 32291 53 32290 54 32289 55 32288 56 32287 57 32286 58 3228..."
},
{
"input": "100000 50000",
"output": "1 100000 2 99999 3 99998 4 99997 5 99996 6 99995 7 99994 8 99993 9 99992 10 99991 11 99990 12 99989 13 99988 14 99987 15 99986 16 99985 17 99984 18 99983 19 99982 20 99981 21 99980 22 99979 23 99978 24 99977 25 99976 26 99975 27 99974 28 99973 29 99972 30 99971 31 99970 32 99969 33 99968 34 99967 35 99966 36 99965 37 99964 38 99963 39 99962 40 99961 41 99960 42 99959 43 99958 44 99957 45 99956 46 99955 47 99954 48 99953 49 99952 50 99951 51 99950 52 99949 53 99948 54 99947 55 99946 56 99945 57 99944 58 999..."
},
{
"input": "100000 45",
"output": "1 100000 2 99999 3 99998 4 99997 5 99996 6 99995 7 99994 8 99993 9 99992 10 99991 11 99990 12 99989 13 99988 14 99987 15 99986 16 99985 17 99984 18 99983 19 99982 20 99981 21 99980 22 99979 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 12..."
},
{
"input": "99999 2",
"output": "1 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 99915..."
},
{
"input": "9 8",
"output": "1 9 2 8 3 7 4 6 5"
},
{
"input": "7 5",
"output": "1 7 2 6 3 4 5"
}
] | 1,535,934,909
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 514
| 614,400
|
n, k = map(int, input().split())
cur = 1
x = 0
a = [0] * (n + 1)
while k > 0:
a[cur] = 1
print(cur, end=(' '))
if x == 0:
cur = cur + k
x = 1
else:
cur = cur - k
x = 0
k = k - 1
for i in range(1, n + 1):
if a[i] == 0:
print(i, end=' ')
|
Title: Diverse Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Permutation *p* is an ordered set of integers *p*1,<=<=<=*p*2,<=<=<=...,<=<=<=*p**n*, consisting of *n* distinct positive integers not larger than *n*. We'll denote as *n* the length of permutation *p*1,<=<=<=*p*2,<=<=<=...,<=<=<=*p**n*.
Your task is to find such permutation *p* of length *n*, that the group of numbers |*p*1<=-<=*p*2|,<=|*p*2<=-<=*p*3|,<=...,<=|*p**n*<=-<=1<=-<=*p**n*| has exactly *k* distinct elements.
Input Specification:
The single line of the input contains two space-separated positive integers *n*, *k* (1<=≤<=*k*<=<<=*n*<=≤<=105).
Output Specification:
Print *n* integers forming the permutation. If there are multiple answers, print any of them.
Demo Input:
['3 2\n', '3 1\n', '5 2\n']
Demo Output:
['1 3 2\n', '1 2 3\n', '1 3 2 4 5\n']
Note:
By |*x*| we denote the absolute value of number *x*.
|
```python
n, k = map(int, input().split())
cur = 1
x = 0
a = [0] * (n + 1)
while k > 0:
a[cur] = 1
print(cur, end=(' '))
if x == 0:
cur = cur + k
x = 1
else:
cur = cur - k
x = 0
k = k - 1
for i in range(1, n + 1):
if a[i] == 0:
print(i, end=' ')
```
| 3
|
|
825
|
A
|
Binary Protocol
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Polycarp has just invented a new binary protocol for data transmission. He is encoding positive integer decimal number to binary string using following algorithm:
- Each digit is represented with number of '1' characters equal to the value of that digit (for 0 it is zero ones). - Digits are written one by one in order corresponding to number and separated by single '0' character.
Though Polycarp learnt how to encode the numbers, he has no idea how to decode them back. Help him calculate the decoded number.
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=89) — length of the string *s*.
The second line contains string *s* — sequence of '0' and '1' characters, number in its encoded format. It is guaranteed that the number corresponding to the string is positive and doesn't exceed 109. The string always starts with '1'.
|
Print the decoded number.
|
[
"3\n111\n",
"9\n110011101\n"
] |
[
"3\n",
"2031\n"
] |
none
| 0
|
[
{
"input": "3\n111",
"output": "3"
},
{
"input": "9\n110011101",
"output": "2031"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "3\n100",
"output": "100"
},
{
"input": "5\n10001",
"output": "1001"
},
{
"input": "14\n11001100011000",
"output": "202002000"
},
{
"input": "31\n1000011111111100011110111111111",
"output": "100090049"
},
{
"input": "53\n10110111011110111110111111011111110111111110111111111",
"output": "123456789"
},
{
"input": "89\n11111111101111111110111111111011111111101111111110111111111011111111101111111110111111111",
"output": "999999999"
},
{
"input": "10\n1000000000",
"output": "1000000000"
},
{
"input": "2\n10",
"output": "10"
},
{
"input": "4\n1110",
"output": "30"
},
{
"input": "8\n10101010",
"output": "11110"
}
] | 1,500,742,616
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 13
| 77
| 4,608,000
|
n = int(input())
# print(n)
s = input()
# print(s)
k = 0
ans = ''
for c in s:
# print(c)
if c == '0':
ans += str(k)
k = 0
else:
k += 1
print(ans + str(k))
|
Title: Binary Protocol
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has just invented a new binary protocol for data transmission. He is encoding positive integer decimal number to binary string using following algorithm:
- Each digit is represented with number of '1' characters equal to the value of that digit (for 0 it is zero ones). - Digits are written one by one in order corresponding to number and separated by single '0' character.
Though Polycarp learnt how to encode the numbers, he has no idea how to decode them back. Help him calculate the decoded number.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=89) — length of the string *s*.
The second line contains string *s* — sequence of '0' and '1' characters, number in its encoded format. It is guaranteed that the number corresponding to the string is positive and doesn't exceed 109. The string always starts with '1'.
Output Specification:
Print the decoded number.
Demo Input:
['3\n111\n', '9\n110011101\n']
Demo Output:
['3\n', '2031\n']
Note:
none
|
```python
n = int(input())
# print(n)
s = input()
# print(s)
k = 0
ans = ''
for c in s:
# print(c)
if c == '0':
ans += str(k)
k = 0
else:
k += 1
print(ans + str(k))
```
| 3
|
|
892
|
A
|
Greed
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*).
Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not!
|
The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans.
The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans.
|
Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes).
You can print each letter in any case (upper or lower).
|
[
"2\n3 5\n3 6\n",
"3\n6 8 9\n6 10 12\n",
"5\n0 0 5 0 0\n1 1 8 10 5\n",
"4\n4 1 0 3\n5 2 2 3\n"
] |
[
"YES\n",
"NO\n",
"YES\n",
"YES\n"
] |
In the first sample, there are already 2 cans, so the answer is "YES".
| 500
|
[
{
"input": "2\n3 5\n3 6",
"output": "YES"
},
{
"input": "3\n6 8 9\n6 10 12",
"output": "NO"
},
{
"input": "5\n0 0 5 0 0\n1 1 8 10 5",
"output": "YES"
},
{
"input": "4\n4 1 0 3\n5 2 2 3",
"output": "YES"
},
{
"input": "10\n9 10 24 11 1 7 8 3 28 14\n86 20 34 11 22 94 8 16 73 85",
"output": "YES"
},
{
"input": "4\n25 35 7 31\n70 37 43 35",
"output": "YES"
},
{
"input": "10\n15 26 15 14 14 39 40 4 25 39\n27 72 16 44 69 48 53 17 63 42",
"output": "NO"
},
{
"input": "5\n22 5 19 16 32\n26 10 43 38 37",
"output": "NO"
},
{
"input": "5\n32 4 22 40 26\n39 20 36 98 44",
"output": "YES"
},
{
"input": "6\n18 25 3 10 13 37\n38 73 19 35 24 37",
"output": "YES"
},
{
"input": "2\n2 2\n2 2",
"output": "YES"
},
{
"input": "2\n2 5\n2 5",
"output": "YES"
},
{
"input": "2\n1000 1008\n10000 2352",
"output": "YES"
},
{
"input": "5\n1 2 3 4 5\n1 2 3 4 11",
"output": "YES"
},
{
"input": "4\n1 0 0 0\n2 0 0 0",
"output": "YES"
},
{
"input": "2\n0 0\n1 2",
"output": "YES"
},
{
"input": "3\n9 13 4\n10 14 5",
"output": "NO"
},
{
"input": "2\n0 0\n1 1",
"output": "YES"
},
{
"input": "5\n1 1 2 3 1\n1 1 2 3 4",
"output": "NO"
},
{
"input": "2\n0 0\n0 0",
"output": "YES"
},
{
"input": "3\n5 1 1\n5 5 5",
"output": "YES"
}
] | 1,659,184,237
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 39
| 108
| 18,739,200
|
_ = int(input())
soda = list(map(int, input().split()))
cans = sorted(list(map(int, input().split())))
max_capacity = cans[-1] + cans[-2]
result = "YES"
for s in soda:
max_capacity -= s
if max_capacity < 0:
result = "NO"
break
print(result)
|
Title: Greed
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*).
Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not!
Input Specification:
The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans.
The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans.
Output Specification:
Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes).
You can print each letter in any case (upper or lower).
Demo Input:
['2\n3 5\n3 6\n', '3\n6 8 9\n6 10 12\n', '5\n0 0 5 0 0\n1 1 8 10 5\n', '4\n4 1 0 3\n5 2 2 3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'YES\n']
Note:
In the first sample, there are already 2 cans, so the answer is "YES".
|
```python
_ = int(input())
soda = list(map(int, input().split()))
cans = sorted(list(map(int, input().split())))
max_capacity = cans[-1] + cans[-2]
result = "YES"
for s in soda:
max_capacity -= s
if max_capacity < 0:
result = "NO"
break
print(result)
```
| 3
|
|
996
|
A
|
Hit the Lottery
|
PROGRAMMING
| 800
|
[
"dp",
"greedy"
] | null | null |
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
|
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
|
Output the minimum number of bills that Allen could receive.
|
[
"125\n",
"43\n",
"1000000000\n"
] |
[
"3\n",
"5\n",
"10000000\n"
] |
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
| 500
|
[
{
"input": "125",
"output": "3"
},
{
"input": "43",
"output": "5"
},
{
"input": "1000000000",
"output": "10000000"
},
{
"input": "4",
"output": "4"
},
{
"input": "5",
"output": "1"
},
{
"input": "1",
"output": "1"
},
{
"input": "74",
"output": "8"
},
{
"input": "31",
"output": "3"
},
{
"input": "59",
"output": "8"
},
{
"input": "79",
"output": "9"
},
{
"input": "7",
"output": "3"
},
{
"input": "55",
"output": "4"
},
{
"input": "40",
"output": "2"
},
{
"input": "719",
"output": "13"
},
{
"input": "847",
"output": "13"
},
{
"input": "225",
"output": "4"
},
{
"input": "4704",
"output": "51"
},
{
"input": "1132",
"output": "15"
},
{
"input": "7811",
"output": "80"
},
{
"input": "7981",
"output": "84"
},
{
"input": "82655",
"output": "830"
},
{
"input": "6364",
"output": "70"
},
{
"input": "74611",
"output": "748"
},
{
"input": "45391",
"output": "459"
},
{
"input": "620448",
"output": "6210"
},
{
"input": "265145",
"output": "2654"
},
{
"input": "671704",
"output": "6721"
},
{
"input": "365173",
"output": "3658"
},
{
"input": "7130872",
"output": "71314"
},
{
"input": "9628747",
"output": "96292"
},
{
"input": "8898399",
"output": "88993"
},
{
"input": "9497953",
"output": "94985"
},
{
"input": "19070947",
"output": "190714"
},
{
"input": "20185520",
"output": "201856"
},
{
"input": "91402248",
"output": "914028"
},
{
"input": "27035533",
"output": "270360"
},
{
"input": "22717528",
"output": "227180"
},
{
"input": "24403439",
"output": "244041"
},
{
"input": "163565555",
"output": "1635659"
},
{
"input": "152541908",
"output": "1525423"
},
{
"input": "668439837",
"output": "6684403"
},
{
"input": "20",
"output": "1"
},
{
"input": "999999999",
"output": "10000009"
},
{
"input": "10",
"output": "1"
},
{
"input": "7",
"output": "3"
},
{
"input": "6",
"output": "2"
},
{
"input": "99999999",
"output": "1000009"
},
{
"input": "1000001",
"output": "10001"
},
{
"input": "2521",
"output": "27"
}
] | 1,693,589,232
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 46
| 0
|
a=int(input())
count_100 = a//100
a%=100
count_20 = a//20
a%=20
count_10 = a//10
a%=10
count_5 = a//5
a%=5
count_1 = a
tot = count_100 + count_20 + count_10 + count_5 + count_1
print(tot)
|
Title: Hit the Lottery
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
Input Specification:
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output Specification:
Output the minimum number of bills that Allen could receive.
Demo Input:
['125\n', '43\n', '1000000000\n']
Demo Output:
['3\n', '5\n', '10000000\n']
Note:
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
|
```python
a=int(input())
count_100 = a//100
a%=100
count_20 = a//20
a%=20
count_10 = a//10
a%=10
count_5 = a//5
a%=5
count_1 = a
tot = count_100 + count_20 + count_10 + count_5 + count_1
print(tot)
```
| 3
|
|
567
|
A
|
Lineland Mail
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
|
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
|
[
"4\n-5 -2 2 7\n",
"2\n-1 1\n"
] |
[
"3 12\n3 9\n4 7\n5 12\n",
"2 2\n2 2\n"
] |
none
| 500
|
[
{
"input": "4\n-5 -2 2 7",
"output": "3 12\n3 9\n4 7\n5 12"
},
{
"input": "2\n-1 1",
"output": "2 2\n2 2"
},
{
"input": "3\n-1 0 1",
"output": "1 2\n1 1\n1 2"
},
{
"input": "4\n-1 0 1 3",
"output": "1 4\n1 3\n1 2\n2 4"
},
{
"input": "3\n-1000000000 0 1000000000",
"output": "1000000000 2000000000\n1000000000 1000000000\n1000000000 2000000000"
},
{
"input": "2\n-1000000000 1000000000",
"output": "2000000000 2000000000\n2000000000 2000000000"
},
{
"input": "10\n1 10 12 15 59 68 130 912 1239 9123",
"output": "9 9122\n2 9113\n2 9111\n3 9108\n9 9064\n9 9055\n62 8993\n327 8211\n327 7884\n7884 9122"
},
{
"input": "5\n-2 -1 0 1 2",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "5\n-2 -1 0 1 3",
"output": "1 5\n1 4\n1 3\n1 3\n2 5"
},
{
"input": "3\n-10000 1 10000",
"output": "10001 20000\n9999 10001\n9999 20000"
},
{
"input": "5\n-1000000000 -999999999 -999999998 -999999997 -999999996",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "10\n-857422304 -529223472 82412729 145077145 188538640 265299215 527377039 588634631 592896147 702473706",
"output": "328198832 1559896010\n328198832 1231697178\n62664416 939835033\n43461495 1002499449\n43461495 1045960944\n76760575 1122721519\n61257592 1384799343\n4261516 1446056935\n4261516 1450318451\n109577559 1559896010"
},
{
"input": "10\n-876779400 -829849659 -781819137 -570920213 18428128 25280705 121178189 219147240 528386329 923854124",
"output": "46929741 1800633524\n46929741 1753703783\n48030522 1705673261\n210898924 1494774337\n6852577 905425996\n6852577 902060105\n95897484 997957589\n97969051 1095926640\n309239089 1405165729\n395467795 1800633524"
},
{
"input": "30\n-15 1 21 25 30 40 59 60 77 81 97 100 103 123 139 141 157 158 173 183 200 215 226 231 244 256 267 279 289 292",
"output": "16 307\n16 291\n4 271\n4 267\n5 262\n10 252\n1 233\n1 232\n4 215\n4 211\n3 195\n3 192\n3 189\n16 169\n2 154\n2 156\n1 172\n1 173\n10 188\n10 198\n15 215\n11 230\n5 241\n5 246\n12 259\n11 271\n11 282\n10 294\n3 304\n3 307"
},
{
"input": "10\n-1000000000 -999999999 -999999997 -999999996 -999999995 -999999994 -999999992 -999999990 -999999988 -999999986",
"output": "1 14\n1 13\n1 11\n1 10\n1 9\n1 8\n2 8\n2 10\n2 12\n2 14"
},
{
"input": "50\n-50000 -49459 -48875 -48456 -48411 -48096 -47901 -47500 -47150 -46808 -46687 -46679 -46337 -45747 -45604 -45194 -44752 -44242 -44231 -44122 -43636 -43274 -42916 -42881 -42386 -42095 -41830 -41618 -41145 -40897 -40534 -40007 -39761 -39389 -39104 -38909 -38630 -38561 -38364 -38255 -38214 -38084 -37959 -37607 -37202 -36890 -36681 -36136 -36123 -35886",
"output": "541 14114\n541 13573\n419 12989\n45 12570\n45 12525\n195 12210\n195 12015\n350 11614\n342 11264\n121 10922\n8 10801\n8 10793\n342 10451\n143 9861\n143 9718\n410 9308\n442 8866\n11 8356\n11 8345\n109 8236\n362 7750\n358 7388\n35 7084\n35 7119\n291 7614\n265 7905\n212 8170\n212 8382\n248 8855\n248 9103\n363 9466\n246 9993\n246 10239\n285 10611\n195 10896\n195 11091\n69 11370\n69 11439\n109 11636\n41 11745\n41 11786\n125 11916\n125 12041\n352 12393\n312 12798\n209 13110\n209 13319\n13 13864\n13 13877\n237 141..."
},
{
"input": "3\n-1000000000 999999999 1000000000",
"output": "1999999999 2000000000\n1 1999999999\n1 2000000000"
}
] | 1,643,463,324
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 451
| 8,089,600
|
import math
def main():
# t = int(input())
# for _ in range(t):
(case())
def case():
n = int(input())
a = list(map(int, input().split()))
print(f'{abs(a[0]-a[1])} {abs(a[0]-a[-1])}')
for i in range(1, n-1):
head = a[0]
tail = a[-1]
print(min(abs(a[i]-a[i+1]), abs(a[i]-a[i-1])), end=' ')
print(max(abs(a[i]-head), abs(a[i]-tail)))
print(f'{abs(a[-1]-a[-2])} {abs(a[-1]-a[0])}')
main()
|
Title: Lineland Mail
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
Output Specification:
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
Demo Input:
['4\n-5 -2 2 7\n', '2\n-1 1\n']
Demo Output:
['3 12\n3 9\n4 7\n5 12\n', '2 2\n2 2\n']
Note:
none
|
```python
import math
def main():
# t = int(input())
# for _ in range(t):
(case())
def case():
n = int(input())
a = list(map(int, input().split()))
print(f'{abs(a[0]-a[1])} {abs(a[0]-a[-1])}')
for i in range(1, n-1):
head = a[0]
tail = a[-1]
print(min(abs(a[i]-a[i+1]), abs(a[i]-a[i-1])), end=' ')
print(max(abs(a[i]-head), abs(a[i]-tail)))
print(f'{abs(a[-1]-a[-2])} {abs(a[-1]-a[0])}')
main()
```
| 3
|
|
148
|
A
|
Insomnia cure
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
|
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
|
Output the number of damaged dragons.
|
[
"1\n2\n3\n4\n12\n",
"2\n3\n4\n5\n24\n"
] |
[
"12\n",
"17\n"
] |
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
| 1,000
|
[
{
"input": "1\n2\n3\n4\n12",
"output": "12"
},
{
"input": "2\n3\n4\n5\n24",
"output": "17"
},
{
"input": "1\n1\n1\n1\n100000",
"output": "100000"
},
{
"input": "10\n9\n8\n7\n6",
"output": "0"
},
{
"input": "8\n4\n4\n3\n65437",
"output": "32718"
},
{
"input": "8\n4\n1\n10\n59392",
"output": "59392"
},
{
"input": "4\n1\n8\n7\n44835",
"output": "44835"
},
{
"input": "6\n1\n7\n2\n62982",
"output": "62982"
},
{
"input": "2\n7\n4\n9\n56937",
"output": "35246"
},
{
"input": "2\n9\n8\n1\n75083",
"output": "75083"
},
{
"input": "8\n7\n7\n6\n69038",
"output": "24656"
},
{
"input": "4\n4\n2\n3\n54481",
"output": "36320"
},
{
"input": "6\n4\n9\n8\n72628",
"output": "28244"
},
{
"input": "9\n7\n8\n10\n42357",
"output": "16540"
},
{
"input": "5\n6\n4\n3\n60504",
"output": "36302"
},
{
"input": "7\n2\n3\n8\n21754",
"output": "15539"
},
{
"input": "1\n2\n10\n4\n39901",
"output": "39901"
},
{
"input": "3\n4\n7\n1\n58048",
"output": "58048"
},
{
"input": "9\n10\n4\n6\n52003",
"output": "21956"
},
{
"input": "5\n10\n9\n3\n70149",
"output": "32736"
},
{
"input": "5\n5\n5\n10\n55592",
"output": "11118"
},
{
"input": "1\n5\n2\n6\n49547",
"output": "49547"
},
{
"input": "3\n7\n7\n7\n84046",
"output": "36019"
},
{
"input": "10\n2\n1\n8\n63537",
"output": "63537"
},
{
"input": "7\n2\n10\n5\n81684",
"output": "53678"
},
{
"input": "7\n1\n6\n8\n99831",
"output": "99831"
},
{
"input": "3\n9\n3\n3\n61082",
"output": "20360"
},
{
"input": "5\n5\n8\n9\n79228",
"output": "29931"
},
{
"input": "1\n5\n5\n6\n89535",
"output": "89535"
},
{
"input": "5\n5\n2\n1\n7682",
"output": "7682"
},
{
"input": "7\n4\n8\n8\n25829",
"output": "9224"
},
{
"input": "3\n4\n3\n3\n87079",
"output": "43539"
},
{
"input": "5\n8\n4\n9\n5226",
"output": "2438"
},
{
"input": "4\n9\n6\n6\n1070",
"output": "415"
},
{
"input": "10\n10\n10\n10\n100000",
"output": "10000"
},
{
"input": "1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "10\n10\n10\n10\n1",
"output": "0"
},
{
"input": "10\n10\n1\n10\n10",
"output": "10"
},
{
"input": "10\n10\n1\n10\n100",
"output": "100"
},
{
"input": "2\n2\n2\n2\n1",
"output": "0"
}
] | 1,698,689,846
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 154
| 11,776,000
|
k=int(input())
l=int(input())
m=int(input())
n=int(input())
d=int(input())
if k==1 or l==1 or m==1 or n==1:
print(d)
else:
di={}
escaped=0
for i in range(1,d+1):
di[i]=0
for j in range(k,d+1,k):
di[j]=1
for j in range(l,d+1,l):
di[j]=1
for j in range(m,d+1,m):
di[j]=1
for j in range(n,d+1,n):
di[j]=1
for i in range(1,d+1):
if di[i]==0:
escaped+=1
print(d-escaped)
|
Title: Insomnia cure
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input Specification:
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output Specification:
Output the number of damaged dragons.
Demo Input:
['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n']
Demo Output:
['12\n', '17\n']
Note:
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
|
```python
k=int(input())
l=int(input())
m=int(input())
n=int(input())
d=int(input())
if k==1 or l==1 or m==1 or n==1:
print(d)
else:
di={}
escaped=0
for i in range(1,d+1):
di[i]=0
for j in range(k,d+1,k):
di[j]=1
for j in range(l,d+1,l):
di[j]=1
for j in range(m,d+1,m):
di[j]=1
for j in range(n,d+1,n):
di[j]=1
for i in range(1,d+1):
if di[i]==0:
escaped+=1
print(d-escaped)
```
| 3
|
|
733
|
A
|
Grasshopper And the String
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
|
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
|
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
|
[
"ABABBBACFEYUKOTT\n",
"AAA\n"
] |
[
"4",
"1"
] |
none
| 500
|
[
{
"input": "ABABBBACFEYUKOTT",
"output": "4"
},
{
"input": "AAA",
"output": "1"
},
{
"input": "A",
"output": "1"
},
{
"input": "B",
"output": "2"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIKLMJNHGTRWSDZXCVBNMHGFDSXVWRTPPPLKMNBXIUOIUOIUOIUOOIU",
"output": "39"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIAEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOI",
"output": "1"
},
{
"input": "KMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVCKMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVC",
"output": "85"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZ",
"output": "18"
},
{
"input": "PKLKBWTXVJ",
"output": "11"
},
{
"input": "CFHFPTGMOKXVLJJZJDQW",
"output": "12"
},
{
"input": "TXULTFSBUBFLRNQORMMULWNVLPWTYJXZBPBGAWNX",
"output": "9"
},
{
"input": "DAIUSEAUEUYUWEIOOEIOUYVYYOPEEWEBZOOOAOXUOIEUKYYOJOYAUYUUIYUXOUJLGIYEIIYUOCUAACRY",
"output": "4"
},
{
"input": "VRPHBNWNWVWBWMFJJDCTJQJDJBKSJRZLVQRVVFLTZFSGCGDXCWQVWWWMFVCQHPKXXVRKTGWGPSMQTPKNDQJHNSKLXPCXDJDQDZZD",
"output": "101"
},
{
"input": "SGDDFCDRDWGPNNFBBZZJSPXFYMZKPRXTCHVJSJJBWZXXQMDZBNKDHRGSRLGLRKPMWXNSXJPNJLDPXBSRCQMHJKPZNTPNTZXNPCJC",
"output": "76"
},
{
"input": "NVTQVNLGWFDBCBKSDLTBGWBMNQZWZQJWNGVCTCQBGWNTYJRDBPZJHXCXFMIXNRGSTXHQPCHNFQPCMDZWJGLJZWMRRFCVLBKDTDSC",
"output": "45"
},
{
"input": "SREZXQFVPQCLRCQGMKXCBRWKYZKWKRMZGXPMKWNMFZTRDPHJFCSXVPPXWKZMZTBFXGNLPLHZIPLFXNRRQFDTLFPKBGCXKTMCFKKT",
"output": "48"
},
{
"input": "ICKJKMVPDNZPLKDSLTPZNRLSQSGHQJQQPJJSNHNWVDLJRLZEJSXZDPHYXGGWXHLCTVQSKWNWGTLJMOZVJNZPVXGVPJKHFVZTGCCX",
"output": "47"
},
{
"input": "XXFPZDRPXLNHGDVCBDKJMKLGUQZXLLWYLOKFZVGXVNPJWZZZNRMQBRJCZTSDRHSNCVDMHKVXCXPCRBWSJCJWDRDPVZZLCZRTDRYA",
"output": "65"
},
{
"input": "HDDRZDKCHHHEDKHZMXQSNQGSGNNSCCPVJFGXGNCEKJMRKSGKAPQWPCWXXWHLSMRGSJWEHWQCSJJSGLQJXGVTBYALWMLKTTJMFPFS",
"output": "28"
},
{
"input": "PXVKJHXVDPWGLHWFWMJPMCCNHCKSHCPZXGIHHNMYNFQBUCKJJTXXJGKRNVRTQFDFMLLGPQKFOVNNLTNDIEXSARRJKGSCZKGGJCBW",
"output": "35"
},
{
"input": "EXNMTTFPJLDHXDQBJJRDRYBZVFFHUDCHCPNFZWXSMZXNFVJGHZWXVBRQFNUIDVLZOVPXQNVMFNBTJDSCKRLNGXPSADTGCAHCBJKL",
"output": "30"
},
{
"input": "NRNLSQQJGIJBCZFTNKJCXMGPARGWXPSHZXOBNSFOLDQVXTVAGJZNLXULHBRDGMNQKQGWMRRDPYCSNFVPUFTFBUBRXVJGNGSPJKLL",
"output": "19"
},
{
"input": "SRHOKCHQQMVZKTCVQXJJCFGYFXGMBZSZFNAFETXILZHPGHBWZRZQFMGSEYRUDVMCIQTXTBTSGFTHRRNGNTHHWWHCTDFHSVARMCMB",
"output": "30"
},
{
"input": "HBSVZHDKGNIRQUBYKYHUPJCEETGFMVBZJTHYHFQPFBVBSMQACYAVWZXSBGNKWXFNMQJFMSCHJVWBZXZGSNBRUHTHAJKVLEXFBOFB",
"output": "34"
},
{
"input": "NXKMUGOPTUQNSRYTKUKSCWCRQSZKKFPYUMDIBJAHJCEKZJVWZAWOLOEFBFXLQDDPNNZKCQHUPBFVDSXSUCVLMZXQROYQYIKPQPWR",
"output": "17"
},
{
"input": "TEHJDICFNOLQVQOAREVAGUAWODOCXJXIHYXFAEPEXRHPKEIIRCRIVASKNTVYUYDMUQKSTSSBYCDVZKDDHTSDWJWACPCLYYOXGCLT",
"output": "15"
},
{
"input": "LCJJUZZFEIUTMSEXEYNOOAIZMORQDOANAMUCYTFRARDCYHOYOPHGGYUNOGNXUAOYSEMXAZOOOFAVHQUBRNGORSPNQWZJYQQUNPEB",
"output": "9"
},
{
"input": "UUOKAOOJBXUTSMOLOOOOSUYYFTAVBNUXYFVOOGCGZYQEOYISIYOUULUAIJUYVVOENJDOCLHOSOHIHDEJOIGZNIXEMEGZACHUAQFW",
"output": "5"
},
{
"input": "OUUBEHXOOURMOAIAEHXCUOIYHUJEVAWYRCIIAGDRIPUIPAIUYAIWJEVYEYYUYBYOGVYESUJCFOJNUAHIOOKBUUHEJFEWPOEOUHYA",
"output": "4"
},
{
"input": "EMNOYEEUIOUHEWZITIAEZNCJUOUAOQEAUYEIHYUSUYUUUIAEDIOOERAEIRBOJIEVOMECOGAIAIUIYYUWYIHIOWVIJEYUEAFYULSE",
"output": "5"
},
{
"input": "BVOYEAYOIEYOREJUYEUOEOYIISYAEOUYAAOIOEOYOOOIEFUAEAAESUOOIIEUAAGAEISIAPYAHOOEYUJHUECGOYEIDAIRTBHOYOYA",
"output": "5"
},
{
"input": "GOIEOAYIEYYOOEOAIAEOOUWYEIOTNYAANAYOOXEEOEAVIOIAAIEOIAUIAIAAUEUAOIAEUOUUZYIYAIEUEGOOOOUEIYAEOSYAEYIO",
"output": "3"
},
{
"input": "AUEAOAYIAOYYIUIOAULIOEUEYAIEYYIUOEOEIEYRIYAYEYAEIIMMAAEAYAAAAEOUICAUAYOUIAOUIAIUOYEOEEYAEYEYAAEAOYIY",
"output": "3"
},
{
"input": "OAIIYEYYAOOEIUOEEIOUOIAEFIOAYETUYIOAAAEYYOYEYOEAUIIUEYAYYIIAOIEEYGYIEAAOOWYAIEYYYIAOUUOAIAYAYYOEUEOY",
"output": "2"
},
{
"input": "EEEAOEOEEIOUUUEUEAAOEOIUYJEYAIYIEIYYEAUOIIYIUOOEUCYEOOOYYYIUUAYIAOEUEIEAOUOIAACAOOUAUIYYEAAAOOUYIAAE",
"output": "2"
},
{
"input": "AYEYIIEUIYOYAYEUEIIIEUYUUAUEUIYAIAAUYONIEYIUIAEUUOUOYYOUUUIUIAEYEOUIIUOUUEOAIUUYAAEOAAEOYUUIYAYRAIII",
"output": "2"
},
{
"input": "YOOAAUUAAAYEUYIUIUYIUOUAEIEEIAUEOAUIIAAIUYEUUOYUIYEAYAAAYUEEOEEAEOEEYYOUAEUYEEAIIYEUEYJOIIYUIOIUOIEE",
"output": "2"
},
{
"input": "UYOIIIAYOOAIUUOOEEUYIOUAEOOEIOUIAIEYOAEAIOOEOOOIUYYUYIAAUIOUYYOOUAUIEYYUOAAUUEAAIEUIAUEUUIAUUOYOAYIU",
"output": "1"
},
{
"input": "ABBABBB",
"output": "4"
},
{
"input": "ABCD",
"output": "4"
},
{
"input": "XXYC",
"output": "3"
},
{
"input": "YYY",
"output": "1"
},
{
"input": "ABABBBBBBB",
"output": "8"
},
{
"input": "YYYY",
"output": "1"
},
{
"input": "YYYYY",
"output": "1"
},
{
"input": "AXXX",
"output": "4"
},
{
"input": "YYYYYYY",
"output": "1"
},
{
"input": "BYYBBB",
"output": "4"
},
{
"input": "YYYYYYYYY",
"output": "1"
},
{
"input": "CAAAAA",
"output": "2"
},
{
"input": "CCCACCCC",
"output": "5"
},
{
"input": "ABABBBACFEYUKOTTTT",
"output": "5"
},
{
"input": "AABBYYYYYYYY",
"output": "3"
},
{
"input": "BYBACYC",
"output": "2"
},
{
"input": "Y",
"output": "1"
},
{
"input": "ABBBBBB",
"output": "7"
},
{
"input": "BACDYDI",
"output": "3"
},
{
"input": "XEXXXXXXXXXXXXXXX",
"output": "16"
},
{
"input": "TTYTT",
"output": "3"
},
{
"input": "AAYBC",
"output": "3"
},
{
"input": "ABABBBACFEYUKOTTTTT",
"output": "6"
},
{
"input": "YYAYY",
"output": "1"
},
{
"input": "YZZY",
"output": "3"
},
{
"input": "YY",
"output": "1"
},
{
"input": "ZZYZZ",
"output": "3"
},
{
"input": "YBBBY",
"output": "4"
},
{
"input": "BBBACCCCCCC",
"output": "8"
},
{
"input": "YBBBBY",
"output": "5"
},
{
"input": "YYYYYYYYYY",
"output": "1"
},
{
"input": "ABABBBBBBBBBBBB",
"output": "13"
}
] | 1,655,550,376
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 70
| 93
| 0
|
def solve(s:str):
a=[]
vowels=['A','E','I','O','U','Y']
flag=False
for i in range(0,len(s)):
if s[i] in vowels:
flag=True
a.append(i)
a.insert(0,-1)
a.append(len(s))
m=-1
if not flag:
print(len(s)+1)
else:
for i in range(1,len(a)):
#print(a[i])
if(m<(a[i]-a[i-1])):
m=a[i]-a[i-1]
print(m)
if __name__=='__main__':
s=input()
solve(s)
|
Title: Grasshopper And the String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
Input Specification:
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
Output Specification:
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
Demo Input:
['ABABBBACFEYUKOTT\n', 'AAA\n']
Demo Output:
['4', '1']
Note:
none
|
```python
def solve(s:str):
a=[]
vowels=['A','E','I','O','U','Y']
flag=False
for i in range(0,len(s)):
if s[i] in vowels:
flag=True
a.append(i)
a.insert(0,-1)
a.append(len(s))
m=-1
if not flag:
print(len(s)+1)
else:
for i in range(1,len(a)):
#print(a[i])
if(m<(a[i]-a[i-1])):
m=a[i]-a[i-1]
print(m)
if __name__=='__main__':
s=input()
solve(s)
```
| 3
|
|
489
|
B
|
BerSU Ball
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"dp",
"graph matchings",
"greedy",
"sortings",
"two pointers"
] | null | null |
The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves.
We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one.
For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill.
Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill.
|
Print a single number — the required maximum possible number of pairs.
|
[
"4\n1 4 6 2\n5\n5 1 5 7 9\n",
"4\n1 2 3 4\n4\n10 11 12 13\n",
"5\n1 1 1 1 1\n3\n1 2 3\n"
] |
[
"3\n",
"0\n",
"2\n"
] |
none
| 1,000
|
[
{
"input": "4\n1 4 6 2\n5\n5 1 5 7 9",
"output": "3"
},
{
"input": "4\n1 2 3 4\n4\n10 11 12 13",
"output": "0"
},
{
"input": "5\n1 1 1 1 1\n3\n1 2 3",
"output": "2"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 10\n1\n9",
"output": "1"
},
{
"input": "4\n4 5 4 4\n5\n5 3 4 2 4",
"output": "4"
},
{
"input": "1\n2\n1\n1",
"output": "1"
},
{
"input": "1\n3\n2\n3 2",
"output": "1"
},
{
"input": "1\n4\n3\n4 4 4",
"output": "1"
},
{
"input": "1\n2\n4\n3 1 4 2",
"output": "1"
},
{
"input": "1\n4\n5\n2 5 5 3 1",
"output": "1"
},
{
"input": "2\n2 2\n1\n2",
"output": "1"
},
{
"input": "2\n4 2\n2\n4 4",
"output": "1"
},
{
"input": "2\n4 1\n3\n2 3 2",
"output": "2"
},
{
"input": "2\n4 3\n4\n5 5 5 6",
"output": "1"
},
{
"input": "2\n5 7\n5\n4 6 7 2 5",
"output": "2"
},
{
"input": "3\n1 2 3\n1\n1",
"output": "1"
},
{
"input": "3\n5 4 5\n2\n2 1",
"output": "0"
},
{
"input": "3\n6 3 4\n3\n4 5 2",
"output": "3"
},
{
"input": "3\n7 7 7\n4\n2 7 2 4",
"output": "1"
},
{
"input": "3\n1 3 3\n5\n1 3 4 1 2",
"output": "3"
},
{
"input": "4\n1 2 1 3\n1\n4",
"output": "1"
},
{
"input": "4\n4 4 6 6\n2\n2 1",
"output": "0"
},
{
"input": "4\n3 1 1 1\n3\n1 6 7",
"output": "1"
},
{
"input": "4\n2 5 1 2\n4\n2 3 3 1",
"output": "3"
},
{
"input": "4\n9 1 7 1\n5\n9 9 9 8 4",
"output": "2"
},
{
"input": "5\n1 6 5 5 6\n1\n2",
"output": "1"
},
{
"input": "5\n5 2 4 5 6\n2\n7 4",
"output": "2"
},
{
"input": "5\n4 1 3 1 4\n3\n6 3 6",
"output": "1"
},
{
"input": "5\n5 2 3 1 4\n4\n1 3 1 7",
"output": "3"
},
{
"input": "5\n9 8 10 9 10\n5\n2 1 5 4 6",
"output": "0"
},
{
"input": "1\n48\n100\n76 90 78 44 29 30 35 85 98 38 27 71 51 100 15 98 78 45 85 26 48 66 98 71 45 85 83 77 92 17 23 95 98 43 11 15 39 53 71 25 74 53 77 41 39 35 66 4 92 44 44 55 35 87 91 6 44 46 57 24 46 82 15 44 81 40 65 17 64 24 42 52 13 12 64 82 26 7 66 85 93 89 58 92 92 77 37 91 47 73 35 69 31 22 60 60 97 21 52 6",
"output": "1"
},
{
"input": "100\n9 90 66 62 60 9 10 97 47 73 26 81 97 60 80 84 19 4 25 77 19 17 91 12 1 27 15 54 18 45 71 79 96 90 51 62 9 13 92 34 7 52 55 8 16 61 96 12 52 38 50 9 60 3 30 3 48 46 77 64 90 35 16 16 21 42 67 70 23 19 90 14 50 96 98 92 82 62 7 51 93 38 84 82 37 78 99 3 20 69 44 96 94 71 3 55 27 86 92 82\n1\n58",
"output": "0"
},
{
"input": "10\n20 87 3 39 20 20 8 40 70 51\n100\n69 84 81 84 35 97 69 68 63 97 85 80 95 58 70 91 100 65 72 80 41 87 87 87 22 49 96 96 78 96 97 56 90 31 62 98 89 74 100 86 95 88 66 54 93 62 41 60 95 79 29 69 63 70 52 63 87 58 54 52 48 57 26 75 39 61 98 78 52 73 99 49 74 50 59 90 31 97 16 85 63 72 81 68 75 59 70 67 73 92 10 88 57 95 3 71 80 95 84 96",
"output": "6"
},
{
"input": "100\n10 10 9 18 56 64 92 66 54 42 66 65 58 5 74 68 80 57 58 30 58 69 70 13 38 19 34 63 38 17 26 24 66 83 48 77 44 37 78 97 13 90 51 56 60 23 49 32 14 86 90 100 13 14 52 69 85 95 81 53 5 3 91 66 2 64 45 59 7 30 80 42 61 82 70 10 62 82 5 34 50 28 24 47 85 68 27 50 24 61 76 17 63 24 3 67 83 76 42 60\n10\n66 74 40 67 28 82 99 57 93 64",
"output": "9"
},
{
"input": "100\n4 1 1 1 3 3 2 5 1 2 1 2 1 1 1 6 1 3 1 1 1 1 2 4 1 1 4 2 2 8 2 2 1 8 2 4 3 3 8 1 3 2 3 2 1 3 8 2 2 3 1 1 2 2 5 1 4 3 1 1 3 1 3 1 7 1 1 1 3 2 1 2 2 3 7 2 1 4 3 2 1 1 3 4 1 1 3 5 1 8 4 1 1 1 3 10 2 2 1 2\n100\n1 1 5 2 13 2 2 3 6 12 1 13 8 1 1 16 1 1 5 6 2 4 6 4 2 7 4 1 7 3 3 9 5 3 1 7 4 1 6 6 8 2 2 5 2 3 16 3 6 3 8 6 1 8 1 2 6 5 3 4 11 3 4 8 2 13 2 5 2 7 3 3 1 8 1 4 4 2 4 7 7 1 5 7 6 3 6 9 1 1 1 3 1 11 5 2 5 11 13 1",
"output": "76"
},
{
"input": "4\n1 6 9 15\n2\n5 8",
"output": "2"
},
{
"input": "2\n2 4\n2\n3 1",
"output": "2"
},
{
"input": "3\n2 3 5\n3\n3 4 6",
"output": "3"
},
{
"input": "3\n1 3 4\n3\n2 1 5",
"output": "3"
},
{
"input": "2\n5 5\n4\n1 1 1 5",
"output": "1"
},
{
"input": "2\n3 2\n2\n3 4",
"output": "2"
},
{
"input": "2\n3 1\n2\n2 4",
"output": "2"
},
{
"input": "2\n2 3\n2\n2 1",
"output": "2"
},
{
"input": "2\n10 12\n2\n11 9",
"output": "2"
},
{
"input": "3\n1 2 3\n3\n3 2 1",
"output": "3"
},
{
"input": "2\n1 3\n2\n2 1",
"output": "2"
},
{
"input": "2\n4 5\n2\n5 3",
"output": "2"
},
{
"input": "2\n7 5\n2\n6 8",
"output": "2"
},
{
"input": "4\n4 3 2 1\n4\n1 2 3 4",
"output": "4"
},
{
"input": "2\n2 3\n2\n3 1",
"output": "2"
},
{
"input": "2\n2 4\n3\n3 1 8",
"output": "2"
},
{
"input": "3\n3 1 1\n3\n2 4 4",
"output": "2"
},
{
"input": "2\n5 3\n2\n4 6",
"output": "2"
},
{
"input": "4\n1 1 3 3\n4\n2 2 1 1",
"output": "4"
},
{
"input": "3\n3 2 1\n3\n2 4 3",
"output": "3"
},
{
"input": "5\n1 2 3 4 5\n5\n2 3 4 5 1",
"output": "5"
},
{
"input": "3\n3 2 1\n3\n1 2 3",
"output": "3"
},
{
"input": "2\n5 4\n2\n4 6",
"output": "2"
},
{
"input": "4\n3 3 5 5\n4\n4 4 2 2",
"output": "4"
},
{
"input": "3\n2 7 5\n3\n2 4 8",
"output": "3"
},
{
"input": "100\n2 3 3 4 2 1 4 4 5 5 2 1 5 2 3 3 5 4 3 2 4 2 3 3 2 2 3 4 2 2 2 3 1 2 3 2 2 3 5 3 3 3 3 4 5 2 2 1 1 1 3 1 2 2 3 5 5 2 5 1 3 4 5 3 5 4 1 1 2 3 4 4 5 3 2 4 5 5 5 2 1 4 2 4 5 4 4 5 5 3 2 5 1 4 4 2 2 2 5 3\n100\n4 5 3 3 2 2 4 3 1 5 4 3 3 2 2 4 5 2 5 2 1 4 3 4 2 3 5 3 4 4 1 2 3 5 2 2 1 5 4 2 4 3 4 3 4 2 3 1 3 3 4 1 1 1 4 4 5 3 1 4 2 3 2 1 3 3 2 3 2 1 1 2 3 2 1 3 3 4 3 3 1 1 3 3 3 1 1 3 5 3 3 3 3 4 4 5 2 5 4 5",
"output": "100"
},
{
"input": "1\n3\n2\n2 3",
"output": "1"
},
{
"input": "2\n5 6\n3\n1 5 100",
"output": "1"
},
{
"input": "2\n2 7\n2\n6 8",
"output": "1"
},
{
"input": "4\n4 10 15 17\n4\n3 12 16 16",
"output": "3"
},
{
"input": "2\n2 3\n2\n1 2",
"output": "2"
}
] | 1,687,093,972
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 81
| 77
| 1,638,400
|
import bisect
left = lambda l,a : bisect.bisect_left(l,a) #returns index of value>=a
right = lambda l,a : bisect.bisect_right(l,a) #returns index of value >a
import sys
def input(): return sys.stdin.readline().strip()
def getints(): return map(int,sys.stdin.readline().strip().split())
n = int(input())
b = sorted(getints())
m = int(input())
g = sorted(getints())
ans = 0
j = 0
for i in b:
for j in g:
if abs(i-j) <= 1:
ans += 1
g.remove(j)
break
print(ans)
|
Title: BerSU Ball
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves.
We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one.
For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill.
Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill.
Output Specification:
Print a single number — the required maximum possible number of pairs.
Demo Input:
['4\n1 4 6 2\n5\n5 1 5 7 9\n', '4\n1 2 3 4\n4\n10 11 12 13\n', '5\n1 1 1 1 1\n3\n1 2 3\n']
Demo Output:
['3\n', '0\n', '2\n']
Note:
none
|
```python
import bisect
left = lambda l,a : bisect.bisect_left(l,a) #returns index of value>=a
right = lambda l,a : bisect.bisect_right(l,a) #returns index of value >a
import sys
def input(): return sys.stdin.readline().strip()
def getints(): return map(int,sys.stdin.readline().strip().split())
n = int(input())
b = sorted(getints())
m = int(input())
g = sorted(getints())
ans = 0
j = 0
for i in b:
for j in g:
if abs(i-j) <= 1:
ans += 1
g.remove(j)
break
print(ans)
```
| 3
|
|
799
|
A
|
Carrot Cakes
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
|
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
|
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
|
[
"8 6 4 5\n",
"8 6 4 6\n",
"10 3 11 4\n",
"4 2 1 4\n"
] |
[
"YES\n",
"NO\n",
"NO\n",
"YES\n"
] |
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven.
| 500
|
[
{
"input": "8 6 4 5",
"output": "YES"
},
{
"input": "8 6 4 6",
"output": "NO"
},
{
"input": "10 3 11 4",
"output": "NO"
},
{
"input": "4 2 1 4",
"output": "YES"
},
{
"input": "28 17 16 26",
"output": "NO"
},
{
"input": "60 69 9 438",
"output": "NO"
},
{
"input": "599 97 54 992",
"output": "YES"
},
{
"input": "11 22 18 17",
"output": "NO"
},
{
"input": "1 13 22 11",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "NO"
},
{
"input": "3 1 1 1",
"output": "YES"
},
{
"input": "1000 1000 1000 1000",
"output": "NO"
},
{
"input": "1000 1000 1 1",
"output": "YES"
},
{
"input": "1000 1000 1 400",
"output": "YES"
},
{
"input": "1000 1000 1 1000",
"output": "YES"
},
{
"input": "1000 1000 1 999",
"output": "YES"
},
{
"input": "53 11 3 166",
"output": "YES"
},
{
"input": "313 2 3 385",
"output": "NO"
},
{
"input": "214 9 9 412",
"output": "NO"
},
{
"input": "349 9 5 268",
"output": "YES"
},
{
"input": "611 16 8 153",
"output": "YES"
},
{
"input": "877 13 3 191",
"output": "YES"
},
{
"input": "340 9 9 10",
"output": "YES"
},
{
"input": "31 8 2 205",
"output": "NO"
},
{
"input": "519 3 2 148",
"output": "YES"
},
{
"input": "882 2 21 219",
"output": "NO"
},
{
"input": "982 13 5 198",
"output": "YES"
},
{
"input": "428 13 6 272",
"output": "YES"
},
{
"input": "436 16 14 26",
"output": "YES"
},
{
"input": "628 10 9 386",
"output": "YES"
},
{
"input": "77 33 18 31",
"output": "YES"
},
{
"input": "527 36 4 8",
"output": "YES"
},
{
"input": "128 18 2 169",
"output": "YES"
},
{
"input": "904 4 2 288",
"output": "YES"
},
{
"input": "986 4 3 25",
"output": "YES"
},
{
"input": "134 8 22 162",
"output": "NO"
},
{
"input": "942 42 3 69",
"output": "YES"
},
{
"input": "894 4 9 4",
"output": "YES"
},
{
"input": "953 8 10 312",
"output": "YES"
},
{
"input": "43 8 1 121",
"output": "YES"
},
{
"input": "12 13 19 273",
"output": "NO"
},
{
"input": "204 45 10 871",
"output": "YES"
},
{
"input": "342 69 50 425",
"output": "NO"
},
{
"input": "982 93 99 875",
"output": "NO"
},
{
"input": "283 21 39 132",
"output": "YES"
},
{
"input": "1000 45 83 686",
"output": "NO"
},
{
"input": "246 69 36 432",
"output": "NO"
},
{
"input": "607 93 76 689",
"output": "NO"
},
{
"input": "503 21 24 435",
"output": "NO"
},
{
"input": "1000 45 65 989",
"output": "NO"
},
{
"input": "30 21 2 250",
"output": "YES"
},
{
"input": "1000 49 50 995",
"output": "NO"
},
{
"input": "383 69 95 253",
"output": "YES"
},
{
"input": "393 98 35 999",
"output": "YES"
},
{
"input": "1000 22 79 552",
"output": "NO"
},
{
"input": "268 294 268 154",
"output": "NO"
},
{
"input": "963 465 706 146",
"output": "YES"
},
{
"input": "304 635 304 257",
"output": "NO"
},
{
"input": "4 2 1 6",
"output": "NO"
},
{
"input": "1 51 10 50",
"output": "NO"
},
{
"input": "5 5 4 4",
"output": "YES"
},
{
"input": "3 2 1 1",
"output": "YES"
},
{
"input": "3 4 3 3",
"output": "NO"
},
{
"input": "7 3 4 1",
"output": "YES"
},
{
"input": "101 10 1 1000",
"output": "NO"
},
{
"input": "5 1 1 1",
"output": "YES"
},
{
"input": "5 10 5 5",
"output": "NO"
},
{
"input": "19 1 7 1",
"output": "YES"
},
{
"input": "763 572 745 262",
"output": "YES"
},
{
"input": "1 2 1 1",
"output": "NO"
},
{
"input": "5 1 1 3",
"output": "YES"
},
{
"input": "170 725 479 359",
"output": "NO"
},
{
"input": "6 2 1 7",
"output": "YES"
},
{
"input": "6 2 5 1",
"output": "YES"
},
{
"input": "1 2 2 1",
"output": "NO"
},
{
"input": "24 2 8 3",
"output": "YES"
},
{
"input": "7 3 3 3",
"output": "YES"
},
{
"input": "5 2 2 2",
"output": "YES"
},
{
"input": "3 2 1 2",
"output": "YES"
},
{
"input": "1000 2 200 8",
"output": "NO"
},
{
"input": "3 100 2 100",
"output": "NO"
},
{
"input": "2 999 1 1000",
"output": "NO"
},
{
"input": "2 1 1 1",
"output": "NO"
},
{
"input": "2 3 5 1",
"output": "NO"
},
{
"input": "100 1 5 1",
"output": "YES"
},
{
"input": "7 2 3 3",
"output": "YES"
},
{
"input": "4 1 1 3",
"output": "NO"
},
{
"input": "3 2 2 1",
"output": "YES"
},
{
"input": "1 1 1 2",
"output": "NO"
},
{
"input": "91 8 7 13",
"output": "YES"
},
{
"input": "3 1 2 1",
"output": "NO"
},
{
"input": "5 3 2 3",
"output": "YES"
},
{
"input": "9 6 6 3",
"output": "YES"
}
] | 1,629,720,841
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 93
| 311
| 6,963,200
|
import math
n,t,k,d=map(int,input().split())
x=math.ceil(n/k)*t
y,i=0,1
while n>0:
if i%t==0:
y=i
n-=k
# print(y,n)
if (i-d)>0 and (i-d)%t==0 and i!=d:
y=i
n-=k
# print(y,n)
i+=1
if y<x:
print("YES")
else:
print("NO")
|
Title: Carrot Cakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
Input Specification:
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
Output Specification:
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
Demo Input:
['8 6 4 5\n', '8 6 4 6\n', '10 3 11 4\n', '4 2 1 4\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n', 'YES\n']
Note:
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven.
|
```python
import math
n,t,k,d=map(int,input().split())
x=math.ceil(n/k)*t
y,i=0,1
while n>0:
if i%t==0:
y=i
n-=k
# print(y,n)
if (i-d)>0 and (i-d)%t==0 and i!=d:
y=i
n-=k
# print(y,n)
i+=1
if y<x:
print("YES")
else:
print("NO")
```
| 3
|
|
761
|
A
|
Dasha and Stairs
|
PROGRAMMING
| 1,000
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
|
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
|
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
|
[
"2 3\n",
"3 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
| 500
|
[
{
"input": "2 3",
"output": "YES"
},
{
"input": "3 1",
"output": "NO"
},
{
"input": "5 4",
"output": "YES"
},
{
"input": "9 9",
"output": "YES"
},
{
"input": "85 95",
"output": "NO"
},
{
"input": "0 1",
"output": "YES"
},
{
"input": "89 25",
"output": "NO"
},
{
"input": "74 73",
"output": "YES"
},
{
"input": "62 39",
"output": "NO"
},
{
"input": "57 57",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "0 0",
"output": "NO"
},
{
"input": "98 100",
"output": "NO"
},
{
"input": "99 100",
"output": "YES"
},
{
"input": "1 0",
"output": "YES"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "0 100",
"output": "NO"
},
{
"input": "100 98",
"output": "NO"
},
{
"input": "100 100",
"output": "YES"
},
{
"input": "0 5",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
}
] | 1,486,239,897
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 77
| 4,608,000
|
string=input()
a,b=map(int,string.split(' '))
if a==0 and b==0:
print('NO')
elif a-b==1 or b-a==1:
print('YES')
elif a==b:
print('YES')
else:
print('NO')
|
Title: Dasha and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
Input Specification:
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
Output Specification:
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
Demo Input:
['2 3\n', '3 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
|
```python
string=input()
a,b=map(int,string.split(' '))
if a==0 and b==0:
print('NO')
elif a-b==1 or b-a==1:
print('YES')
elif a==b:
print('YES')
else:
print('NO')
```
| 3
|
|
552
|
B
|
Vanya and Books
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
|
Print the number of digits needed to number all the books.
|
[
"13\n",
"4\n"
] |
[
"17\n",
"4\n"
] |
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits.
| 1,000
|
[
{
"input": "13",
"output": "17"
},
{
"input": "4",
"output": "4"
},
{
"input": "100",
"output": "192"
},
{
"input": "99",
"output": "189"
},
{
"input": "1000000000",
"output": "8888888899"
},
{
"input": "1000000",
"output": "5888896"
},
{
"input": "999",
"output": "2889"
},
{
"input": "55",
"output": "101"
},
{
"input": "222222222",
"output": "1888888896"
},
{
"input": "8",
"output": "8"
},
{
"input": "13",
"output": "17"
},
{
"input": "313",
"output": "831"
},
{
"input": "1342",
"output": "4261"
},
{
"input": "30140",
"output": "139594"
},
{
"input": "290092",
"output": "1629447"
},
{
"input": "2156660",
"output": "13985516"
},
{
"input": "96482216",
"output": "760746625"
},
{
"input": "943006819",
"output": "8375950269"
},
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "7"
},
{
"input": "35",
"output": "61"
},
{
"input": "996",
"output": "2880"
},
{
"input": "6120",
"output": "23373"
},
{
"input": "30660",
"output": "142194"
},
{
"input": "349463",
"output": "1985673"
},
{
"input": "8171970",
"output": "56092686"
},
{
"input": "36123011",
"output": "277872985"
},
{
"input": "986747865",
"output": "8769619683"
},
{
"input": "9",
"output": "9"
},
{
"input": "10",
"output": "11"
},
{
"input": "11",
"output": "13"
},
{
"input": "101",
"output": "195"
},
{
"input": "1000",
"output": "2893"
},
{
"input": "1001",
"output": "2897"
},
{
"input": "9999",
"output": "38889"
},
{
"input": "10000",
"output": "38894"
},
{
"input": "10001",
"output": "38899"
},
{
"input": "99999",
"output": "488889"
},
{
"input": "100000",
"output": "488895"
},
{
"input": "100001",
"output": "488901"
},
{
"input": "999999",
"output": "5888889"
},
{
"input": "1000001",
"output": "5888903"
},
{
"input": "9999999",
"output": "68888889"
},
{
"input": "10000000",
"output": "68888897"
},
{
"input": "10000001",
"output": "68888905"
},
{
"input": "99999999",
"output": "788888889"
},
{
"input": "100000000",
"output": "788888898"
},
{
"input": "100000001",
"output": "788888907"
},
{
"input": "999999999",
"output": "8888888889"
},
{
"input": "95",
"output": "181"
},
{
"input": "995",
"output": "2877"
},
{
"input": "9995",
"output": "38873"
},
{
"input": "99995",
"output": "488869"
},
{
"input": "999999995",
"output": "8888888853"
},
{
"input": "999999998",
"output": "8888888880"
}
] | 1,537,648,847
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 124
| 0
|
ch=str(input())
n=int(ch)
res=0
if len(ch)>1:
for i in range(1,len(ch)):
res+=i*(10**i-10**(i-1))
res+=len(ch)*(n+1-10**(len(ch)-1))
print(res)
|
Title: Vanya and Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
Output Specification:
Print the number of digits needed to number all the books.
Demo Input:
['13\n', '4\n']
Demo Output:
['17\n', '4\n']
Note:
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits.
|
```python
ch=str(input())
n=int(ch)
res=0
if len(ch)>1:
for i in range(1,len(ch)):
res+=i*(10**i-10**(i-1))
res+=len(ch)*(n+1-10**(len(ch)-1))
print(res)
```
| 3
|
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integer — the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,695,582,784
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 29
| 62
| 0
|
inpa = input().split(' ')
inpb = input().split(' ')
counter = 0
for x in inpb:
if int(x) > int(inpa[1]):
counter += 2
else:
counter += 1
print(counter)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
|
```python
inpa = input().split(' ')
inpb = input().split(' ')
counter = 0
for x in inpb:
if int(x) > int(inpa[1]):
counter += 2
else:
counter += 1
print(counter)
```
| 3
|
|
366
|
A
|
Dima and Guards
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Nothing has changed since the last round. Dima and Inna still love each other and want to be together. They've made a deal with Seryozha and now they need to make a deal with the dorm guards...
There are four guardposts in Dima's dorm. Each post contains two guards (in Russia they are usually elderly women). You can bribe a guard by a chocolate bar or a box of juice. For each guard you know the minimum price of the chocolate bar she can accept as a gift and the minimum price of the box of juice she can accept as a gift. If a chocolate bar for some guard costs less than the minimum chocolate bar price for this guard is, or if a box of juice for some guard costs less than the minimum box of juice price for this guard is, then the guard doesn't accept such a gift.
In order to pass through a guardpost, one needs to bribe both guards.
The shop has an unlimited amount of juice and chocolate of any price starting with 1. Dima wants to choose some guardpost, buy one gift for each guard from the guardpost and spend exactly *n* rubles on it.
Help him choose a post through which he can safely sneak Inna or otherwise say that this is impossible. Mind you, Inna would be very sorry to hear that!
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=105) — the money Dima wants to spend. Then follow four lines describing the guardposts. Each line contains four integers *a*,<=*b*,<=*c*,<=*d* (1<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=105) — the minimum price of the chocolate and the minimum price of the juice for the first guard and the minimum price of the chocolate and the minimum price of the juice for the second guard, correspondingly.
|
In a single line of the output print three space-separated integers: the number of the guardpost, the cost of the first present and the cost of the second present. If there is no guardpost Dima can sneak Inna through at such conditions, print -1 in a single line.
The guardposts are numbered from 1 to 4 according to the order given in the input.
If there are multiple solutions, you can print any of them.
|
[
"10\n5 6 5 6\n6 6 7 7\n5 8 6 6\n9 9 9 9\n",
"10\n6 6 6 6\n7 7 7 7\n4 4 4 4\n8 8 8 8\n",
"5\n3 3 3 3\n3 3 3 3\n3 3 3 3\n3 3 3 3\n"
] |
[
"1 5 5\n",
"3 4 6\n",
"-1\n"
] |
Explanation of the first example.
The only way to spend 10 rubles to buy the gifts that won't be less than the minimum prices is to buy two 5 ruble chocolates to both guards from the first guardpost.
Explanation of the second example.
Dima needs 12 rubles for the first guardpost, 14 for the second one, 16 for the fourth one. So the only guardpost we can sneak through is the third one. So, Dima can buy 4 ruble chocolate for the first guard and 6 ruble juice of the second guard.
| 500
|
[
{
"input": "10\n5 6 5 6\n6 6 7 7\n5 8 6 6\n9 9 9 9",
"output": "1 5 5"
},
{
"input": "10\n6 6 6 6\n7 7 7 7\n4 4 4 4\n8 8 8 8",
"output": "3 4 6"
},
{
"input": "5\n3 3 3 3\n3 3 3 3\n3 3 3 3\n3 3 3 3",
"output": "-1"
},
{
"input": "100000\n100000 100000 100000 100000\n100000 100000 100000 100000\n100000 100000 100000 100000\n100000 100000 100000 100000",
"output": "-1"
},
{
"input": "5\n3 2 3 3\n3 2 3 3\n4 4 4 4\n4 4 1 1",
"output": "1 2 3"
},
{
"input": "100\n1 1 2 2\n100 100 2 2\n99 99 2 2\n2 2 99 99",
"output": "1 1 99"
},
{
"input": "1000\n500 500 550 550\n450 450 500 500\n999 1 1 999\n1 999 1 999",
"output": "3 1 999"
},
{
"input": "50\n30 30 30 30\n20 20 40 40\n10 10 50 50\n1 1 50 55",
"output": "-1"
},
{
"input": "10000\n1000 7000 8000 6000\n8000 8000 6000 6000\n5000 6000 6000 6000\n10000 10000 2 3",
"output": "1 1000 9000"
},
{
"input": "40000\n25000 25000 30000 30000\n1 1 1 1\n30000 20000 30000 30000\n40000 40000 40000 50000",
"output": "2 1 39999"
},
{
"input": "4\n2 1 4 4\n4 4 1 1\n3 1 2 2\n4 4 4 4",
"output": "3 1 3"
},
{
"input": "50\n5 5 5 5\n5 5 5 5\n5 5 5 5\n5 5 5 5",
"output": "1 5 45"
},
{
"input": "10\n7 2 3 20\n20 20 20 20\n20 20 20 20\n7 2 3 20",
"output": "1 2 8"
},
{
"input": "10\n8 2 7 8\n20 20 20 20\n20 20 20 20\n8 2 7 8",
"output": "1 2 8"
},
{
"input": "100000\n50000 50000 50000 50000\n50000 50000 50000 50000\n50000 50000 50000 50000\n50000 50000 50000 50000",
"output": "1 50000 50000"
},
{
"input": "100000\n25000 75000 80000 80000\n99999 99999 2 2\n99999 2 99999 99999\n2 99999 99999 99999",
"output": "-1"
},
{
"input": "1231\n123 132 85 78\n123 5743 139 27\n4598 347 12438 12\n34589 2349 123 123",
"output": "2 123 1108"
},
{
"input": "6\n2 6 2 9\n4 8 5 1\n5 6 4 3\n1 2 5 1",
"output": "4 1 5"
},
{
"input": "8\n5 5 3 3\n1 1 8 8\n2 8 8 7\n10 7 2 2",
"output": "1 5 3"
},
{
"input": "100000\n25000 50000 50001 75001\n25000 50000 50001 75001\n25000 50000 50001 75001\n25000 50000 50001 75001",
"output": "1 25000 75000"
},
{
"input": "100000\n25000 50000 75001 50001\n25000 50000 75001 50001\n25000 50000 75001 50001\n25000 50000 75001 50001",
"output": "1 25000 75000"
},
{
"input": "5\n3 7 6 2\n100 100 100 100\n100 100 100 100\n100 100 100 100",
"output": "1 3 2"
},
{
"input": "10\n1 100 100 1\n1 100 100 1\n1 100 100 1\n1 100 100 1",
"output": "1 1 9"
},
{
"input": "10\n7 5 5 7\n10 10 10 10\n10 10 10 10\n10 10 10 10",
"output": "1 5 5"
},
{
"input": "10\n9 9 9 9\n9 9 9 9\n9 9 9 9\n1 1 1 1",
"output": "4 1 9"
},
{
"input": "10\n8 6 5 3\n8 6 5 3\n8 6 5 3\n8 6 5 3",
"output": "1 6 4"
},
{
"input": "10\n9 9 9 9\n9 9 9 9\n9 9 9 9\n9 4 9 6",
"output": "4 4 6"
},
{
"input": "10\n6 6 4 4\n6 6 4 4\n6 6 4 4\n6 6 4 4",
"output": "1 6 4"
},
{
"input": "100000\n99000 100000 999 100000\n100000 100000 100000 100000\n100000 100000 100000 100000\n100000 100000 100000 100000",
"output": "1 99000 1000"
}
] | 1,589,740,885
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 109
| 6,656,000
|
n=int(input())
for i in range(4):
a,b,c,d=map(int,input().split())
a=min(a,b)
c=min(c,d)
if a+c<=n:
print(i+1,a,n-a)
break
else: print(-1)
|
Title: Dima and Guards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nothing has changed since the last round. Dima and Inna still love each other and want to be together. They've made a deal with Seryozha and now they need to make a deal with the dorm guards...
There are four guardposts in Dima's dorm. Each post contains two guards (in Russia they are usually elderly women). You can bribe a guard by a chocolate bar or a box of juice. For each guard you know the minimum price of the chocolate bar she can accept as a gift and the minimum price of the box of juice she can accept as a gift. If a chocolate bar for some guard costs less than the minimum chocolate bar price for this guard is, or if a box of juice for some guard costs less than the minimum box of juice price for this guard is, then the guard doesn't accept such a gift.
In order to pass through a guardpost, one needs to bribe both guards.
The shop has an unlimited amount of juice and chocolate of any price starting with 1. Dima wants to choose some guardpost, buy one gift for each guard from the guardpost and spend exactly *n* rubles on it.
Help him choose a post through which he can safely sneak Inna or otherwise say that this is impossible. Mind you, Inna would be very sorry to hear that!
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=105) — the money Dima wants to spend. Then follow four lines describing the guardposts. Each line contains four integers *a*,<=*b*,<=*c*,<=*d* (1<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=105) — the minimum price of the chocolate and the minimum price of the juice for the first guard and the minimum price of the chocolate and the minimum price of the juice for the second guard, correspondingly.
Output Specification:
In a single line of the output print three space-separated integers: the number of the guardpost, the cost of the first present and the cost of the second present. If there is no guardpost Dima can sneak Inna through at such conditions, print -1 in a single line.
The guardposts are numbered from 1 to 4 according to the order given in the input.
If there are multiple solutions, you can print any of them.
Demo Input:
['10\n5 6 5 6\n6 6 7 7\n5 8 6 6\n9 9 9 9\n', '10\n6 6 6 6\n7 7 7 7\n4 4 4 4\n8 8 8 8\n', '5\n3 3 3 3\n3 3 3 3\n3 3 3 3\n3 3 3 3\n']
Demo Output:
['1 5 5\n', '3 4 6\n', '-1\n']
Note:
Explanation of the first example.
The only way to spend 10 rubles to buy the gifts that won't be less than the minimum prices is to buy two 5 ruble chocolates to both guards from the first guardpost.
Explanation of the second example.
Dima needs 12 rubles for the first guardpost, 14 for the second one, 16 for the fourth one. So the only guardpost we can sneak through is the third one. So, Dima can buy 4 ruble chocolate for the first guard and 6 ruble juice of the second guard.
|
```python
n=int(input())
for i in range(4):
a,b,c,d=map(int,input().split())
a=min(a,b)
c=min(c,d)
if a+c<=n:
print(i+1,a,n-a)
break
else: print(-1)
```
| 3
|
|
437
|
A
|
The Child and Homework
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct.
Fortunately the child knows how to solve such complicated test. The child will follow the algorithm:
- If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice).
You are given a multiple-choice questions, can you predict child's choose?
|
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length.
Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
|
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
|
[
"A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n",
"A.ab\nB.abcde\nC.ab\nD.abc\n",
"A.c\nB.cc\nC.c\nD.c\n"
] |
[
"D\n",
"C\n",
"B\n"
] |
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D.
In the second sample, no choice is great, so the child will choose the luckiest choice C.
In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
| 500
|
[
{
"input": "A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute",
"output": "D"
},
{
"input": "A.ab\nB.abcde\nC.ab\nD.abc",
"output": "C"
},
{
"input": "A.c\nB.cc\nC.c\nD.c",
"output": "B"
},
{
"input": "A.He_nan_de_yang_guang_zhao_yao_zhe_wo_men_mei_guo_ren_lian_shang_dou_xiao_kai_yan_wahaaaaaaaaaaaaaaaa\nB.Li_bai_li_bai_fei_liu_zhi_xia_san_qian_chi_yi_si_yin_he_luo_jiu_tian_li_bai_li_bai_li_bai_li_bai_shi\nC.Peng_yu_xiang_shi_zai_tai_shen_le_jian_zhi_jiu_shi_ye_jie_du_liu_a_si_mi_da_zhen_shi_tai_shen_le_a_a\nD.Wo_huo_le_si_shi_er_nian_zhen_de_shi_cong_lai_ye_mei_you_jian_guo_zhe_me_biao_zhun_de_yi_bai_ge_zi_a",
"output": "C"
},
{
"input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____",
"output": "C"
},
{
"input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_",
"output": "D"
},
{
"input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____",
"output": "C"
},
{
"input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_",
"output": "D"
},
{
"input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h",
"output": "A"
},
{
"input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_",
"output": "C"
},
{
"input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg",
"output": "B"
},
{
"input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___",
"output": "D"
},
{
"input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS",
"output": "C"
},
{
"input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_",
"output": "C"
},
{
"input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi",
"output": "C"
},
{
"input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__",
"output": "C"
},
{
"input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h",
"output": "A"
},
{
"input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_",
"output": "C"
},
{
"input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg",
"output": "B"
},
{
"input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___",
"output": "D"
},
{
"input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS",
"output": "C"
},
{
"input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_",
"output": "C"
},
{
"input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi",
"output": "C"
},
{
"input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__",
"output": "C"
},
{
"input": "A.aaaaaa\nB.aaa\nC.aaa\nD.aaa",
"output": "A"
},
{
"input": "A.aaa\nB.aaaaaa\nC.aaaaaa\nD.aaaaaa",
"output": "A"
},
{
"input": "A.a\nB.b\nC.c\nD.d",
"output": "C"
},
{
"input": "A._\nB.__\nC.____\nD.________",
"output": "C"
},
{
"input": "A.____\nB.________\nC.________\nD._______",
"output": "C"
},
{
"input": "A.h\nB.asdf\nC.asqw\nD.qwertasdfg",
"output": "C"
},
{
"input": "A.aa\nB.aaaaa\nC.aaaaaa\nD.aaaaaaaaaaaaa",
"output": "C"
},
{
"input": "A.ccc\nB.ccccccc\nC.ccc\nD.c",
"output": "C"
},
{
"input": "A.c\nB.ccc\nC.cccccccccccccccccc\nD.cccccc",
"output": "C"
},
{
"input": "A.aa\nB.bb\nC.cc\nD.ddd",
"output": "C"
},
{
"input": "A.QW\nB.WERT\nC.QWER\nD.QWERTYUI",
"output": "C"
}
] | 1,595,488,935
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 109
| 6,656,000
|
arr = sorted([(len(input())-2,i) for i in 'ABCD'])
p=0
if 2 * arr[0][0] <= arr[1][0]:
p+=1
if 2 * arr[-2][0] <= arr[-1][0]:
p+=2
print(['C',arr[0][1],arr[-1][1],'C'][p])
|
Title: The Child and Homework
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct.
Fortunately the child knows how to solve such complicated test. The child will follow the algorithm:
- If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice).
You are given a multiple-choice questions, can you predict child's choose?
Input Specification:
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length.
Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
Output Specification:
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
Demo Input:
['A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n', 'A.ab\nB.abcde\nC.ab\nD.abc\n', 'A.c\nB.cc\nC.c\nD.c\n']
Demo Output:
['D\n', 'C\n', 'B\n']
Note:
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D.
In the second sample, no choice is great, so the child will choose the luckiest choice C.
In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
|
```python
arr = sorted([(len(input())-2,i) for i in 'ABCD'])
p=0
if 2 * arr[0][0] <= arr[1][0]:
p+=1
if 2 * arr[-2][0] <= arr[-1][0]:
p+=2
print(['C',arr[0][1],arr[-1][1],'C'][p])
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,580,302,676
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 155
| 1,024,000
|
import re
s=str(input())
if re.search("h.*e.*l.*l.*o", s):
print("YES")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
import re
s=str(input())
if re.search("h.*e.*l.*l.*o", s):
print("YES")
else:
print("NO")
```
| 3.920593
|
14
|
A
|
Letter
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Letter
|
1
|
64
|
A boy Bob likes to draw. Not long ago he bought a rectangular graph (checked) sheet with *n* rows and *m* columns. Bob shaded some of the squares on the sheet. Having seen his masterpiece, he decided to share it with his elder brother, who lives in Flatland. Now Bob has to send his picture by post, but because of the world economic crisis and high oil prices, he wants to send his creation, but to spend as little money as possible. For each sent square of paper (no matter whether it is shaded or not) Bob has to pay 3.14 burles. Please, help Bob cut out of his masterpiece a rectangle of the minimum cost, that will contain all the shaded squares. The rectangle's sides should be parallel to the sheet's sides.
|
The first line of the input data contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50), *n* — amount of lines, and *m* — amount of columns on Bob's sheet. The following *n* lines contain *m* characters each. Character «.» stands for a non-shaded square on the sheet, and «*» — for a shaded square. It is guaranteed that Bob has shaded at least one square.
|
Output the required rectangle of the minimum cost. Study the output data in the sample tests to understand the output format better.
|
[
"6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..\n",
"3 3\n***\n*.*\n***\n"
] |
[
"***\n*..\n***\n*..\n***\n",
"***\n*.*\n***\n"
] |
none
| 0
|
[
{
"input": "6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..",
"output": "***\n*..\n***\n*..\n***"
},
{
"input": "3 3\n***\n*.*\n***",
"output": "***\n*.*\n***"
},
{
"input": "1 1\n*",
"output": "*"
},
{
"input": "2 1\n*\n*",
"output": "*\n*"
},
{
"input": "5 1\n.\n*\n.\n.\n.",
"output": "*"
},
{
"input": "1 6\n*****.",
"output": "*****"
},
{
"input": "2 2\n..\n*.",
"output": "*"
},
{
"input": "8 2\n..\n..\n..\n..\n..\n*.\n..\n..",
"output": "*"
},
{
"input": "50 1\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "*\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*"
},
{
"input": "2 1\n*\n.",
"output": "*"
},
{
"input": "5 1\n*\n*\n*\n*\n*",
"output": "*\n*\n*\n*\n*"
},
{
"input": "2 2\n*.\n..",
"output": "*"
},
{
"input": "3 4\n...*\n*...\n..*.",
"output": "...*\n*...\n..*."
},
{
"input": "8 2\n**\n**\n**\n**\n**\n**\n**\n**",
"output": "**\n**\n**\n**\n**\n**\n**\n**"
},
{
"input": "50 1\n.\n*\n*\n*\n.\n.\n*\n.\n*\n*\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n.\n.\n*\n*\n.\n*\n*\n.\n.\n.\n.\n*\n*\n.\n.\n.\n.\n.\n.",
"output": "*\n*\n*\n.\n.\n*\n.\n*\n*\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n.\n.\n*\n*\n.\n*\n*\n.\n.\n.\n.\n*\n*"
}
] | 1,633,622,807
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 6,963,200
|
#%%
rc=input().split()
r,c=[int(x) for x in rc]
matrix=[]
for i in range(r):
matrix.append(input())
max_i=0
max_j=0
min_i=r-1
min_j=c-1
for i in range(r):
for j in range(c):
if matrix[i][j]=='*':
if i<min_i:
min_i=i
if i>max_i:
max_i=i
if j<min_j:
min_j=j
if j>=max_j:
max_j=j
for i in range(min_i,max_i+1):
print(matrix[i][min_j:max_j+1])
# %%
|
Title: Letter
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
A boy Bob likes to draw. Not long ago he bought a rectangular graph (checked) sheet with *n* rows and *m* columns. Bob shaded some of the squares on the sheet. Having seen his masterpiece, he decided to share it with his elder brother, who lives in Flatland. Now Bob has to send his picture by post, but because of the world economic crisis and high oil prices, he wants to send his creation, but to spend as little money as possible. For each sent square of paper (no matter whether it is shaded or not) Bob has to pay 3.14 burles. Please, help Bob cut out of his masterpiece a rectangle of the minimum cost, that will contain all the shaded squares. The rectangle's sides should be parallel to the sheet's sides.
Input Specification:
The first line of the input data contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50), *n* — amount of lines, and *m* — amount of columns on Bob's sheet. The following *n* lines contain *m* characters each. Character «.» stands for a non-shaded square on the sheet, and «*» — for a shaded square. It is guaranteed that Bob has shaded at least one square.
Output Specification:
Output the required rectangle of the minimum cost. Study the output data in the sample tests to understand the output format better.
Demo Input:
['6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..\n', '3 3\n***\n*.*\n***\n']
Demo Output:
['***\n*..\n***\n*..\n***\n', '***\n*.*\n***\n']
Note:
none
|
```python
#%%
rc=input().split()
r,c=[int(x) for x in rc]
matrix=[]
for i in range(r):
matrix.append(input())
max_i=0
max_j=0
min_i=r-1
min_j=c-1
for i in range(r):
for j in range(c):
if matrix[i][j]=='*':
if i<min_i:
min_i=i
if i>max_i:
max_i=i
if j<min_j:
min_j=j
if j>=max_j:
max_j=j
for i in range(min_i,max_i+1):
print(matrix[i][min_j:max_j+1])
# %%
```
| 3.88612
|
340
|
A
|
The Wall
|
PROGRAMMING
| 1,200
|
[
"math"
] | null | null |
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on.
Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink.
After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
|
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
|
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
|
[
"2 3 6 18\n"
] |
[
"3"
] |
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
| 500
|
[
{
"input": "2 3 6 18",
"output": "3"
},
{
"input": "4 6 20 201",
"output": "15"
},
{
"input": "15 27 100 10000",
"output": "74"
},
{
"input": "105 60 3456 78910",
"output": "179"
},
{
"input": "1 1 1000 100000",
"output": "99001"
},
{
"input": "3 2 5 5",
"output": "0"
},
{
"input": "555 777 1 1000000",
"output": "257"
},
{
"input": "1000 1000 1 32323",
"output": "32"
},
{
"input": "45 125 93451125 100000000",
"output": "5821"
},
{
"input": "101 171 1 1000000000",
"output": "57900"
},
{
"input": "165 255 69696 1000000000",
"output": "356482"
},
{
"input": "555 777 666013 1000000000",
"output": "257229"
},
{
"input": "23 46 123321 900000000",
"output": "19562537"
},
{
"input": "321 123 15 1000000",
"output": "75"
},
{
"input": "819 1000 9532 152901000",
"output": "186"
},
{
"input": "819 1000 10000 1000000",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "1 2 2 1000003",
"output": "500001"
},
{
"input": "1 1 1 1000000000",
"output": "1000000000"
},
{
"input": "10 15 69 195610342",
"output": "6520342"
},
{
"input": "2 1 1 1000000000",
"output": "500000000"
},
{
"input": "1000 1000 1 20",
"output": "0"
},
{
"input": "1 1 1 2000000000",
"output": "2000000000"
},
{
"input": "1 2 1 2000000000",
"output": "1000000000"
},
{
"input": "2 1 1 2000000000",
"output": "1000000000"
},
{
"input": "2 3 1 1000000000",
"output": "166666666"
},
{
"input": "2 3 1 2000000000",
"output": "333333333"
},
{
"input": "3 7 1 1000000000",
"output": "47619047"
},
{
"input": "1 1 1000000000 2000000000",
"output": "1000000001"
},
{
"input": "2 2 1 2000000000",
"output": "1000000000"
},
{
"input": "1 1 2 2000000000",
"output": "1999999999"
},
{
"input": "3 2 1 2000000000",
"output": "333333333"
},
{
"input": "1 1 2000000000 2000000000",
"output": "1"
},
{
"input": "2 3 7 7",
"output": "0"
},
{
"input": "3 3 3 7",
"output": "2"
}
] | 1,589,825,175
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 218
| 307,200
|
def editor():
import sys
sys.stdin=open("input.txt",'r')
sys.stdout=open("output.txt",'w')
def solve():
x,y,a,b=I()
import math
# hcf=math.gcd(a, b)
# lcm= a*b//hcf
# print(lcm)
# ans=(b-a)//hcf
# ans=b//hcf - (a-1)//hcf
lcm=x*y//math.gcd(x,y)
ans=b//lcm - (a-1)//lcm
print(ans)
if __name__ == "__main__":
# editor()
tc=1
# tc=int(input())
I=lambda:list(map(int,input().split()))
for t in range(tc):
solve()
|
Title: The Wall
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on.
Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink.
After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
Input Specification:
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
Output Specification:
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
Demo Input:
['2 3 6 18\n']
Demo Output:
['3']
Note:
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
|
```python
def editor():
import sys
sys.stdin=open("input.txt",'r')
sys.stdout=open("output.txt",'w')
def solve():
x,y,a,b=I()
import math
# hcf=math.gcd(a, b)
# lcm= a*b//hcf
# print(lcm)
# ans=(b-a)//hcf
# ans=b//hcf - (a-1)//hcf
lcm=x*y//math.gcd(x,y)
ans=b//lcm - (a-1)//lcm
print(ans)
if __name__ == "__main__":
# editor()
tc=1
# tc=int(input())
I=lambda:list(map(int,input().split()))
for t in range(tc):
solve()
```
| 3
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,692,825,526
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 31
| 122
| 0
|
n=int(input())
sum=0
l=[]
l=list(map(int,input().split()))
for i in range(n):
sum =sum+l[i]
print(sum/n)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
n=int(input())
sum=0
l=[]
l=list(map(int,input().split()))
for i in range(n):
sum =sum+l[i]
print(sum/n)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,687,105,289
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 93
| 0
|
n = int(input())
l = []
for i in range(n):
l.append(input())
if len(l[i]) <= 10:
print(l[i])
else:
print(l[i][0] + str(len(l[i]) - 2) + l[i][-1])
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
n = int(input())
l = []
for i in range(n):
l.append(input())
if len(l[i]) <= 10:
print(l[i])
else:
print(l[i][0] + str(len(l[i]) - 2) + l[i][-1])
```
| 3.9535
|
136
|
A
|
Presents
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
|
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
|
[
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] |
[
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,693,232,270
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 101
| 92
| 0
|
n = int(input())
s = list(map(int, input().split()))
for i in range(0, len(s)):
print(s.index(i+1)+1, end='')
if i != len(s):
print(' ', end='')
|
Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none
|
```python
n = int(input())
s = list(map(int, input().split()))
for i in range(0, len(s)):
print(s.index(i+1)+1, end='')
if i != len(s):
print(' ', end='')
```
| 3
|
|
110
|
A
|
Nearly Lucky Number
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Nearly Lucky Number
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
|
[
"40047\n",
"7747774\n",
"1000000000000000000\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
| 500
|
[
{
"input": "40047",
"output": "NO"
},
{
"input": "7747774",
"output": "YES"
},
{
"input": "1000000000000000000",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "4",
"output": "NO"
},
{
"input": "474404774",
"output": "NO"
},
{
"input": "4744000695826",
"output": "YES"
},
{
"input": "10000000004744744",
"output": "YES"
},
{
"input": "446486416781684178",
"output": "YES"
},
{
"input": "999999999",
"output": "NO"
},
{
"input": "7777",
"output": "YES"
},
{
"input": "87414417444",
"output": "NO"
},
{
"input": "111222333444555667",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "4700",
"output": "NO"
},
{
"input": "3794555488744477",
"output": "NO"
},
{
"input": "444444444444444444",
"output": "NO"
},
{
"input": "474447447774444774",
"output": "NO"
},
{
"input": "777777777777777",
"output": "NO"
},
{
"input": "34777745021000000",
"output": "NO"
},
{
"input": "963",
"output": "NO"
},
{
"input": "855474448854788540",
"output": "NO"
},
{
"input": "999999999999994744",
"output": "YES"
},
{
"input": "400000000474",
"output": "YES"
},
{
"input": "123456789123456789",
"output": "YES"
},
{
"input": "740577777584945874",
"output": "NO"
},
{
"input": "7777777",
"output": "YES"
},
{
"input": "4444000111222333",
"output": "YES"
},
{
"input": "9847745885202111",
"output": "YES"
},
{
"input": "123456000000",
"output": "NO"
},
{
"input": "4744447444444",
"output": "NO"
},
{
"input": "7477",
"output": "YES"
},
{
"input": "4747477",
"output": "YES"
},
{
"input": "777777777444444444",
"output": "NO"
}
] | 1,699,091,504
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 92
| 0
|
n = int(input())
digits = [int(i) for i in str(n)]
number_of_lucky_digits = digits.count(4) + digits.count(7)
if number_of_lucky_digits == 4 or number_of_lucky_digits == 7:
print('YES')
else:
print('NO')
|
Title: Nearly Lucky Number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Output Specification:
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
Demo Input:
['40047\n', '7747774\n', '1000000000000000000\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
|
```python
n = int(input())
digits = [int(i) for i in str(n)]
number_of_lucky_digits = digits.count(4) + digits.count(7)
if number_of_lucky_digits == 4 or number_of_lucky_digits == 7:
print('YES')
else:
print('NO')
```
| 3.977
|
551
|
A
|
GukiZ and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
|
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
|
[
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] |
[
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] |
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
| 500
|
[
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,686,979,657
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 36
| 77
| 2,150,400
|
n = int(input())
lst = list(map(int, input().split()))
cpy = lst.copy()
cpy.sort()
cpy.reverse()
res = [1 + cpy.index(x) for x in lst]
print(" ".join(str(x) for x in res))
|
Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
|
```python
n = int(input())
lst = list(map(int, input().split()))
cpy = lst.copy()
cpy.sort()
cpy.reverse()
res = [1 + cpy.index(x) for x in lst]
print(" ".join(str(x) for x in res))
```
| 3
|
|
6
|
A
|
Triangle
|
PROGRAMMING
| 900
|
[
"brute force",
"geometry"
] |
A. Triangle
|
2
|
64
|
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same.
The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
|
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
|
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
|
[
"4 2 1 3\n",
"7 2 2 4\n",
"3 5 9 1\n"
] |
[
"TRIANGLE\n",
"SEGMENT\n",
"IMPOSSIBLE\n"
] |
none
| 0
|
[
{
"input": "4 2 1 3",
"output": "TRIANGLE"
},
{
"input": "7 2 2 4",
"output": "SEGMENT"
},
{
"input": "3 5 9 1",
"output": "IMPOSSIBLE"
},
{
"input": "3 1 5 1",
"output": "IMPOSSIBLE"
},
{
"input": "10 10 10 10",
"output": "TRIANGLE"
},
{
"input": "11 5 6 11",
"output": "TRIANGLE"
},
{
"input": "1 1 1 1",
"output": "TRIANGLE"
},
{
"input": "10 20 30 40",
"output": "TRIANGLE"
},
{
"input": "45 25 5 15",
"output": "IMPOSSIBLE"
},
{
"input": "20 5 8 13",
"output": "TRIANGLE"
},
{
"input": "10 30 7 20",
"output": "SEGMENT"
},
{
"input": "3 2 3 2",
"output": "TRIANGLE"
},
{
"input": "70 10 100 30",
"output": "SEGMENT"
},
{
"input": "4 8 16 2",
"output": "IMPOSSIBLE"
},
{
"input": "3 3 3 10",
"output": "TRIANGLE"
},
{
"input": "1 5 5 5",
"output": "TRIANGLE"
},
{
"input": "13 25 12 1",
"output": "SEGMENT"
},
{
"input": "10 100 7 3",
"output": "SEGMENT"
},
{
"input": "50 1 50 100",
"output": "TRIANGLE"
},
{
"input": "50 1 100 49",
"output": "SEGMENT"
},
{
"input": "49 51 100 1",
"output": "SEGMENT"
},
{
"input": "5 11 2 25",
"output": "IMPOSSIBLE"
},
{
"input": "91 50 9 40",
"output": "IMPOSSIBLE"
},
{
"input": "27 53 7 97",
"output": "IMPOSSIBLE"
},
{
"input": "51 90 24 8",
"output": "IMPOSSIBLE"
},
{
"input": "3 5 1 1",
"output": "IMPOSSIBLE"
},
{
"input": "13 49 69 15",
"output": "IMPOSSIBLE"
},
{
"input": "16 99 9 35",
"output": "IMPOSSIBLE"
},
{
"input": "27 6 18 53",
"output": "IMPOSSIBLE"
},
{
"input": "57 88 17 8",
"output": "IMPOSSIBLE"
},
{
"input": "95 20 21 43",
"output": "IMPOSSIBLE"
},
{
"input": "6 19 32 61",
"output": "IMPOSSIBLE"
},
{
"input": "100 21 30 65",
"output": "IMPOSSIBLE"
},
{
"input": "85 16 61 9",
"output": "IMPOSSIBLE"
},
{
"input": "5 6 19 82",
"output": "IMPOSSIBLE"
},
{
"input": "1 5 1 3",
"output": "IMPOSSIBLE"
},
{
"input": "65 10 36 17",
"output": "IMPOSSIBLE"
},
{
"input": "81 64 9 7",
"output": "IMPOSSIBLE"
},
{
"input": "11 30 79 43",
"output": "IMPOSSIBLE"
},
{
"input": "1 1 5 3",
"output": "IMPOSSIBLE"
},
{
"input": "21 94 61 31",
"output": "IMPOSSIBLE"
},
{
"input": "49 24 9 74",
"output": "IMPOSSIBLE"
},
{
"input": "11 19 5 77",
"output": "IMPOSSIBLE"
},
{
"input": "52 10 19 71",
"output": "SEGMENT"
},
{
"input": "2 3 7 10",
"output": "SEGMENT"
},
{
"input": "1 2 6 3",
"output": "SEGMENT"
},
{
"input": "2 6 1 8",
"output": "SEGMENT"
},
{
"input": "1 2 4 1",
"output": "SEGMENT"
},
{
"input": "4 10 6 2",
"output": "SEGMENT"
},
{
"input": "2 10 7 3",
"output": "SEGMENT"
},
{
"input": "5 2 3 9",
"output": "SEGMENT"
},
{
"input": "6 1 4 10",
"output": "SEGMENT"
},
{
"input": "10 6 4 1",
"output": "SEGMENT"
},
{
"input": "3 2 9 1",
"output": "SEGMENT"
},
{
"input": "22 80 29 7",
"output": "SEGMENT"
},
{
"input": "2 6 3 9",
"output": "SEGMENT"
},
{
"input": "3 1 2 1",
"output": "SEGMENT"
},
{
"input": "3 4 7 1",
"output": "SEGMENT"
},
{
"input": "8 4 3 1",
"output": "SEGMENT"
},
{
"input": "2 8 3 5",
"output": "SEGMENT"
},
{
"input": "4 1 2 1",
"output": "SEGMENT"
},
{
"input": "8 1 3 2",
"output": "SEGMENT"
},
{
"input": "6 2 1 8",
"output": "SEGMENT"
},
{
"input": "3 3 3 6",
"output": "TRIANGLE"
},
{
"input": "3 6 3 3",
"output": "TRIANGLE"
},
{
"input": "4 10 4 4",
"output": "TRIANGLE"
},
{
"input": "1 1 2 1",
"output": "TRIANGLE"
},
{
"input": "3 3 3 6",
"output": "TRIANGLE"
},
{
"input": "5 4 5 5",
"output": "TRIANGLE"
},
{
"input": "8 7 8 8",
"output": "TRIANGLE"
},
{
"input": "3 3 3 1",
"output": "TRIANGLE"
},
{
"input": "1 1 6 6",
"output": "TRIANGLE"
},
{
"input": "1 9 1 9",
"output": "TRIANGLE"
},
{
"input": "7 2 2 7",
"output": "TRIANGLE"
},
{
"input": "7 2 3 2",
"output": "TRIANGLE"
},
{
"input": "4 4 10 10",
"output": "TRIANGLE"
},
{
"input": "7 7 10 7",
"output": "TRIANGLE"
},
{
"input": "4 4 4 5",
"output": "TRIANGLE"
},
{
"input": "1 10 9 2",
"output": "TRIANGLE"
},
{
"input": "1 8 2 7",
"output": "TRIANGLE"
},
{
"input": "4 3 2 8",
"output": "TRIANGLE"
},
{
"input": "5 9 5 3",
"output": "TRIANGLE"
},
{
"input": "4 10 3 5",
"output": "TRIANGLE"
}
] | 1,589,101,746
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 83
| 312
| 20,172,800
|
sides = list(map(int, input().split()))
sides.sort()
if sides[0]+sides[1]>sides[2]:
print("TRIANGLE")
elif sides[1]+sides[2]>sides[3]:
print("TRIANGLE")
elif sides[1]+sides[2]==sides[3]:
print("SEGMENT")
elif sides[0]+sides[1]==sides[2]:
print("SEGMENT")
else:
print("IMPOSSIBLE")
|
Title: Triangle
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same.
The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
Input Specification:
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
Output Specification:
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
Demo Input:
['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n']
Demo Output:
['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n']
Note:
none
|
```python
sides = list(map(int, input().split()))
sides.sort()
if sides[0]+sides[1]>sides[2]:
print("TRIANGLE")
elif sides[1]+sides[2]>sides[3]:
print("TRIANGLE")
elif sides[1]+sides[2]==sides[3]:
print("SEGMENT")
elif sides[0]+sides[1]==sides[2]:
print("SEGMENT")
else:
print("IMPOSSIBLE")
```
| 3.771701
|
53
|
C
|
Little Frog
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms"
] |
C. Little Frog
|
2
|
256
|
Once upon a time a little frog whose name was Vasya decided to travel around his home swamp. Overall there are *n* mounds on the swamp, located on one line. The distance between the neighboring mounds is one meter. Vasya wants to visit all the mounds in one day; besides, he wants to visit each one exactly once. For that he makes a route plan, to decide the order in which to jump on the mounds. Vasya can pick any mound as the first one. He thinks it boring to jump two times at the same distance. That's why he wants any two jumps on his route to have different lengths. Help Vasya the Frog and make the plan for him.
|
The single line contains a number *n* (1<=≤<=*n*<=≤<=104) which is the number of mounds.
|
Print *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*) which are the frog's route plan.
- All the *p**i*'s should be mutually different. - All the |*p**i*–*p**i*<=+<=1|'s should be mutually different (1<=≤<=*i*<=≤<=*n*<=-<=1).
If there are several solutions, output any.
|
[
"2\n",
"3\n"
] |
[
"1 2 ",
"1 3 2 "
] |
none
| 1,500
|
[
{
"input": "2",
"output": "1 2 "
},
{
"input": "3",
"output": "1 3 2 "
},
{
"input": "4",
"output": "1 4 2 3 "
},
{
"input": "5",
"output": "1 5 2 4 3 "
},
{
"input": "6",
"output": "1 6 2 5 3 4 "
},
{
"input": "1",
"output": "1 "
},
{
"input": "9149",
"output": "1 9149 2 9148 3 9147 4 9146 5 9145 6 9144 7 9143 8 9142 9 9141 10 9140 11 9139 12 9138 13 9137 14 9136 15 9135 16 9134 17 9133 18 9132 19 9131 20 9130 21 9129 22 9128 23 9127 24 9126 25 9125 26 9124 27 9123 28 9122 29 9121 30 9120 31 9119 32 9118 33 9117 34 9116 35 9115 36 9114 37 9113 38 9112 39 9111 40 9110 41 9109 42 9108 43 9107 44 9106 45 9105 46 9104 47 9103 48 9102 49 9101 50 9100 51 9099 52 9098 53 9097 54 9096 55 9095 56 9094 57 9093 58 9092 59 9091 60 9090 61 9089 62 9088 63 9087 64 9086 65 9085 ..."
},
{
"input": "2877",
"output": "1 2877 2 2876 3 2875 4 2874 5 2873 6 2872 7 2871 8 2870 9 2869 10 2868 11 2867 12 2866 13 2865 14 2864 15 2863 16 2862 17 2861 18 2860 19 2859 20 2858 21 2857 22 2856 23 2855 24 2854 25 2853 26 2852 27 2851 28 2850 29 2849 30 2848 31 2847 32 2846 33 2845 34 2844 35 2843 36 2842 37 2841 38 2840 39 2839 40 2838 41 2837 42 2836 43 2835 44 2834 45 2833 46 2832 47 2831 48 2830 49 2829 50 2828 51 2827 52 2826 53 2825 54 2824 55 2823 56 2822 57 2821 58 2820 59 2819 60 2818 61 2817 62 2816 63 2815 64 2814 65 2813 ..."
},
{
"input": "2956",
"output": "1 2956 2 2955 3 2954 4 2953 5 2952 6 2951 7 2950 8 2949 9 2948 10 2947 11 2946 12 2945 13 2944 14 2943 15 2942 16 2941 17 2940 18 2939 19 2938 20 2937 21 2936 22 2935 23 2934 24 2933 25 2932 26 2931 27 2930 28 2929 29 2928 30 2927 31 2926 32 2925 33 2924 34 2923 35 2922 36 2921 37 2920 38 2919 39 2918 40 2917 41 2916 42 2915 43 2914 44 2913 45 2912 46 2911 47 2910 48 2909 49 2908 50 2907 51 2906 52 2905 53 2904 54 2903 55 2902 56 2901 57 2900 58 2899 59 2898 60 2897 61 2896 62 2895 63 2894 64 2893 65 2892 ..."
},
{
"input": "3035",
"output": "1 3035 2 3034 3 3033 4 3032 5 3031 6 3030 7 3029 8 3028 9 3027 10 3026 11 3025 12 3024 13 3023 14 3022 15 3021 16 3020 17 3019 18 3018 19 3017 20 3016 21 3015 22 3014 23 3013 24 3012 25 3011 26 3010 27 3009 28 3008 29 3007 30 3006 31 3005 32 3004 33 3003 34 3002 35 3001 36 3000 37 2999 38 2998 39 2997 40 2996 41 2995 42 2994 43 2993 44 2992 45 2991 46 2990 47 2989 48 2988 49 2987 50 2986 51 2985 52 2984 53 2983 54 2982 55 2981 56 2980 57 2979 58 2978 59 2977 60 2976 61 2975 62 2974 63 2973 64 2972 65 2971 ..."
},
{
"input": "3114",
"output": "1 3114 2 3113 3 3112 4 3111 5 3110 6 3109 7 3108 8 3107 9 3106 10 3105 11 3104 12 3103 13 3102 14 3101 15 3100 16 3099 17 3098 18 3097 19 3096 20 3095 21 3094 22 3093 23 3092 24 3091 25 3090 26 3089 27 3088 28 3087 29 3086 30 3085 31 3084 32 3083 33 3082 34 3081 35 3080 36 3079 37 3078 38 3077 39 3076 40 3075 41 3074 42 3073 43 3072 44 3071 45 3070 46 3069 47 3068 48 3067 49 3066 50 3065 51 3064 52 3063 53 3062 54 3061 55 3060 56 3059 57 3058 58 3057 59 3056 60 3055 61 3054 62 3053 63 3052 64 3051 65 3050 ..."
},
{
"input": "3193",
"output": "1 3193 2 3192 3 3191 4 3190 5 3189 6 3188 7 3187 8 3186 9 3185 10 3184 11 3183 12 3182 13 3181 14 3180 15 3179 16 3178 17 3177 18 3176 19 3175 20 3174 21 3173 22 3172 23 3171 24 3170 25 3169 26 3168 27 3167 28 3166 29 3165 30 3164 31 3163 32 3162 33 3161 34 3160 35 3159 36 3158 37 3157 38 3156 39 3155 40 3154 41 3153 42 3152 43 3151 44 3150 45 3149 46 3148 47 3147 48 3146 49 3145 50 3144 51 3143 52 3142 53 3141 54 3140 55 3139 56 3138 57 3137 58 3136 59 3135 60 3134 61 3133 62 3132 63 3131 64 3130 65 3129 ..."
},
{
"input": "3273",
"output": "1 3273 2 3272 3 3271 4 3270 5 3269 6 3268 7 3267 8 3266 9 3265 10 3264 11 3263 12 3262 13 3261 14 3260 15 3259 16 3258 17 3257 18 3256 19 3255 20 3254 21 3253 22 3252 23 3251 24 3250 25 3249 26 3248 27 3247 28 3246 29 3245 30 3244 31 3243 32 3242 33 3241 34 3240 35 3239 36 3238 37 3237 38 3236 39 3235 40 3234 41 3233 42 3232 43 3231 44 3230 45 3229 46 3228 47 3227 48 3226 49 3225 50 3224 51 3223 52 3222 53 3221 54 3220 55 3219 56 3218 57 3217 58 3216 59 3215 60 3214 61 3213 62 3212 63 3211 64 3210 65 3209 ..."
},
{
"input": "7000",
"output": "1 7000 2 6999 3 6998 4 6997 5 6996 6 6995 7 6994 8 6993 9 6992 10 6991 11 6990 12 6989 13 6988 14 6987 15 6986 16 6985 17 6984 18 6983 19 6982 20 6981 21 6980 22 6979 23 6978 24 6977 25 6976 26 6975 27 6974 28 6973 29 6972 30 6971 31 6970 32 6969 33 6968 34 6967 35 6966 36 6965 37 6964 38 6963 39 6962 40 6961 41 6960 42 6959 43 6958 44 6957 45 6956 46 6955 47 6954 48 6953 49 6952 50 6951 51 6950 52 6949 53 6948 54 6947 55 6946 56 6945 57 6944 58 6943 59 6942 60 6941 61 6940 62 6939 63 6938 64 6937 65 6936 ..."
},
{
"input": "7079",
"output": "1 7079 2 7078 3 7077 4 7076 5 7075 6 7074 7 7073 8 7072 9 7071 10 7070 11 7069 12 7068 13 7067 14 7066 15 7065 16 7064 17 7063 18 7062 19 7061 20 7060 21 7059 22 7058 23 7057 24 7056 25 7055 26 7054 27 7053 28 7052 29 7051 30 7050 31 7049 32 7048 33 7047 34 7046 35 7045 36 7044 37 7043 38 7042 39 7041 40 7040 41 7039 42 7038 43 7037 44 7036 45 7035 46 7034 47 7033 48 7032 49 7031 50 7030 51 7029 52 7028 53 7027 54 7026 55 7025 56 7024 57 7023 58 7022 59 7021 60 7020 61 7019 62 7018 63 7017 64 7016 65 7015 ..."
},
{
"input": "4653",
"output": "1 4653 2 4652 3 4651 4 4650 5 4649 6 4648 7 4647 8 4646 9 4645 10 4644 11 4643 12 4642 13 4641 14 4640 15 4639 16 4638 17 4637 18 4636 19 4635 20 4634 21 4633 22 4632 23 4631 24 4630 25 4629 26 4628 27 4627 28 4626 29 4625 30 4624 31 4623 32 4622 33 4621 34 4620 35 4619 36 4618 37 4617 38 4616 39 4615 40 4614 41 4613 42 4612 43 4611 44 4610 45 4609 46 4608 47 4607 48 4606 49 4605 50 4604 51 4603 52 4602 53 4601 54 4600 55 4599 56 4598 57 4597 58 4596 59 4595 60 4594 61 4593 62 4592 63 4591 64 4590 65 4589 ..."
},
{
"input": "9995",
"output": "1 9995 2 9994 3 9993 4 9992 5 9991 6 9990 7 9989 8 9988 9 9987 10 9986 11 9985 12 9984 13 9983 14 9982 15 9981 16 9980 17 9979 18 9978 19 9977 20 9976 21 9975 22 9974 23 9973 24 9972 25 9971 26 9970 27 9969 28 9968 29 9967 30 9966 31 9965 32 9964 33 9963 34 9962 35 9961 36 9960 37 9959 38 9958 39 9957 40 9956 41 9955 42 9954 43 9953 44 9952 45 9951 46 9950 47 9949 48 9948 49 9947 50 9946 51 9945 52 9944 53 9943 54 9942 55 9941 56 9940 57 9939 58 9938 59 9937 60 9936 61 9935 62 9934 63 9933 64 9932 65 9931 ..."
},
{
"input": "9996",
"output": "1 9996 2 9995 3 9994 4 9993 5 9992 6 9991 7 9990 8 9989 9 9988 10 9987 11 9986 12 9985 13 9984 14 9983 15 9982 16 9981 17 9980 18 9979 19 9978 20 9977 21 9976 22 9975 23 9974 24 9973 25 9972 26 9971 27 9970 28 9969 29 9968 30 9967 31 9966 32 9965 33 9964 34 9963 35 9962 36 9961 37 9960 38 9959 39 9958 40 9957 41 9956 42 9955 43 9954 44 9953 45 9952 46 9951 47 9950 48 9949 49 9948 50 9947 51 9946 52 9945 53 9944 54 9943 55 9942 56 9941 57 9940 58 9939 59 9938 60 9937 61 9936 62 9935 63 9934 64 9933 65 9932 ..."
},
{
"input": "9997",
"output": "1 9997 2 9996 3 9995 4 9994 5 9993 6 9992 7 9991 8 9990 9 9989 10 9988 11 9987 12 9986 13 9985 14 9984 15 9983 16 9982 17 9981 18 9980 19 9979 20 9978 21 9977 22 9976 23 9975 24 9974 25 9973 26 9972 27 9971 28 9970 29 9969 30 9968 31 9967 32 9966 33 9965 34 9964 35 9963 36 9962 37 9961 38 9960 39 9959 40 9958 41 9957 42 9956 43 9955 44 9954 45 9953 46 9952 47 9951 48 9950 49 9949 50 9948 51 9947 52 9946 53 9945 54 9944 55 9943 56 9942 57 9941 58 9940 59 9939 60 9938 61 9937 62 9936 63 9935 64 9934 65 9933 ..."
},
{
"input": "9998",
"output": "1 9998 2 9997 3 9996 4 9995 5 9994 6 9993 7 9992 8 9991 9 9990 10 9989 11 9988 12 9987 13 9986 14 9985 15 9984 16 9983 17 9982 18 9981 19 9980 20 9979 21 9978 22 9977 23 9976 24 9975 25 9974 26 9973 27 9972 28 9971 29 9970 30 9969 31 9968 32 9967 33 9966 34 9965 35 9964 36 9963 37 9962 38 9961 39 9960 40 9959 41 9958 42 9957 43 9956 44 9955 45 9954 46 9953 47 9952 48 9951 49 9950 50 9949 51 9948 52 9947 53 9946 54 9945 55 9944 56 9943 57 9942 58 9941 59 9940 60 9939 61 9938 62 9937 63 9936 64 9935 65 9934 ..."
},
{
"input": "9999",
"output": "1 9999 2 9998 3 9997 4 9996 5 9995 6 9994 7 9993 8 9992 9 9991 10 9990 11 9989 12 9988 13 9987 14 9986 15 9985 16 9984 17 9983 18 9982 19 9981 20 9980 21 9979 22 9978 23 9977 24 9976 25 9975 26 9974 27 9973 28 9972 29 9971 30 9970 31 9969 32 9968 33 9967 34 9966 35 9965 36 9964 37 9963 38 9962 39 9961 40 9960 41 9959 42 9958 43 9957 44 9956 45 9955 46 9954 47 9953 48 9952 49 9951 50 9950 51 9949 52 9948 53 9947 54 9946 55 9945 56 9944 57 9943 58 9942 59 9941 60 9940 61 9939 62 9938 63 9937 64 9936 65 9935 ..."
},
{
"input": "10000",
"output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951 51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 9936..."
}
] | 1,621,862,488
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 22
| 186
| 5,529,600
|
def solve():
n = int(input())
j=0
i=1
k=n
# print("k")
s = ""
if n%2==0:
while j<n:
s = s + str(k)+" "+str(i)+" "
k-=1
i+=1
j+=2
else:
while j<n-1:
s = s + str(k)+" "+str(i)+" "
i+=1
k-=1
j+=2
s+=str(i)
print(s)
return
try:
solve()
except:
pass
|
Title: Little Frog
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once upon a time a little frog whose name was Vasya decided to travel around his home swamp. Overall there are *n* mounds on the swamp, located on one line. The distance between the neighboring mounds is one meter. Vasya wants to visit all the mounds in one day; besides, he wants to visit each one exactly once. For that he makes a route plan, to decide the order in which to jump on the mounds. Vasya can pick any mound as the first one. He thinks it boring to jump two times at the same distance. That's why he wants any two jumps on his route to have different lengths. Help Vasya the Frog and make the plan for him.
Input Specification:
The single line contains a number *n* (1<=≤<=*n*<=≤<=104) which is the number of mounds.
Output Specification:
Print *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*) which are the frog's route plan.
- All the *p**i*'s should be mutually different. - All the |*p**i*–*p**i*<=+<=1|'s should be mutually different (1<=≤<=*i*<=≤<=*n*<=-<=1).
If there are several solutions, output any.
Demo Input:
['2\n', '3\n']
Demo Output:
['1 2 ', '1 3 2 ']
Note:
none
|
```python
def solve():
n = int(input())
j=0
i=1
k=n
# print("k")
s = ""
if n%2==0:
while j<n:
s = s + str(k)+" "+str(i)+" "
k-=1
i+=1
j+=2
else:
while j<n-1:
s = s + str(k)+" "+str(i)+" "
i+=1
k-=1
j+=2
s+=str(i)
print(s)
return
try:
solve()
except:
pass
```
| 3.9432
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,687,933,698
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 46
| 0
|
n,c=map(int,input().split())
students=list(map(int,input().split()))
count=0
for i in students:
sub=(5-c)
if(sub>=i):
count+=1
ans=count//3
print(ans)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
n,c=map(int,input().split())
students=list(map(int,input().split()))
count=0
for i in students:
sub=(5-c)
if(sub>=i):
count+=1
ans=count//3
print(ans)
```
| 3
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.