contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
262
|
B
|
Roma and Changing Signs
|
PROGRAMMING
| 1,200
|
[
"greedy"
] | null | null |
Roma works in a company that sells TVs. Now he has to prepare a report for the last year.
Roma has got a list of the company's incomes. The list is a sequence that consists of *n* integers. The total income of the company is the sum of all integers in sequence. Roma decided to perform exactly *k* changes of signs of several numbers in the sequence. He can also change the sign of a number one, two or more times.
The operation of changing a number's sign is the operation of multiplying this number by -1.
Help Roma perform the changes so as to make the total income of the company (the sum of numbers in the resulting sequence) maximum. Note that Roma should perform exactly *k* changes.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=105), showing, how many numbers are in the sequence and how many swaps are to be made.
The second line contains a non-decreasing sequence, consisting of *n* integers *a**i* (|*a**i*|<=≤<=104).
The numbers in the lines are separated by single spaces. Please note that the given sequence is sorted in non-decreasing order.
|
In the single line print the answer to the problem — the maximum total income that we can obtain after exactly *k* changes.
|
[
"3 2\n-1 -1 1\n",
"3 1\n-1 -1 1\n"
] |
[
"3\n",
"1\n"
] |
In the first sample we can get sequence [1, 1, 1], thus the total income equals 3.
In the second test, the optimal strategy is to get sequence [-1, 1, 1], thus the total income equals 1.
| 1,000
|
[
{
"input": "3 2\n-1 -1 1",
"output": "3"
},
{
"input": "3 1\n-1 -1 1",
"output": "1"
},
{
"input": "17 27\n257 320 676 1136 2068 2505 2639 4225 4951 5786 7677 7697 7851 8337 8429 8469 9343",
"output": "81852"
},
{
"input": "69 28\n-9822 -9264 -9253 -9221 -9139 -9126 -9096 -8981 -8521 -8313 -8257 -8253 -7591 -7587 -7301 -7161 -7001 -6847 -6441 -6241 -5949 -5896 -5713 -5692 -5644 -5601 -5545 -5525 -5331 -5253 -5041 -5000 -4951 -4855 -4384 -4293 -4251 -4001 -3991 -3762 -3544 -3481 -3261 -2983 -2882 -2857 -2713 -2691 -2681 -2653 -2221 -2043 -2011 -1997 -1601 -1471 -1448 -1363 -1217 -1217 -1129 -961 -926 -801 -376 -327 -305 -174 -91",
"output": "102443"
},
{
"input": "12 28\n-6652 -6621 -6471 -5559 -5326 -4551 -4401 -4326 -3294 -1175 -1069 -43",
"output": "49488"
},
{
"input": "78 13\n-9961 -9922 -9817 -9813 -9521 -9368 -9361 -9207 -9153 -9124 -9008 -8981 -8951 -8911 -8551 -8479 -8245 -8216 -7988 -7841 -7748 -7741 -7734 -7101 -6846 -6804 -6651 -6526 -6519 -6463 -6297 -6148 -6090 -5845 -5209 -5201 -5161 -5061 -4537 -4529 -4433 -4370 -4266 -4189 -4125 -3945 -3843 -3777 -3751 -3476 -3461 -3279 -3205 -3001 -2889 -2761 -2661 -2521 -2481 -2305 -2278 -2269 -2225 -1648 -1524 -1476 -1353 -1097 -867 -785 -741 -711 -692 -440 -401 -225 -65 -41",
"output": "-147832"
},
{
"input": "4 1\n218 3441 4901 7601",
"output": "15725"
},
{
"input": "73 26\n-8497 -8363 -7603 -7388 -6830 -6827 -6685 -6389 -6237 -6099 -6013 -5565 -5465 -4965 -4947 -4201 -3851 -3793 -3421 -3410 -3201 -3169 -3156 -2976 -2701 -2623 -2321 -2169 -1469 -1221 -950 -926 -9 47 236 457 773 1321 1485 1545 1671 1736 2014 2137 2174 2301 2625 3181 3536 3851 4041 4685 4981 4987 5145 5163 5209 5249 6011 6337 6790 7254 7361 7407 7969 7982 8083 8251 8407 8735 9660 9855 9957",
"output": "315919"
},
{
"input": "53 5\n-9821 -9429 -9146 -8973 -8807 -8801 -8321 -7361 -7222 -7161 -6913 -5961 -4877 -4756 -4753 -4661 -3375 -3031 -2950 -2661 -2161 -2041 -1111 -1071 -905 -697 -397 323 772 1617 1752 2736 2737 3201 3465 4029 4121 4463 4561 4637 4814 6119 6610 6641 6961 7217 7523 8045 8610 8915 9004 9265 9576",
"output": "92703"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n10000",
"output": "-10000"
},
{
"input": "1 2\n-1",
"output": "-1"
},
{
"input": "2 1\n0 1",
"output": "1"
},
{
"input": "2 2\n-1 0",
"output": "1"
},
{
"input": "5 6\n-3 -2 -1 5 6",
"output": "15"
},
{
"input": "3 3\n-50 -10 30",
"output": "70"
},
{
"input": "4 4\n-100 -90 -80 1",
"output": "269"
},
{
"input": "4 3\n-3 -2 1 2",
"output": "6"
},
{
"input": "6 4\n-6 -3 -2 1 2 3",
"output": "15"
},
{
"input": "5 6\n-10 -9 -8 1 2",
"output": "28"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "2 2\n-1 3",
"output": "2"
},
{
"input": "4 7\n-3 -2 1 6",
"output": "10"
},
{
"input": "4 3\n-7 -6 1 5",
"output": "17"
},
{
"input": "4 4\n-5 -1 1 2",
"output": "9"
}
] | 1,662,106,820
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 154
| 7,270,400
|
n, m = map(int, input(). split())
arr = list(map(int, input(). split()))
q = 0
for i in range(min(n, m)):
if arr[i] < 0:
arr[i] *= (-1)
q += 1
else:
break
if m <= q:
print(sum(arr))
else:
if (m - q) % 2:
arr. sort()
print(sum(arr) - (arr[0] * 2))
else:
print(sum(arr))
|
Title: Roma and Changing Signs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Roma works in a company that sells TVs. Now he has to prepare a report for the last year.
Roma has got a list of the company's incomes. The list is a sequence that consists of *n* integers. The total income of the company is the sum of all integers in sequence. Roma decided to perform exactly *k* changes of signs of several numbers in the sequence. He can also change the sign of a number one, two or more times.
The operation of changing a number's sign is the operation of multiplying this number by -1.
Help Roma perform the changes so as to make the total income of the company (the sum of numbers in the resulting sequence) maximum. Note that Roma should perform exactly *k* changes.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=105), showing, how many numbers are in the sequence and how many swaps are to be made.
The second line contains a non-decreasing sequence, consisting of *n* integers *a**i* (|*a**i*|<=≤<=104).
The numbers in the lines are separated by single spaces. Please note that the given sequence is sorted in non-decreasing order.
Output Specification:
In the single line print the answer to the problem — the maximum total income that we can obtain after exactly *k* changes.
Demo Input:
['3 2\n-1 -1 1\n', '3 1\n-1 -1 1\n']
Demo Output:
['3\n', '1\n']
Note:
In the first sample we can get sequence [1, 1, 1], thus the total income equals 3.
In the second test, the optimal strategy is to get sequence [-1, 1, 1], thus the total income equals 1.
|
```python
n, m = map(int, input(). split())
arr = list(map(int, input(). split()))
q = 0
for i in range(min(n, m)):
if arr[i] < 0:
arr[i] *= (-1)
q += 1
else:
break
if m <= q:
print(sum(arr))
else:
if (m - q) % 2:
arr. sort()
print(sum(arr) - (arr[0] * 2))
else:
print(sum(arr))
```
| 3
|
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,663,421,072
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 59
| 62
| 0
|
import math
arr = list(map(int,input().split()))
ans = min(arr)
print(math.factorial(ans))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math
arr = list(map(int,input().split()))
ans = min(arr)
print(math.factorial(ans))
```
| 3
|
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,690,148,921
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 46
| 0
|
a, b = map(int, input().split())
count_a = 0
count_b = 0
count_c = 0
for i in range(1, 7):
if abs(a-i) < abs(b-i):
count_a += 1
elif abs(b-i) < abs(a-i):
count_b += 1
else:
count_c += 1
print(count_a, count_c, count_b)
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
a, b = map(int, input().split())
count_a = 0
count_b = 0
count_c = 0
for i in range(1, 7):
if abs(a-i) < abs(b-i):
count_a += 1
elif abs(b-i) < abs(a-i):
count_b += 1
else:
count_c += 1
print(count_a, count_c, count_b)
```
| 3
|
|
914
|
B
|
Conan and Agasa play a Card Game
|
PROGRAMMING
| 1,200
|
[
"games",
"greedy",
"implementation"
] | null | null |
Edogawa Conan got tired of solving cases, and invited his friend, Professor Agasa, over. They decided to play a game of cards. Conan has *n* cards, and the *i*-th card has a number *a**i* written on it.
They take turns playing, starting with Conan. In each turn, the player chooses a card and removes it. Also, he removes all cards having a number strictly lesser than the number on the chosen card. Formally, if the player chooses the *i*-th card, he removes that card and removes the *j*-th card for all *j* such that *a**j*<=<<=*a**i*.
A player loses if he cannot make a move on his turn, that is, he loses if there are no cards left. Predict the outcome of the game, assuming both players play optimally.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of cards Conan has.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105), where *a**i* is the number on the *i*-th card.
|
If Conan wins, print "Conan" (without quotes), otherwise print "Agasa" (without quotes).
|
[
"3\n4 5 7\n",
"2\n1 1\n"
] |
[
"Conan\n",
"Agasa\n"
] |
In the first example, Conan can just choose the card having number 7 on it and hence remove all the cards. After that, there are no cards left on Agasa's turn.
In the second example, no matter which card Conan chooses, there will be one one card left, which Agasa can choose. After that, there are no cards left when it becomes Conan's turn again.
| 1,000
|
[
{
"input": "3\n4 5 7",
"output": "Conan"
},
{
"input": "2\n1 1",
"output": "Agasa"
},
{
"input": "10\n38282 53699 38282 38282 38282 38282 38282 38282 38282 38282",
"output": "Conan"
},
{
"input": "10\n50165 50165 50165 50165 50165 50165 50165 50165 50165 50165",
"output": "Agasa"
},
{
"input": "10\n83176 83176 83176 23495 83176 8196 83176 23495 83176 83176",
"output": "Conan"
},
{
"input": "10\n32093 36846 32093 32093 36846 36846 36846 36846 36846 36846",
"output": "Conan"
},
{
"input": "3\n1 2 3",
"output": "Conan"
},
{
"input": "4\n2 3 4 5",
"output": "Conan"
},
{
"input": "10\n30757 30757 33046 41744 39918 39914 41744 39914 33046 33046",
"output": "Conan"
},
{
"input": "10\n50096 50096 50096 50096 50096 50096 28505 50096 50096 50096",
"output": "Conan"
},
{
"input": "10\n54842 54842 54842 54842 57983 54842 54842 57983 57983 54842",
"output": "Conan"
},
{
"input": "10\n87900 87900 5761 87900 87900 87900 5761 87900 87900 87900",
"output": "Agasa"
},
{
"input": "10\n53335 35239 26741 35239 35239 26741 35239 35239 53335 35239",
"output": "Agasa"
},
{
"input": "10\n75994 64716 75994 64716 75994 75994 56304 64716 56304 64716",
"output": "Agasa"
},
{
"input": "1\n1",
"output": "Conan"
},
{
"input": "5\n2 2 1 1 1",
"output": "Conan"
},
{
"input": "5\n1 4 4 5 5",
"output": "Conan"
},
{
"input": "3\n1 3 3",
"output": "Conan"
},
{
"input": "3\n2 2 2",
"output": "Conan"
},
{
"input": "5\n1 1 1 2 2",
"output": "Conan"
},
{
"input": "4\n1 2 1 2",
"output": "Agasa"
},
{
"input": "7\n7 7 7 7 6 6 6",
"output": "Conan"
},
{
"input": "3\n2 3 3",
"output": "Conan"
},
{
"input": "3\n1 1 100000",
"output": "Conan"
},
{
"input": "1\n100000",
"output": "Conan"
},
{
"input": "5\n3 3 3 4 4",
"output": "Conan"
},
{
"input": "3\n1 2 2",
"output": "Conan"
},
{
"input": "3\n4 4 5",
"output": "Conan"
},
{
"input": "1\n2",
"output": "Conan"
},
{
"input": "3\n97 97 100",
"output": "Conan"
},
{
"input": "5\n100000 100000 100000 1 1",
"output": "Conan"
},
{
"input": "7\n7 7 6 6 5 5 4",
"output": "Conan"
},
{
"input": "5\n100000 100000 100000 2 2",
"output": "Conan"
},
{
"input": "4\n3 3 2 1",
"output": "Conan"
},
{
"input": "1\n485",
"output": "Conan"
},
{
"input": "3\n4 4 100000",
"output": "Conan"
},
{
"input": "3\n1 1 2",
"output": "Conan"
},
{
"input": "3\n1 1 1",
"output": "Conan"
},
{
"input": "5\n1 1 2 2 2",
"output": "Conan"
}
] | 1,572,452,747
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 91
| 187
| 10,035,200
|
input()
d={}
c=0
for i in input().split():
d[i] = d.get(i,0)+1;c+=d[i]%2*2-1
print(["Conan","Agasa"][not c])
|
Title: Conan and Agasa play a Card Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Edogawa Conan got tired of solving cases, and invited his friend, Professor Agasa, over. They decided to play a game of cards. Conan has *n* cards, and the *i*-th card has a number *a**i* written on it.
They take turns playing, starting with Conan. In each turn, the player chooses a card and removes it. Also, he removes all cards having a number strictly lesser than the number on the chosen card. Formally, if the player chooses the *i*-th card, he removes that card and removes the *j*-th card for all *j* such that *a**j*<=<<=*a**i*.
A player loses if he cannot make a move on his turn, that is, he loses if there are no cards left. Predict the outcome of the game, assuming both players play optimally.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of cards Conan has.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105), where *a**i* is the number on the *i*-th card.
Output Specification:
If Conan wins, print "Conan" (without quotes), otherwise print "Agasa" (without quotes).
Demo Input:
['3\n4 5 7\n', '2\n1 1\n']
Demo Output:
['Conan\n', 'Agasa\n']
Note:
In the first example, Conan can just choose the card having number 7 on it and hence remove all the cards. After that, there are no cards left on Agasa's turn.
In the second example, no matter which card Conan chooses, there will be one one card left, which Agasa can choose. After that, there are no cards left when it becomes Conan's turn again.
|
```python
input()
d={}
c=0
for i in input().split():
d[i] = d.get(i,0)+1;c+=d[i]%2*2-1
print(["Conan","Agasa"][not c])
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,693,131,530
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
x,y,z = map(int,input().split())
min_dist = float('inf')
xy = abs(x-y)
xz = abs(x-z)
yz = abs(y-z)
if xy+xz < min_dist:
min_dist = xy+xz
if xy+yz < min_dist:
min_dist = xy+yz
if xz+yz < min_dist:
min_dist = xz + yz
print(min_dist)
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
x,y,z = map(int,input().split())
min_dist = float('inf')
xy = abs(x-y)
xz = abs(x-z)
yz = abs(y-z)
if xy+xz < min_dist:
min_dist = xy+xz
if xy+yz < min_dist:
min_dist = xy+yz
if xz+yz < min_dist:
min_dist = xz + yz
print(min_dist)
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,544,188,931
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 218
| 0
|
x=eval(input())
l=list(map(int,input().split()))
i = 0
ev=0
odd=0
while(i<x):
if (l[i]%2==0):
ev+=1
else:
odd+=1
i+=1
i=0
if ev==1:
while(i<x):
if (l[i]%2==0):
print(i+1)
break
i+=1
else:
while(i<x):
if (l[i]%2!=0):
print(i+1)
break
i+=1
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
x=eval(input())
l=list(map(int,input().split()))
i = 0
ev=0
odd=0
while(i<x):
if (l[i]%2==0):
ev+=1
else:
odd+=1
i+=1
i=0
if ev==1:
while(i<x):
if (l[i]%2==0):
print(i+1)
break
i+=1
else:
while(i<x):
if (l[i]%2!=0):
print(i+1)
break
i+=1
```
| 3.9455
|
152
|
A
|
Marks
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Vasya, or Mr. Vasily Petrov is a dean of a department in a local university. After the winter exams he got his hands on a group's gradebook.
Overall the group has *n* students. They received marks for *m* subjects. Each student got a mark from 1 to 9 (inclusive) for each subject.
Let's consider a student the best at some subject, if there is no student who got a higher mark for this subject. Let's consider a student successful, if there exists a subject he is the best at.
Your task is to find the number of successful students in the group.
|
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of students and the number of subjects, correspondingly. Next *n* lines each containing *m* characters describe the gradebook. Each character in the gradebook is a number from 1 to 9. Note that the marks in a rows are not sepatated by spaces.
|
Print the single number — the number of successful students in the given group.
|
[
"3 3\n223\n232\n112\n",
"3 5\n91728\n11828\n11111\n"
] |
[
"2\n",
"3\n"
] |
In the first sample test the student number 1 is the best at subjects 1 and 3, student 2 is the best at subjects 1 and 2, but student 3 isn't the best at any subject.
In the second sample test each student is the best at at least one subject.
| 500
|
[
{
"input": "3 3\n223\n232\n112",
"output": "2"
},
{
"input": "3 5\n91728\n11828\n11111",
"output": "3"
},
{
"input": "2 2\n48\n27",
"output": "1"
},
{
"input": "2 1\n4\n6",
"output": "1"
},
{
"input": "1 2\n57",
"output": "1"
},
{
"input": "1 1\n5",
"output": "1"
},
{
"input": "3 4\n2553\n6856\n5133",
"output": "2"
},
{
"input": "8 7\n6264676\n7854895\n3244128\n2465944\n8958761\n1378945\n3859353\n6615285",
"output": "6"
},
{
"input": "9 8\n61531121\n43529859\n18841327\n88683622\n98995641\n62741632\n57441743\n49396792\n63381994",
"output": "4"
},
{
"input": "10 20\n26855662887514171367\n48525577498621511535\n47683778377545341138\n47331616748732562762\n44876938191354974293\n24577238399664382695\n42724955594463126746\n79187344479926159359\n48349683283914388185\n82157191115518781898",
"output": "9"
},
{
"input": "20 15\n471187383859588\n652657222494199\n245695867594992\n726154672861295\n614617827782772\n862889444974692\n373977167653235\n645434268565473\n785993468314573\n722176861496755\n518276853323939\n723712762593348\n728935312568886\n373898548522463\n769777587165681\n247592995114377\n182375946483965\n497496542536127\n988239919677856\n859844339819143",
"output": "18"
},
{
"input": "13 9\n514562255\n322655246\n135162979\n733845982\n473117129\n513967187\n965649829\n799122777\n661249521\n298618978\n659352422\n747778378\n723261619",
"output": "11"
},
{
"input": "75 1\n2\n3\n8\n3\n2\n1\n3\n1\n5\n1\n5\n4\n8\n8\n4\n2\n5\n1\n7\n6\n3\n2\n2\n3\n5\n5\n2\n4\n7\n7\n9\n2\n9\n5\n1\n4\n9\n5\n2\n4\n6\n6\n3\n3\n9\n3\n3\n2\n3\n4\n2\n6\n9\n1\n1\n1\n1\n7\n2\n3\n2\n9\n7\n4\n9\n1\n7\n5\n6\n8\n3\n4\n3\n4\n6",
"output": "7"
},
{
"input": "92 3\n418\n665\n861\n766\n529\n416\n476\n676\n561\n995\n415\n185\n291\n176\n776\n631\n556\n488\n118\n188\n437\n496\n466\n131\n914\n118\n766\n365\n113\n897\n386\n639\n276\n946\n759\n169\n494\n837\n338\n351\n783\n311\n261\n862\n598\n132\n246\n982\n575\n364\n615\n347\n374\n368\n523\n132\n774\n161\n552\n492\n598\n474\n639\n681\n635\n342\n516\n483\n141\n197\n571\n336\n175\n596\n481\n327\n841\n133\n142\n146\n246\n396\n287\n582\n556\n996\n479\n814\n497\n363\n963\n162",
"output": "23"
},
{
"input": "100 1\n1\n6\n9\n1\n1\n5\n5\n4\n6\n9\n6\n1\n7\n8\n7\n3\n8\n8\n7\n6\n2\n1\n5\n8\n7\n3\n5\n4\n9\n7\n1\n2\n4\n1\n6\n5\n1\n3\n9\n4\n5\n8\n1\n2\n1\n9\n7\n3\n7\n1\n2\n2\n2\n2\n3\n9\n7\n2\n4\n7\n1\n6\n8\n1\n5\n6\n1\n1\n2\n9\n7\n4\n9\n1\n9\n4\n1\n3\n5\n2\n4\n4\n6\n5\n1\n4\n5\n8\n4\n7\n6\n5\n6\n9\n5\n8\n1\n5\n1\n6",
"output": "10"
},
{
"input": "100 2\n71\n87\n99\n47\n22\n87\n49\n73\n21\n12\n77\n43\n18\n41\n78\n62\n61\n16\n64\n89\n81\n54\n53\n92\n93\n94\n68\n93\n15\n68\n42\n93\n28\n19\n86\n16\n97\n17\n11\n43\n72\n76\n54\n95\n58\n53\n48\n45\n85\n85\n74\n21\n44\n51\n89\n75\n76\n17\n38\n62\n81\n22\n66\n59\n89\n85\n91\n87\n12\n97\n52\n87\n43\n89\n51\n58\n57\n98\n78\n68\n82\n41\n87\n29\n75\n72\n48\n14\n35\n71\n74\n91\n66\n67\n42\n98\n52\n54\n22\n41",
"output": "21"
},
{
"input": "5 20\n11111111111111111111\n11111111111111111111\n11111111111111111111\n99999999999999999999\n11111111111111111119",
"output": "2"
},
{
"input": "3 3\n111\n111\n999",
"output": "1"
},
{
"input": "3 3\n119\n181\n711",
"output": "3"
},
{
"input": "15 5\n91728\n11828\n11111\n91728\n11828\n11111\n91728\n11828\n11111\n91728\n11828\n11111\n91728\n11828\n11111",
"output": "15"
},
{
"input": "2 20\n22222222222222222222\n11111111111111111111",
"output": "1"
},
{
"input": "3 3\n233\n222\n111",
"output": "2"
},
{
"input": "4 15\n222222222222222\n111111111111119\n111111111111119\n111111111111111",
"output": "3"
},
{
"input": "4 1\n1\n9\n9\n9",
"output": "3"
},
{
"input": "3 3\n123\n321\n132",
"output": "3"
},
{
"input": "3 3\n113\n332\n322",
"output": "3"
},
{
"input": "2 100\n2222222222222222222222222222222222222222222222222222222222222222222222221222222222222222222222222222\n1111111111111111111111111111111111111111111111111111111111111111111111119111111111111111111111111111",
"output": "2"
},
{
"input": "3 3\n321\n231\n123",
"output": "3"
},
{
"input": "2 100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222",
"output": "1"
},
{
"input": "3 3\n221\n111\n111",
"output": "3"
}
] | 1,547,227,241
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 124
| 0
|
n,m=list(map(int,input().split()))
l=[]
count=0
for i in range(n):
l.append(input())
final=[]
for i in range(m):
f=[]
for j in l:
f.append(int(j[i]))
r=max(f)
for k in range(n):
if r==f[k] and k+1 not in final:
count+=1
final.append(k+1)
print(count)
|
Title: Marks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya, or Mr. Vasily Petrov is a dean of a department in a local university. After the winter exams he got his hands on a group's gradebook.
Overall the group has *n* students. They received marks for *m* subjects. Each student got a mark from 1 to 9 (inclusive) for each subject.
Let's consider a student the best at some subject, if there is no student who got a higher mark for this subject. Let's consider a student successful, if there exists a subject he is the best at.
Your task is to find the number of successful students in the group.
Input Specification:
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of students and the number of subjects, correspondingly. Next *n* lines each containing *m* characters describe the gradebook. Each character in the gradebook is a number from 1 to 9. Note that the marks in a rows are not sepatated by spaces.
Output Specification:
Print the single number — the number of successful students in the given group.
Demo Input:
['3 3\n223\n232\n112\n', '3 5\n91728\n11828\n11111\n']
Demo Output:
['2\n', '3\n']
Note:
In the first sample test the student number 1 is the best at subjects 1 and 3, student 2 is the best at subjects 1 and 2, but student 3 isn't the best at any subject.
In the second sample test each student is the best at at least one subject.
|
```python
n,m=list(map(int,input().split()))
l=[]
count=0
for i in range(n):
l.append(input())
final=[]
for i in range(m):
f=[]
for j in l:
f.append(int(j[i]))
r=max(f)
for k in range(n):
if r==f[k] and k+1 not in final:
count+=1
final.append(k+1)
print(count)
```
| 3
|
|
443
|
A
|
Anton and Letters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
|
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
|
Print a single number — the number of distinct letters in Anton's set.
|
[
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] |
[
"3\n",
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,686,659,293
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 62
| 0
|
input_str = input()
input_str = input_str[1:-1]
if input_str:
letters = input_str.split(", ")
distinct_letters = set(letters)
count = len(distinct_letters)
else:
count = 0
print(count)
|
Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number — the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none
|
```python
input_str = input()
input_str = input_str[1:-1]
if input_str:
letters = input_str.split(", ")
distinct_letters = set(letters)
count = len(distinct_letters)
else:
count = 0
print(count)
```
| 3
|
|
999
|
A
|
Mishka and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
|
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
|
Print one integer — the maximum number of problems Mishka can solve.
|
[
"8 4\n4 2 3 1 5 1 6 4\n",
"5 2\n3 1 2 1 3\n",
"5 100\n12 34 55 43 21\n"
] |
[
"5\n",
"0\n",
"5\n"
] |
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
| 0
|
[
{
"input": "8 4\n4 2 3 1 5 1 6 4",
"output": "5"
},
{
"input": "5 2\n3 1 2 1 3",
"output": "0"
},
{
"input": "5 100\n12 34 55 43 21",
"output": "5"
},
{
"input": "100 100\n44 47 36 83 76 94 86 69 31 2 22 77 37 51 10 19 25 78 53 25 1 29 48 95 35 53 22 72 49 86 60 38 13 91 89 18 54 19 71 2 25 33 65 49 53 5 95 90 100 68 25 5 87 48 45 72 34 14 100 44 94 75 80 26 25 7 57 82 49 73 55 43 42 60 34 8 51 11 71 41 81 23 20 89 12 72 68 26 96 92 32 63 13 47 19 9 35 56 79 62",
"output": "100"
},
{
"input": "100 99\n84 82 43 4 71 3 30 92 15 47 76 43 2 17 76 4 1 33 24 96 44 98 75 99 59 11 73 27 67 17 8 88 69 41 44 22 91 48 4 46 42 21 21 67 85 51 57 84 11 100 100 59 39 72 89 82 74 19 98 14 37 97 20 78 38 52 44 83 19 83 69 32 56 6 93 13 98 80 80 2 33 71 11 15 55 51 98 58 16 91 39 32 83 58 77 79 88 81 17 98",
"output": "98"
},
{
"input": "100 69\n80 31 12 89 16 35 8 28 39 12 32 51 42 67 64 53 17 88 63 97 29 41 57 28 51 33 82 75 93 79 57 86 32 100 83 82 99 33 1 27 86 22 65 15 60 100 42 37 38 85 26 43 90 62 91 13 1 92 16 20 100 19 28 30 23 6 5 69 24 22 9 1 10 14 28 14 25 9 32 8 67 4 39 7 10 57 15 7 8 35 62 6 53 59 62 13 24 7 53 2",
"output": "39"
},
{
"input": "100 2\n2 2 2 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 2 1 1 1 2 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 16",
"output": "99"
},
{
"input": "100 3\n86 53 82 40 2 20 59 2 46 63 75 49 24 81 70 22 9 9 93 72 47 23 29 77 78 51 17 59 19 71 35 3 20 60 70 9 11 96 71 94 91 19 88 93 50 49 72 19 53 30 38 67 62 71 81 86 5 26 5 32 63 98 1 97 22 32 87 65 96 55 43 85 56 37 56 67 12 100 98 58 77 54 18 20 33 53 21 66 24 64 42 71 59 32 51 69 49 79 10 1",
"output": "1"
},
{
"input": "13 7\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "1 5\n4",
"output": "1"
},
{
"input": "3 2\n1 4 1",
"output": "2"
},
{
"input": "1 2\n100",
"output": "0"
},
{
"input": "7 4\n4 2 3 4 4 2 3",
"output": "7"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "1 2\n15",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "5 3\n3 4 3 2 1",
"output": "4"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "1 5\n1",
"output": "1"
},
{
"input": "6 6\n7 1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n6 5 5 5 5",
"output": "4"
},
{
"input": "1 4\n2",
"output": "1"
},
{
"input": "9 4\n1 2 1 2 4 2 1 2 1",
"output": "9"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n5",
"output": "1"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "100 10\n2 5 1 10 10 2 7 7 9 4 1 8 1 1 8 4 7 9 10 5 7 9 5 6 7 2 7 5 3 2 1 82 4 80 9 8 6 1 10 7 5 7 1 5 6 7 19 4 2 4 6 2 1 8 31 6 2 2 57 42 3 2 7 1 9 5 10 8 5 4 10 8 3 5 8 7 2 7 6 5 3 3 4 10 6 7 10 8 7 10 7 2 4 6 8 10 10 2 6 4",
"output": "71"
},
{
"input": "100 90\n17 16 5 51 17 62 24 45 49 41 90 30 19 78 67 66 59 34 28 47 42 8 33 77 90 41 61 16 86 33 43 71 90 95 23 9 56 41 24 90 31 12 77 36 90 67 47 15 92 50 79 88 42 19 21 79 86 60 41 26 47 4 70 62 44 90 82 89 84 91 54 16 90 53 29 69 21 44 18 28 88 74 56 43 12 76 10 22 34 24 27 52 28 76 90 75 5 29 50 90",
"output": "63"
},
{
"input": "100 10\n6 4 8 4 1 9 4 8 5 2 2 5 2 6 10 2 2 5 3 5 2 3 10 5 2 9 1 1 6 1 5 9 16 42 33 49 26 31 81 27 53 63 81 90 55 97 70 51 87 21 79 62 60 91 54 95 26 26 30 61 87 79 47 11 59 34 40 82 37 40 81 2 7 1 8 4 10 7 1 10 8 7 3 5 2 8 3 3 9 2 1 1 5 7 8 7 1 10 9 8",
"output": "61"
},
{
"input": "100 90\n45 57 52 69 17 81 85 60 59 39 55 14 87 90 90 31 41 57 35 89 74 20 53 4 33 49 71 11 46 90 71 41 71 90 63 74 51 13 99 92 99 91 100 97 93 40 93 96 100 99 100 92 98 96 78 91 91 91 91 100 94 97 95 97 96 95 17 13 45 35 54 26 2 74 6 51 20 3 73 90 90 42 66 43 86 28 84 70 37 27 90 30 55 80 6 58 57 51 10 22",
"output": "72"
},
{
"input": "100 10\n10 2 10 10 10 10 10 10 10 7 10 10 10 10 10 10 9 10 10 10 10 10 10 10 10 7 9 10 10 10 37 10 4 10 10 10 59 5 95 10 10 10 10 39 10 10 10 10 10 10 10 5 10 10 10 10 10 10 10 10 10 10 10 10 66 10 10 10 10 10 5 10 10 10 10 10 10 44 10 10 10 10 10 10 10 10 10 10 10 7 10 10 10 10 10 10 10 10 10 2",
"output": "52"
},
{
"input": "100 90\n57 90 90 90 90 90 90 90 81 90 3 90 39 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 92 90 90 90 90 90 90 90 90 98 90 90 90 90 90 90 90 90 90 90 90 90 90 54 90 90 90 90 90 62 90 90 91 90 90 90 90 90 90 91 90 90 90 90 90 90 90 3 90 90 90 90 90 90 90 2 90 90 90 90 90 90 90 90 90 2 90 90 90 90 90",
"output": "60"
},
{
"input": "100 10\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 78 90 61 40 87 39 91 50 64 30 10 24 10 55 28 11 28 35 26 26 10 57 45 67 14 99 96 51 67 79 59 11 21 55 70 33 10 16 92 70 38 50 66 52 5 10 10 10 2 4 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 10 10 10 10 8 10 10 10 10 10",
"output": "56"
},
{
"input": "100 90\n90 90 90 90 90 90 55 21 90 90 90 90 90 90 90 90 90 90 69 83 90 90 90 90 90 90 90 90 93 95 92 98 92 97 91 92 92 91 91 95 94 95 100 100 96 97 94 93 90 90 95 95 97 99 90 95 98 91 94 96 99 99 94 95 95 97 99 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 12 90 3 90 90 90 90 90 90 90",
"output": "61"
},
{
"input": "100 49\n71 25 14 36 36 48 36 49 28 40 49 49 49 38 40 49 33 22 49 49 14 46 8 44 49 11 37 49 40 49 2 49 3 49 37 49 49 11 25 49 49 32 49 11 49 30 16 21 49 49 23 24 30 49 49 49 49 49 49 27 49 42 49 49 20 32 30 29 35 49 30 49 9 49 27 25 5 49 49 42 49 20 49 35 49 22 15 49 49 49 19 49 29 28 13 49 22 7 6 24",
"output": "99"
},
{
"input": "100 50\n38 68 9 6 50 18 19 50 50 20 33 34 43 50 24 50 50 2 50 50 50 50 50 21 30 50 41 40 50 50 50 50 50 7 50 21 19 23 1 50 24 50 50 50 25 50 50 50 50 50 50 50 7 24 28 18 50 5 43 50 20 50 13 50 50 16 50 3 2 24 50 50 18 5 50 4 50 50 38 50 33 49 12 33 11 14 50 50 50 33 50 50 50 50 50 50 7 4 50 50",
"output": "99"
},
{
"input": "100 48\n8 6 23 47 29 48 48 48 48 48 48 26 24 48 48 48 3 48 27 28 41 45 9 29 48 48 48 48 48 48 48 48 48 48 47 23 48 48 48 5 48 22 40 48 48 48 20 48 48 57 48 32 19 48 33 2 4 19 48 48 39 48 16 48 48 44 48 48 48 48 29 14 25 43 46 7 48 19 30 48 18 8 39 48 30 47 35 18 48 45 48 48 30 13 48 48 48 17 9 48",
"output": "99"
},
{
"input": "100 57\n57 9 57 4 43 57 57 57 57 26 57 18 57 57 57 57 57 57 57 47 33 57 57 43 57 57 55 57 14 57 57 4 1 57 57 57 57 57 46 26 57 57 57 57 57 57 57 39 57 57 57 5 57 12 11 57 57 57 25 37 34 57 54 18 29 57 39 57 5 57 56 34 57 24 7 57 57 57 2 57 57 57 57 1 55 39 19 57 57 57 57 21 3 40 13 3 57 57 62 57",
"output": "99"
},
{
"input": "100 51\n51 51 38 51 51 45 51 51 51 18 51 36 51 19 51 26 37 51 11 51 45 34 51 21 51 51 33 51 6 51 51 51 21 47 51 13 51 51 30 29 50 51 51 51 51 51 51 45 14 51 2 51 51 23 9 51 50 23 51 29 34 51 40 32 1 36 31 51 11 51 51 47 51 51 51 51 51 51 51 50 39 51 14 4 4 12 3 11 51 51 51 51 41 51 51 51 49 37 5 93",
"output": "99"
},
{
"input": "100 50\n87 91 95 73 50 50 16 97 39 24 58 50 33 89 42 37 50 50 12 71 3 55 50 50 80 10 76 50 52 36 88 44 66 69 86 71 77 50 72 50 21 55 50 50 78 61 75 89 65 2 50 69 62 47 11 92 97 77 41 31 55 29 35 51 36 48 50 91 92 86 50 36 50 94 51 74 4 27 55 63 50 36 87 50 67 7 65 75 20 96 88 50 41 73 35 51 66 21 29 33",
"output": "3"
},
{
"input": "100 50\n50 37 28 92 7 76 50 50 50 76 100 57 50 50 50 32 76 50 8 72 14 8 50 91 67 50 55 82 50 50 24 97 88 50 59 61 68 86 44 15 61 67 88 50 40 50 36 99 1 23 63 50 88 59 76 82 99 76 68 50 50 30 31 68 57 98 71 12 15 60 35 79 90 6 67 50 50 50 50 68 13 6 50 50 16 87 84 50 67 67 50 64 50 58 50 50 77 51 50 51",
"output": "3"
},
{
"input": "100 50\n43 50 50 91 97 67 6 50 86 50 76 60 50 59 4 56 11 38 49 50 37 50 50 20 60 47 33 54 95 58 22 50 77 77 72 9 57 40 81 57 95 50 81 63 62 76 13 87 50 39 74 69 50 99 63 1 11 62 84 31 97 99 56 73 70 36 45 100 28 91 93 9 19 52 73 50 83 58 84 52 86 12 50 44 64 52 97 50 12 71 97 52 87 66 83 66 86 50 9 49",
"output": "6"
},
{
"input": "88 10\n10 8 1 10 10 1 3 7 10 5 8 8 10 2 7 10 10 10 10 10 1 10 10 10 10 1 2 9 10 9 10 10 10 64 100 25 10 12 9 52 13 8 10 56 10 4 10 7 10 3 10 79 74 8 73 10 10 10 9 10 3 5 10 10 10 5 1 10 10 4 3 10 10 10 4 10 6 4 10 10 10 10 3 3 8 5 6 8",
"output": "66"
},
{
"input": "100 50\n80 39 33 69 75 50 23 88 50 50 67 90 87 50 29 15 55 32 60 50 50 50 38 95 62 50 50 88 8 97 45 50 42 12 22 93 49 50 24 50 50 71 60 4 50 72 57 57 50 50 50 83 69 17 1 31 72 55 50 11 50 80 93 41 91 94 20 60 50 50 51 48 53 56 76 73 50 72 19 98 50 50 50 50 50 28 48 45 62 11 16 67 93 88 63 50 50 66 48 95",
"output": "0"
},
{
"input": "100 50\n70 50 38 50 38 50 32 30 50 31 26 42 50 33 34 50 50 50 28 21 50 44 50 47 50 50 9 40 50 50 50 50 50 42 50 50 16 50 50 3 24 50 50 50 4 26 50 2 50 50 33 1 27 50 50 50 8 29 50 23 33 50 6 29 50 50 15 50 50 50 32 50 43 50 50 50 31 50 4 50 50 31 50 50 31 16 50 17 50 17 31 13 25 16 50 10 50 47 50 66",
"output": "0"
},
{
"input": "2 8\n8 8",
"output": "2"
},
{
"input": "1 6\n3",
"output": "1"
},
{
"input": "1 5\n5",
"output": "1"
}
] | 1,618,145,586
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 48
| 108
| 0
|
k,n=[int(i) for i in input().split(" ")]
tasks=[int(i) for i in input().split(" ")]
stop=False
count=0
while((not stop) and (len(tasks)>0)):
if(tasks[0]<=n):
count+=1
del(tasks[0])
elif(tasks[-1]<=n):
count+=1
del(tasks[-1])
else:
stop=True
print(count)
|
Title: Mishka and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
Output Specification:
Print one integer — the maximum number of problems Mishka can solve.
Demo Input:
['8 4\n4 2 3 1 5 1 6 4\n', '5 2\n3 1 2 1 3\n', '5 100\n12 34 55 43 21\n']
Demo Output:
['5\n', '0\n', '5\n']
Note:
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
|
```python
k,n=[int(i) for i in input().split(" ")]
tasks=[int(i) for i in input().split(" ")]
stop=False
count=0
while((not stop) and (len(tasks)>0)):
if(tasks[0]<=n):
count+=1
del(tasks[0])
elif(tasks[-1]<=n):
count+=1
del(tasks[-1])
else:
stop=True
print(count)
```
| 3
|
|
681
|
A
|
A Good Contest
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
|
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
|
[
"3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n",
"3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n"
] |
[
"YES",
"NO"
] |
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
| 500
|
[
{
"input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "NO"
},
{
"input": "1\nDb -3373 3591",
"output": "NO"
},
{
"input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155",
"output": "NO"
},
{
"input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968",
"output": "NO"
},
{
"input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290",
"output": "NO"
},
{
"input": "1\na 2400 2401",
"output": "YES"
},
{
"input": "1\nfucker 4000 4000",
"output": "NO"
},
{
"input": "1\nJora 2400 2401",
"output": "YES"
},
{
"input": "1\nACA 2400 2420",
"output": "YES"
},
{
"input": "1\nAca 2400 2420",
"output": "YES"
},
{
"input": "1\nSub_d 2401 2402",
"output": "YES"
},
{
"input": "2\nHack 2400 2401\nDum 1243 555",
"output": "YES"
},
{
"input": "1\nXXX 2400 2500",
"output": "YES"
},
{
"input": "1\nfucker 2400 2401",
"output": "YES"
},
{
"input": "1\nX 2400 2500",
"output": "YES"
},
{
"input": "1\nvineet 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2500",
"output": "YES"
},
{
"input": "1\naaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nhoge 2400 2401",
"output": "YES"
},
{
"input": "1\nInfinity 2400 2468",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2401",
"output": "YES"
},
{
"input": "1\nFuck 2400 2401",
"output": "YES"
},
{
"input": "1\nfuck 2400 2401",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "YES"
},
{
"input": "1\nalex 2400 2401",
"output": "YES"
},
{
"input": "1\nA 2400 2401",
"output": "YES"
},
{
"input": "1\na 2400 2455",
"output": "YES"
},
{
"input": "1\nlol 2400 2401",
"output": "YES"
},
{
"input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214",
"output": "YES"
},
{
"input": "1\naaaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2500",
"output": "YES"
},
{
"input": "1\nds 2400 2410",
"output": "YES"
},
{
"input": "1\nas 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2401",
"output": "YES"
},
{
"input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537",
"output": "YES"
},
{
"input": "1\ncaonima 2400 2401",
"output": "YES"
},
{
"input": "1\narr 2400 2500",
"output": "YES"
},
{
"input": "1\nx 2400 2401",
"output": "YES"
},
{
"input": "1\narrr 2400 2500",
"output": "YES"
},
{
"input": "1\nabc 2400 2405",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2537",
"output": "YES"
},
{
"input": "1\nHELLO 2400 2401",
"output": "YES"
},
{
"input": "1\neatmore 2400 2500",
"output": "YES"
},
{
"input": "1\nb 2400 2401",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nApplejack 2400 2410",
"output": "YES"
},
{
"input": "1\nabacaba 2400 2451",
"output": "YES"
},
{
"input": "1\nrekt_n00b 2500 2600",
"output": "YES"
}
] | 1,580,735,872
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 109
| 0
|
n = int(input())
for i in range(n):
s , x , y = input().split()
x = int(x)
y = int(y)
if x < y and x >= 2400 :
print('YES')
break
else:
print('NO')
|
Title: A Good Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
Output Specification:
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
Demo Input:
['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
|
```python
n = int(input())
for i in range(n):
s , x , y = input().split()
x = int(x)
y = int(y)
if x < y and x >= 2400 :
print('YES')
break
else:
print('NO')
```
| 3
|
|
122
|
A
|
Lucky Division
|
PROGRAMMING
| 1,000
|
[
"brute force",
"number theory"
] | null | null |
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
|
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
|
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
|
[
"47\n",
"16\n",
"78\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
| 500
|
[
{
"input": "47",
"output": "YES"
},
{
"input": "16",
"output": "YES"
},
{
"input": "78",
"output": "NO"
},
{
"input": "48",
"output": "YES"
},
{
"input": "100",
"output": "YES"
},
{
"input": "107",
"output": "NO"
},
{
"input": "77",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "480",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "49",
"output": "YES"
},
{
"input": "56",
"output": "YES"
},
{
"input": "124",
"output": "YES"
},
{
"input": "1000",
"output": "YES"
},
{
"input": "999",
"output": "NO"
},
{
"input": "298",
"output": "NO"
},
{
"input": "274",
"output": "NO"
},
{
"input": "998",
"output": "NO"
},
{
"input": "42",
"output": "YES"
},
{
"input": "788",
"output": "YES"
},
{
"input": "70",
"output": "YES"
},
{
"input": "444",
"output": "YES"
},
{
"input": "777",
"output": "YES"
},
{
"input": "799",
"output": "YES"
},
{
"input": "25",
"output": "NO"
},
{
"input": "882",
"output": "YES"
},
{
"input": "88",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "7",
"output": "YES"
},
{
"input": "8",
"output": "YES"
},
{
"input": "94",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "141",
"output": "YES"
}
] | 1,698,214,739
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 36
| 124
| 1,536,000
|
n = int(input())
def isLucky(num):
return bool(str(num).replace('4', '').replace('7', '') == '')
yes = False
for i in range(n):
if isLucky(n) or (isLucky(i) and n%i == 0):
print("YES")
yes = True
break
if not yes: print("NO")
|
Title: Lucky Division
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
Output Specification:
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
Demo Input:
['47\n', '16\n', '78\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
|
```python
n = int(input())
def isLucky(num):
return bool(str(num).replace('4', '').replace('7', '') == '')
yes = False
for i in range(n):
if isLucky(n) or (isLucky(i) and n%i == 0):
print("YES")
yes = True
break
if not yes: print("NO")
```
| 3
|
|
544
|
B
|
Sea and Islands
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"implementation"
] | null | null |
A map of some object is a rectangular field consisting of *n* rows and *n* columns. Each cell is initially occupied by the sea but you can cover some some cells of the map with sand so that exactly *k* islands appear on the map. We will call a set of sand cells to be island if it is possible to get from each of them to each of them by moving only through sand cells and by moving from a cell only to a side-adjacent cell. The cells are called to be side-adjacent if they share a vertical or horizontal side. It is easy to see that islands do not share cells (otherwise they together form a bigger island).
Find a way to cover some cells with sand so that exactly *k* islands appear on the *n*<=×<=*n* map, or determine that no such way exists.
|
The single line contains two positive integers *n*, *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=*n*2) — the size of the map and the number of islands you should form.
|
If the answer doesn't exist, print "NO" (without the quotes) in a single line.
Otherwise, print "YES" in the first line. In the next *n* lines print the description of the map. Each of the lines of the description must consist only of characters 'S' and 'L', where 'S' is a cell that is occupied by the sea and 'L' is the cell covered with sand. The length of each line of the description must equal *n*.
If there are multiple answers, you may print any of them.
You should not maximize the sizes of islands.
|
[
"5 2\n",
"5 25\n"
] |
[
"YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS\n",
"NO\n"
] |
none
| 1,000
|
[
{
"input": "5 2",
"output": "YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS"
},
{
"input": "5 25",
"output": "NO"
},
{
"input": "82 6047",
"output": "NO"
},
{
"input": "6 5",
"output": "YES\nLSLSLS\nSLSLSS\nSSSSSS\nSSSSSS\nSSSSSS\nSSSSSS"
},
{
"input": "10 80",
"output": "NO"
},
{
"input": "48 1279",
"output": "NO"
},
{
"input": "40 1092",
"output": "NO"
},
{
"input": "9 12",
"output": "YES\nLSLSLSLSL\nSLSLSLSLS\nLSLSLSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS"
},
{
"input": "43 146",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSS..."
},
{
"input": "100 5000",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "100 4999",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "100 5001",
"output": "NO"
},
{
"input": "99 4901",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nS..."
},
{
"input": "99 4900",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nS..."
},
{
"input": "99 4902",
"output": "NO"
},
{
"input": "99 9801",
"output": "NO"
},
{
"input": "99 10",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "99 1",
"output": "YES\nLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "100 10000",
"output": "NO"
},
{
"input": "100 10",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS..."
},
{
"input": "50 1200",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL..."
},
{
"input": "50 1438",
"output": "NO"
},
{
"input": "50 2447",
"output": "NO"
},
{
"input": "49 1719",
"output": "NO"
},
{
"input": "51 1996",
"output": "NO"
},
{
"input": "51 1981",
"output": "NO"
},
{
"input": "34 1060",
"output": "NO"
},
{
"input": "74 3901",
"output": "NO"
},
{
"input": "65 617",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "89 497",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "34 621",
"output": "NO"
},
{
"input": "1 0",
"output": "YES\nS"
},
{
"input": "10 0",
"output": "YES\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS"
},
{
"input": "11 0",
"output": "YES\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS"
},
{
"input": "99 0",
"output": "YES\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "100 0",
"output": "YES\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS..."
},
{
"input": "1 1",
"output": "YES\nL"
},
{
"input": "2 1",
"output": "YES\nLS\nSS"
},
{
"input": "2 0",
"output": "YES\nSS\nSS"
},
{
"input": "2 2",
"output": "YES\nLS\nSL"
},
{
"input": "2 3",
"output": "NO"
},
{
"input": "2 4",
"output": "NO"
}
] | 1,610,548,599
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 77
| 409,600
|
n,k=input().split()
n,k=int(n),int(k)
if k>(n*n+1)//2:
print("NO")
exit()
print("YES")
for i in range(0,n):
for j in range(0,n):
if((i+j)%2==0and k>0):
print('L',end='')
k-=1
else:
print('S',end='')
print()
|
Title: Sea and Islands
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A map of some object is a rectangular field consisting of *n* rows and *n* columns. Each cell is initially occupied by the sea but you can cover some some cells of the map with sand so that exactly *k* islands appear on the map. We will call a set of sand cells to be island if it is possible to get from each of them to each of them by moving only through sand cells and by moving from a cell only to a side-adjacent cell. The cells are called to be side-adjacent if they share a vertical or horizontal side. It is easy to see that islands do not share cells (otherwise they together form a bigger island).
Find a way to cover some cells with sand so that exactly *k* islands appear on the *n*<=×<=*n* map, or determine that no such way exists.
Input Specification:
The single line contains two positive integers *n*, *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=*n*2) — the size of the map and the number of islands you should form.
Output Specification:
If the answer doesn't exist, print "NO" (without the quotes) in a single line.
Otherwise, print "YES" in the first line. In the next *n* lines print the description of the map. Each of the lines of the description must consist only of characters 'S' and 'L', where 'S' is a cell that is occupied by the sea and 'L' is the cell covered with sand. The length of each line of the description must equal *n*.
If there are multiple answers, you may print any of them.
You should not maximize the sizes of islands.
Demo Input:
['5 2\n', '5 25\n']
Demo Output:
['YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS\n', 'NO\n']
Note:
none
|
```python
n,k=input().split()
n,k=int(n),int(k)
if k>(n*n+1)//2:
print("NO")
exit()
print("YES")
for i in range(0,n):
for j in range(0,n):
if((i+j)%2==0and k>0):
print('L',end='')
k-=1
else:
print('S',end='')
print()
```
| 3
|
|
799
|
A
|
Carrot Cakes
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
|
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
|
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
|
[
"8 6 4 5\n",
"8 6 4 6\n",
"10 3 11 4\n",
"4 2 1 4\n"
] |
[
"YES\n",
"NO\n",
"NO\n",
"YES\n"
] |
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven.
| 500
|
[
{
"input": "8 6 4 5",
"output": "YES"
},
{
"input": "8 6 4 6",
"output": "NO"
},
{
"input": "10 3 11 4",
"output": "NO"
},
{
"input": "4 2 1 4",
"output": "YES"
},
{
"input": "28 17 16 26",
"output": "NO"
},
{
"input": "60 69 9 438",
"output": "NO"
},
{
"input": "599 97 54 992",
"output": "YES"
},
{
"input": "11 22 18 17",
"output": "NO"
},
{
"input": "1 13 22 11",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "NO"
},
{
"input": "3 1 1 1",
"output": "YES"
},
{
"input": "1000 1000 1000 1000",
"output": "NO"
},
{
"input": "1000 1000 1 1",
"output": "YES"
},
{
"input": "1000 1000 1 400",
"output": "YES"
},
{
"input": "1000 1000 1 1000",
"output": "YES"
},
{
"input": "1000 1000 1 999",
"output": "YES"
},
{
"input": "53 11 3 166",
"output": "YES"
},
{
"input": "313 2 3 385",
"output": "NO"
},
{
"input": "214 9 9 412",
"output": "NO"
},
{
"input": "349 9 5 268",
"output": "YES"
},
{
"input": "611 16 8 153",
"output": "YES"
},
{
"input": "877 13 3 191",
"output": "YES"
},
{
"input": "340 9 9 10",
"output": "YES"
},
{
"input": "31 8 2 205",
"output": "NO"
},
{
"input": "519 3 2 148",
"output": "YES"
},
{
"input": "882 2 21 219",
"output": "NO"
},
{
"input": "982 13 5 198",
"output": "YES"
},
{
"input": "428 13 6 272",
"output": "YES"
},
{
"input": "436 16 14 26",
"output": "YES"
},
{
"input": "628 10 9 386",
"output": "YES"
},
{
"input": "77 33 18 31",
"output": "YES"
},
{
"input": "527 36 4 8",
"output": "YES"
},
{
"input": "128 18 2 169",
"output": "YES"
},
{
"input": "904 4 2 288",
"output": "YES"
},
{
"input": "986 4 3 25",
"output": "YES"
},
{
"input": "134 8 22 162",
"output": "NO"
},
{
"input": "942 42 3 69",
"output": "YES"
},
{
"input": "894 4 9 4",
"output": "YES"
},
{
"input": "953 8 10 312",
"output": "YES"
},
{
"input": "43 8 1 121",
"output": "YES"
},
{
"input": "12 13 19 273",
"output": "NO"
},
{
"input": "204 45 10 871",
"output": "YES"
},
{
"input": "342 69 50 425",
"output": "NO"
},
{
"input": "982 93 99 875",
"output": "NO"
},
{
"input": "283 21 39 132",
"output": "YES"
},
{
"input": "1000 45 83 686",
"output": "NO"
},
{
"input": "246 69 36 432",
"output": "NO"
},
{
"input": "607 93 76 689",
"output": "NO"
},
{
"input": "503 21 24 435",
"output": "NO"
},
{
"input": "1000 45 65 989",
"output": "NO"
},
{
"input": "30 21 2 250",
"output": "YES"
},
{
"input": "1000 49 50 995",
"output": "NO"
},
{
"input": "383 69 95 253",
"output": "YES"
},
{
"input": "393 98 35 999",
"output": "YES"
},
{
"input": "1000 22 79 552",
"output": "NO"
},
{
"input": "268 294 268 154",
"output": "NO"
},
{
"input": "963 465 706 146",
"output": "YES"
},
{
"input": "304 635 304 257",
"output": "NO"
},
{
"input": "4 2 1 6",
"output": "NO"
},
{
"input": "1 51 10 50",
"output": "NO"
},
{
"input": "5 5 4 4",
"output": "YES"
},
{
"input": "3 2 1 1",
"output": "YES"
},
{
"input": "3 4 3 3",
"output": "NO"
},
{
"input": "7 3 4 1",
"output": "YES"
},
{
"input": "101 10 1 1000",
"output": "NO"
},
{
"input": "5 1 1 1",
"output": "YES"
},
{
"input": "5 10 5 5",
"output": "NO"
},
{
"input": "19 1 7 1",
"output": "YES"
},
{
"input": "763 572 745 262",
"output": "YES"
},
{
"input": "1 2 1 1",
"output": "NO"
},
{
"input": "5 1 1 3",
"output": "YES"
},
{
"input": "170 725 479 359",
"output": "NO"
},
{
"input": "6 2 1 7",
"output": "YES"
},
{
"input": "6 2 5 1",
"output": "YES"
},
{
"input": "1 2 2 1",
"output": "NO"
},
{
"input": "24 2 8 3",
"output": "YES"
},
{
"input": "7 3 3 3",
"output": "YES"
},
{
"input": "5 2 2 2",
"output": "YES"
},
{
"input": "3 2 1 2",
"output": "YES"
},
{
"input": "1000 2 200 8",
"output": "NO"
},
{
"input": "3 100 2 100",
"output": "NO"
},
{
"input": "2 999 1 1000",
"output": "NO"
},
{
"input": "2 1 1 1",
"output": "NO"
},
{
"input": "2 3 5 1",
"output": "NO"
},
{
"input": "100 1 5 1",
"output": "YES"
},
{
"input": "7 2 3 3",
"output": "YES"
},
{
"input": "4 1 1 3",
"output": "NO"
},
{
"input": "3 2 2 1",
"output": "YES"
},
{
"input": "1 1 1 2",
"output": "NO"
},
{
"input": "91 8 7 13",
"output": "YES"
},
{
"input": "3 1 2 1",
"output": "NO"
},
{
"input": "5 3 2 3",
"output": "YES"
},
{
"input": "9 6 6 3",
"output": "YES"
}
] | 1,681,506,838
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 93
| 61
| 0
|
def should_build_second_oven(n, t, k, d):
single_oven_time = (n + k - 1) // k * t
double_oven_time = d + (n - k * (d // t) + 2 * k - 1) // (2 * k) * t
return double_oven_time < single_oven_time
# Read input
n, t, k, d = map(int, input().split())
# Determine if it's reasonable to build the second oven
if should_build_second_oven(n, t, k, d):
print("YES")
else:
print("NO")
|
Title: Carrot Cakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
Input Specification:
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
Output Specification:
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
Demo Input:
['8 6 4 5\n', '8 6 4 6\n', '10 3 11 4\n', '4 2 1 4\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n', 'YES\n']
Note:
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven.
|
```python
def should_build_second_oven(n, t, k, d):
single_oven_time = (n + k - 1) // k * t
double_oven_time = d + (n - k * (d // t) + 2 * k - 1) // (2 * k) * t
return double_oven_time < single_oven_time
# Read input
n, t, k, d = map(int, input().split())
# Determine if it's reasonable to build the second oven
if should_build_second_oven(n, t, k, d):
print("YES")
else:
print("NO")
```
| 3
|
|
747
|
A
|
Display Size
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] | null | null |
A big company decided to launch a new series of rectangular displays, and decided that the display must have exactly *n* pixels.
Your task is to determine the size of the rectangular display — the number of lines (rows) of pixels *a* and the number of columns of pixels *b*, so that:
- there are exactly *n* pixels on the display; - the number of rows does not exceed the number of columns, it means *a*<=≤<=*b*; - the difference *b*<=-<=*a* is as small as possible.
|
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=106) — the number of pixels display should have.
|
Print two integers — the number of rows and columns on the display.
|
[
"8\n",
"64\n",
"5\n",
"999999\n"
] |
[
"2 4\n",
"8 8\n",
"1 5\n",
"999 1001\n"
] |
In the first example the minimum possible difference equals 2, so on the display should be 2 rows of 4 pixels.
In the second example the minimum possible difference equals 0, so on the display should be 8 rows of 8 pixels.
In the third example the minimum possible difference equals 4, so on the display should be 1 row of 5 pixels.
| 500
|
[
{
"input": "8",
"output": "2 4"
},
{
"input": "64",
"output": "8 8"
},
{
"input": "5",
"output": "1 5"
},
{
"input": "999999",
"output": "999 1001"
},
{
"input": "716539",
"output": "97 7387"
},
{
"input": "1",
"output": "1 1"
},
{
"input": "2",
"output": "1 2"
},
{
"input": "3",
"output": "1 3"
},
{
"input": "4",
"output": "2 2"
},
{
"input": "6",
"output": "2 3"
},
{
"input": "7",
"output": "1 7"
},
{
"input": "9",
"output": "3 3"
},
{
"input": "10",
"output": "2 5"
},
{
"input": "11",
"output": "1 11"
},
{
"input": "12",
"output": "3 4"
},
{
"input": "15",
"output": "3 5"
},
{
"input": "100",
"output": "10 10"
},
{
"input": "101",
"output": "1 101"
},
{
"input": "169",
"output": "13 13"
},
{
"input": "179",
"output": "1 179"
},
{
"input": "190",
"output": "10 19"
},
{
"input": "1000",
"output": "25 40"
},
{
"input": "10000",
"output": "100 100"
},
{
"input": "10001",
"output": "73 137"
},
{
"input": "100000",
"output": "250 400"
},
{
"input": "100001",
"output": "11 9091"
},
{
"input": "1000000",
"output": "1000 1000"
},
{
"input": "999983",
"output": "1 999983"
},
{
"input": "524288",
"output": "512 1024"
},
{
"input": "954493",
"output": "971 983"
},
{
"input": "966289",
"output": "983 983"
},
{
"input": "944663",
"output": "961 983"
},
{
"input": "912673",
"output": "97 9409"
},
{
"input": "732641",
"output": "679 1079"
},
{
"input": "232897",
"output": "343 679"
},
{
"input": "16807",
"output": "49 343"
},
{
"input": "999958",
"output": "2 499979"
},
{
"input": "990151",
"output": "1 990151"
},
{
"input": "997002",
"output": "998 999"
},
{
"input": "20",
"output": "4 5"
},
{
"input": "20261",
"output": "1 20261"
},
{
"input": "999123",
"output": "3 333041"
},
{
"input": "901841",
"output": "1 901841"
}
] | 1,633,078,226
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 43
| 109
| 20,172,800
|
a = int(input())
b = int(a ** 0.5)
while a % b != 0:
b -= 1
print(b, a // b)
|
Title: Display Size
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A big company decided to launch a new series of rectangular displays, and decided that the display must have exactly *n* pixels.
Your task is to determine the size of the rectangular display — the number of lines (rows) of pixels *a* and the number of columns of pixels *b*, so that:
- there are exactly *n* pixels on the display; - the number of rows does not exceed the number of columns, it means *a*<=≤<=*b*; - the difference *b*<=-<=*a* is as small as possible.
Input Specification:
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=106) — the number of pixels display should have.
Output Specification:
Print two integers — the number of rows and columns on the display.
Demo Input:
['8\n', '64\n', '5\n', '999999\n']
Demo Output:
['2 4\n', '8 8\n', '1 5\n', '999 1001\n']
Note:
In the first example the minimum possible difference equals 2, so on the display should be 2 rows of 4 pixels.
In the second example the minimum possible difference equals 0, so on the display should be 8 rows of 8 pixels.
In the third example the minimum possible difference equals 4, so on the display should be 1 row of 5 pixels.
|
```python
a = int(input())
b = int(a ** 0.5)
while a % b != 0:
b -= 1
print(b, a // b)
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,633,956,133
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 124
| 6,963,200
|
n=int(input())
x=0
y=0
z=0
for i in range(n):
m=[int(x) for x in input().split()]
x+=m[0]
y+=m[1]
z+=m[2]
if x==y==z==0:
print('YES')
else:
print('NO')
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n=int(input())
x=0
y=0
z=0
for i in range(n):
m=[int(x) for x in input().split()]
x+=m[0]
y+=m[1]
z+=m[2]
if x==y==z==0:
print('YES')
else:
print('NO')
```
| 3.95603
|
581
|
A
|
Vasya the Hipster
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
|
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
|
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
|
[
"3 1\n",
"2 3\n",
"7 3\n"
] |
[
"1 1\n",
"2 0\n",
"3 2\n"
] |
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
| 500
|
[
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,667,914,670
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 62
| 0
|
a,b = map(int,input().split()) ; x,y = min(a,b) , max(a,b) ; print(x,(y-x)//2)
|
Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
|
```python
a,b = map(int,input().split()) ; x,y = min(a,b) , max(a,b) ; print(x,(y-x)//2)
```
| 3
|
|
119
|
A
|
Epic Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
|
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
|
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
|
[
"3 5 9\n",
"1 1 100\n"
] |
[
"0",
"1"
] |
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
| 500
|
[
{
"input": "3 5 9",
"output": "0"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "23 12 16",
"output": "1"
},
{
"input": "95 26 29",
"output": "1"
},
{
"input": "73 32 99",
"output": "1"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "41 12 65",
"output": "1"
},
{
"input": "13 61 100",
"output": "1"
},
{
"input": "100 100 10",
"output": "0"
},
{
"input": "12 24 26",
"output": "1"
},
{
"input": "73 21 96",
"output": "1"
},
{
"input": "17 22 81",
"output": "1"
},
{
"input": "14 88 97",
"output": "1"
},
{
"input": "42 81 17",
"output": "0"
},
{
"input": "34 36 19",
"output": "1"
},
{
"input": "21 87 12",
"output": "1"
},
{
"input": "97 92 98",
"output": "1"
},
{
"input": "49 25 62",
"output": "1"
},
{
"input": "29 17 44",
"output": "1"
},
{
"input": "10 1 10",
"output": "0"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "100 100 1",
"output": "0"
},
{
"input": "11 99 55",
"output": "0"
},
{
"input": "8 13 21",
"output": "0"
},
{
"input": "34 55 89",
"output": "0"
},
{
"input": "21 34 55",
"output": "1"
},
{
"input": "13 21 34",
"output": "1"
},
{
"input": "34 21 55",
"output": "0"
},
{
"input": "10 20 84",
"output": "1"
},
{
"input": "4 2 5",
"output": "0"
},
{
"input": "3 2 3",
"output": "0"
},
{
"input": "31 23 1",
"output": "0"
},
{
"input": "100 100 100",
"output": "0"
},
{
"input": "100 1 100",
"output": "0"
},
{
"input": "1 100 100",
"output": "1"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "17 23 100",
"output": "1"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "1 1 2",
"output": "1"
},
{
"input": "2 1 1",
"output": "0"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "2 1 2",
"output": "0"
},
{
"input": "10 10 3",
"output": "1"
},
{
"input": "2 2 1",
"output": "0"
},
{
"input": "9 5 1",
"output": "0"
}
] | 1,649,657,340
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 122
| 0
|
from math import gcd
a,b,c=map(int,input().split())
x=True
k=0
while x:
if k%2==0:
if c-gcd(a,c)>=0:
c-=gcd(a,c)
k+=1
else:
print(1)
x=False
else:
if c-gcd(b,c)>=0:
c-=gcd(b,c)
k+=1
else:
print(0)
x=False
|
Title: Epic Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
Input Specification:
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
Output Specification:
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
Demo Input:
['3 5 9\n', '1 1 100\n']
Demo Output:
['0', '1']
Note:
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
|
```python
from math import gcd
a,b,c=map(int,input().split())
x=True
k=0
while x:
if k%2==0:
if c-gcd(a,c)>=0:
c-=gcd(a,c)
k+=1
else:
print(1)
x=False
else:
if c-gcd(b,c)>=0:
c-=gcd(b,c)
k+=1
else:
print(0)
x=False
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,518,364,679
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 124
| 5,632,000
|
n = int(input())
record = []
for i in range(0,n):
record.append(input())
team1 = record[0]
exists = 0
for i in range(1,n):
if(record[i]!=team1):
team2 = record[i]
exists = 1
break
if(exists == 0):
print(team1)
else:
score1 = 0
score2 = 0
for i in range(0,n):
if(record[i] == team1):
score1+=1
else:
score2+=1
if(score1>score2):
print(team1)
else:
print(team2)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input())
record = []
for i in range(0,n):
record.append(input())
team1 = record[0]
exists = 0
for i in range(1,n):
if(record[i]!=team1):
team2 = record[i]
exists = 1
break
if(exists == 0):
print(team1)
else:
score1 = 0
score2 = 0
for i in range(0,n):
if(record[i] == team1):
score1+=1
else:
score2+=1
if(score1>score2):
print(team1)
else:
print(team2)
```
| 3.95851
|
70
|
A
|
Cookies
|
PROGRAMMING
| 1,300
|
[
"math"
] |
A. Cookies
|
1
|
256
|
Fangy collects cookies. Once he decided to take a box and put cookies into it in some way. If we take a square *k*<=×<=*k* in size, divided into blocks 1<=×<=1 in size and paint there the main diagonal together with cells, which lie above it, then the painted area will be equal to the area occupied by one cookie *k* in size. Fangy also has a box with a square base 2*n*<=×<=2*n*, divided into blocks 1<=×<=1 in size. In a box the cookies should not overlap, and they should not be turned over or rotated. See cookies of sizes 2 and 4 respectively on the figure:
To stack the cookies the little walrus uses the following algorithm. He takes out of the repository the largest cookie which can fit in some place in the box and puts it there. Everything could be perfect but alas, in the repository the little walrus has infinitely many cookies of size 2 and larger, and there are no cookies of size 1, therefore, empty cells will remain in the box. Fangy wants to know how many empty cells will be left in the end.
|
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1000).
|
Print the single number, equal to the number of empty cells in the box. The answer should be printed modulo 106<=+<=3.
|
[
"3\n"
] |
[
"9"
] |
If the box possesses the base of 2<sup class="upper-index">3</sup> × 2<sup class="upper-index">3</sup> (as in the example), then the cookies will be put there in the following manner:
| 500
|
[
{
"input": "3",
"output": "9"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "3"
},
{
"input": "4",
"output": "27"
},
{
"input": "6",
"output": "243"
},
{
"input": "11",
"output": "59049"
},
{
"input": "14",
"output": "594320"
},
{
"input": "15",
"output": "782957"
},
{
"input": "7",
"output": "729"
},
{
"input": "0",
"output": "1"
},
{
"input": "1000",
"output": "691074"
},
{
"input": "657",
"output": "874011"
},
{
"input": "561",
"output": "842553"
},
{
"input": "823",
"output": "858672"
},
{
"input": "850",
"output": "557186"
},
{
"input": "298",
"output": "999535"
},
{
"input": "262",
"output": "946384"
},
{
"input": "910",
"output": "678945"
},
{
"input": "617",
"output": "247876"
},
{
"input": "857",
"output": "562128"
},
{
"input": "69",
"output": "327984"
},
{
"input": "589",
"output": "889192"
},
{
"input": "928",
"output": "794863"
},
{
"input": "696",
"output": "695035"
},
{
"input": "226",
"output": "376094"
}
] | 1,643,501,344
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 46
| 0
|
mod=1000003
c=int(input())
ans=1
i = 2
while i<=c:
ans=(ans%mod + (ans%mod * 2)%mod)%mod
i+=1
print(ans)
|
Title: Cookies
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Fangy collects cookies. Once he decided to take a box and put cookies into it in some way. If we take a square *k*<=×<=*k* in size, divided into blocks 1<=×<=1 in size and paint there the main diagonal together with cells, which lie above it, then the painted area will be equal to the area occupied by one cookie *k* in size. Fangy also has a box with a square base 2*n*<=×<=2*n*, divided into blocks 1<=×<=1 in size. In a box the cookies should not overlap, and they should not be turned over or rotated. See cookies of sizes 2 and 4 respectively on the figure:
To stack the cookies the little walrus uses the following algorithm. He takes out of the repository the largest cookie which can fit in some place in the box and puts it there. Everything could be perfect but alas, in the repository the little walrus has infinitely many cookies of size 2 and larger, and there are no cookies of size 1, therefore, empty cells will remain in the box. Fangy wants to know how many empty cells will be left in the end.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1000).
Output Specification:
Print the single number, equal to the number of empty cells in the box. The answer should be printed modulo 106<=+<=3.
Demo Input:
['3\n']
Demo Output:
['9']
Note:
If the box possesses the base of 2<sup class="upper-index">3</sup> × 2<sup class="upper-index">3</sup> (as in the example), then the cookies will be put there in the following manner:
|
```python
mod=1000003
c=int(input())
ans=1
i = 2
while i<=c:
ans=(ans%mod + (ans%mod * 2)%mod)%mod
i+=1
print(ans)
```
| 3.977
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,696,482,648
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
import sys
if __name__ == '__main__':
n = int(sys.stdin.readline())
count = 0
for _ in range(n):
conf = [int(i) for i in sys.stdin.readline().strip().split()]
if sum(conf) >= 2:
count += 1
print(count)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
import sys
if __name__ == '__main__':
n = int(sys.stdin.readline())
count = 0
for _ in range(n):
conf = [int(i) for i in sys.stdin.readline().strip().split()]
if sum(conf) >= 2:
count += 1
print(count)
```
| 3
|
|
266
|
A
|
Stones on the Table
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There are *n* stones on the table in a row, each of them can be red, green or blue. Count the minimum number of stones to take from the table so that any two neighboring stones had different colors. Stones in a row are considered neighboring if there are no other stones between them.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stones on the table.
The next line contains string *s*, which represents the colors of the stones. We'll consider the stones in the row numbered from 1 to *n* from left to right. Then the *i*-th character *s* equals "R", if the *i*-th stone is red, "G", if it's green and "B", if it's blue.
|
Print a single integer — the answer to the problem.
|
[
"3\nRRG\n",
"5\nRRRRR\n",
"4\nBRBG\n"
] |
[
"1\n",
"4\n",
"0\n"
] |
none
| 500
|
[
{
"input": "3\nRRG",
"output": "1"
},
{
"input": "5\nRRRRR",
"output": "4"
},
{
"input": "4\nBRBG",
"output": "0"
},
{
"input": "1\nB",
"output": "0"
},
{
"input": "2\nBG",
"output": "0"
},
{
"input": "3\nBGB",
"output": "0"
},
{
"input": "4\nRBBR",
"output": "1"
},
{
"input": "5\nRGGBG",
"output": "1"
},
{
"input": "10\nGGBRBRGGRB",
"output": "2"
},
{
"input": "50\nGRBGGRBRGRBGGBBBBBGGGBBBBRBRGBRRBRGBBBRBBRRGBGGGRB",
"output": "18"
},
{
"input": "15\nBRRBRGGBBRRRRGR",
"output": "6"
},
{
"input": "20\nRRGBBRBRGRGBBGGRGRRR",
"output": "6"
},
{
"input": "25\nBBGBGRBGGBRRBGRRBGGBBRBRB",
"output": "6"
},
{
"input": "30\nGRGGGBGGRGBGGRGRBGBGBRRRRRRGRB",
"output": "9"
},
{
"input": "35\nGBBGBRGBBGGRBBGBRRGGRRRRRRRBRBBRRGB",
"output": "14"
},
{
"input": "40\nGBBRRGBGGGRGGGRRRRBRBGGBBGGGBGBBBBBRGGGG",
"output": "20"
},
{
"input": "45\nGGGBBRBBRRGRBBGGBGRBRGGBRBRGBRRGBGRRBGRGRBRRG",
"output": "11"
},
{
"input": "50\nRBGGBGGRBGRBBBGBBGRBBBGGGRBBBGBBBGRGGBGGBRBGBGRRGG",
"output": "17"
},
{
"input": "50\nGGGBBRGGGGGRRGGRBGGRGBBRBRRBGRGBBBGBRBGRGBBGRGGBRB",
"output": "16"
},
{
"input": "50\nGBGRGRRBRRRRRGGBBGBRRRBBBRBBBRRGRBBRGBRBGGRGRBBGGG",
"output": "19"
},
{
"input": "10\nGRRBRBRBGR",
"output": "1"
},
{
"input": "10\nBRBGBGRRBR",
"output": "1"
},
{
"input": "20\nGBGBGGRRRRGRBBGRGRGR",
"output": "5"
},
{
"input": "20\nRRGGRBBGBBRBGRRBRRBG",
"output": "6"
},
{
"input": "30\nBGBRGBBBGRGBBRGBGRBBBRGGRRGRRB",
"output": "8"
},
{
"input": "30\nBBBBGGBRBGBBGBGBGBGGGRGRRGGBBB",
"output": "11"
},
{
"input": "40\nGBRRGRBGBRRGBRGGGBRGBGBRGBBRRGRGGBBGBGBB",
"output": "9"
},
{
"input": "40\nBRGRGGRGGRBBRRRBRBBGGGRRGBGBBGRBBRGBRRGG",
"output": "13"
},
{
"input": "50\nRBGBGGRRGGRGGBGBGRRBGGBGBRRBBGBBGBBBGBBRBBRBRBRGRG",
"output": "13"
},
{
"input": "50\nRBRRGBGRRRBGRRBGRRGRBBRBBRRBRGGBRBRRBGGRBGGBRBRGRB",
"output": "12"
},
{
"input": "2\nBB",
"output": "1"
},
{
"input": "50\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "49"
},
{
"input": "50\nRRRRRRRRGRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "47"
},
{
"input": "50\nRRRRRRRRRRRRGGRRRRRRRRRBRRRRRRRRRRRRRRBBRRRRRRRRRR",
"output": "43"
}
] | 1,698,396,665
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 122
| 0
|
num = int(input())
user = list(input())
counter = 0
length = len(user)
for x in range(0, length - 1):
if user[x] == user[x + 1]:
counter = counter + 1
print(counter)
|
Title: Stones on the Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* stones on the table in a row, each of them can be red, green or blue. Count the minimum number of stones to take from the table so that any two neighboring stones had different colors. Stones in a row are considered neighboring if there are no other stones between them.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stones on the table.
The next line contains string *s*, which represents the colors of the stones. We'll consider the stones in the row numbered from 1 to *n* from left to right. Then the *i*-th character *s* equals "R", if the *i*-th stone is red, "G", if it's green and "B", if it's blue.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3\nRRG\n', '5\nRRRRR\n', '4\nBRBG\n']
Demo Output:
['1\n', '4\n', '0\n']
Note:
none
|
```python
num = int(input())
user = list(input())
counter = 0
length = len(user)
for x in range(0, length - 1):
if user[x] == user[x + 1]:
counter = counter + 1
print(counter)
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,696,593,835
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
s = input()
t = input()
ls = list(s)
lt = list(t)
lt.reverse()
if ls==lt :
print('YES')
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
s = input()
t = input()
ls = list(s)
lt = list(t)
lt.reverse()
if ls==lt :
print('YES')
else:
print("NO")
```
| 3.977
|
807
|
A
|
Is it rated?
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings"
] | null | null |
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
|
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
|
[
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] |
[
"rated\n",
"unrated\n",
"maybe\n"
] |
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
| 500
|
[
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,494,712,919
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 150
| 62
| 0
|
import sys
if __name__ == '__main__':
n = int(input())
before = []
after = []
for i in range(0, n):
x, y = [int(num) for num in input().split()]
before.append(x)
after.append(y)
for i in range(0, n):
if before[i] != after[i]:
print("rated")
sys.exit()
for i in range(0, n - 1):
if before[i + 1] > before[i]:
print("unrated")
sys.exit()
print("maybe")
|
Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
|
```python
import sys
if __name__ == '__main__':
n = int(input())
before = []
after = []
for i in range(0, n):
x, y = [int(num) for num in input().split()]
before.append(x)
after.append(y)
for i in range(0, n):
if before[i] != after[i]:
print("rated")
sys.exit()
for i in range(0, n - 1):
if before[i + 1] > before[i]:
print("unrated")
sys.exit()
print("maybe")
```
| 3
|
|
339
|
B
|
Xenia and Ringroad
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
|
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
|
Print a single integer — the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"4 3\n3 2 3\n",
"4 3\n2 3 3\n"
] |
[
"6\n",
"2\n"
] |
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1 → 2 → 3 → 4 → 1 → 2 → 3. This is optimal sequence. So, she needs 6 time units.
| 1,000
|
[
{
"input": "4 3\n3 2 3",
"output": "6"
},
{
"input": "4 3\n2 3 3",
"output": "2"
},
{
"input": "2 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "100 100\n56 46 1 47 5 86 45 35 81 1 31 70 67 70 62 99 100 47 44 33 78 35 32 37 92 12 95 18 3 22 54 24 22 90 25 22 78 88 51 92 46 84 15 29 28 40 8 5 93 68 77 47 45 76 85 39 84 94 52 69 93 64 31 60 99 17 51 59 62 37 46 47 86 60 88 14 68 22 47 93 50 10 55 87 46 50 43 63 44 43 61 65 91 43 33 97 67 57 66 70",
"output": "4869"
},
{
"input": "78 58\n23 14 73 45 47 14 27 59 65 39 15 23 5 1 50 37 3 51 46 69 75 65 45 68 48 59 77 39 53 21 72 33 46 32 34 5 69 55 56 53 47 31 32 5 42 23 76 15 2 77 65 24 16 68 61 28 55 10",
"output": "2505"
},
{
"input": "14 54\n9 13 14 9 5 12 4 7 3 14 5 12 13 1 1 11 10 2 7 9 5 2 2 8 10 7 3 9 5 11 2 2 6 12 11 5 4 11 11 6 2 11 14 13 8 7 13 9 4 9 11 3 7 13",
"output": "362"
},
{
"input": "100 100\n48 73 63 16 49 88 36 17 66 6 87 13 94 52 58 70 71 52 7 70 25 42 24 36 57 9 79 26 75 39 13 14 38 26 33 66 88 28 75 98 53 48 67 54 63 25 69 87 88 32 72 17 36 35 29 67 74 89 70 47 20 90 78 13 94 57 32 73 29 74 45 78 85 64 81 56 12 65 19 67 34 86 55 71 41 33 76 13 100 47 44 76 86 78 37 15 26 98 83 98",
"output": "4997"
},
{
"input": "99 100\n88 65 10 91 18 35 58 49 42 2 22 57 74 31 53 24 27 93 45 4 71 2 69 39 21 90 97 89 45 73 20 45 82 98 35 90 37 76 68 26 21 65 95 63 24 74 50 59 3 93 65 6 30 37 62 71 18 88 40 12 56 40 89 56 38 71 90 41 97 43 44 23 19 22 10 80 3 24 32 85 26 65 70 60 76 85 66 68 74 11 64 88 12 63 16 15 79 57 93 58",
"output": "4809"
},
{
"input": "65 100\n53 14 5 10 32 60 31 52 52 56 38 6 8 17 52 23 59 3 18 28 15 2 46 26 8 2 40 6 58 30 28 46 49 23 47 24 9 53 3 47 55 12 36 49 12 24 54 55 58 7 50 42 15 4 58 49 34 40 19 4 59 19 31 17 35 65 36 50 45 5 33 11 29 52 55 40 48 11 32 41 31 7 46 55 32 41 56 51 39 13 5 59 58 34 38 50 55 10 43 30",
"output": "3149"
},
{
"input": "10 100\n7 6 2 10 7 2 3 8 10 4 6 1 4 5 7 10 1 2 3 5 4 10 8 2 3 3 6 8 3 9 4 1 9 10 1 2 5 1 8 8 5 9 2 8 1 2 3 2 1 10 10 7 1 3 2 2 7 1 6 6 6 9 2 3 1 7 2 2 9 7 3 3 2 10 7 4 7 3 3 3 2 4 4 2 2 8 4 1 10 10 5 10 6 10 6 10 3 10 8 9",
"output": "428"
},
{
"input": "2 100\n1 1 2 2 2 2 1 2 1 2 2 2 1 1 2 2 2 2 1 1 2 1 2 2 1 1 2 2 2 1 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 1 1 2 2 1 2 1 2 2 2 1 1 1 1 1 2 2 2 1 1 2 2 1 1 2 2 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 1 1 1 1 2",
"output": "47"
},
{
"input": "67 100\n49 5 25 48 37 55 5 33 14 30 59 28 57 46 45 32 47 22 40 28 58 34 27 29 4 52 63 44 31 65 42 61 11 17 32 17 18 1 12 33 38 11 59 46 43 55 23 30 23 2 42 21 45 51 30 19 35 15 10 30 13 21 32 34 33 3 5 59 23 63 6 9 20 43 64 3 42 41 40 4 14 20 40 33 25 44 1 2 50 46 13 10 3 20 22 64 28 42 58 30",
"output": "3245"
},
{
"input": "100 100\n81 62 26 90 7 87 60 35 75 81 54 94 53 71 64 80 58 83 53 70 40 96 87 50 37 63 5 77 83 75 53 28 22 98 52 45 72 70 62 21 1 99 37 93 16 98 68 27 96 37 21 83 92 23 62 96 85 31 85 66 38 77 45 16 90 86 6 21 75 42 18 60 2 17 51 61 94 68 97 79 17 59 66 14 87 78 70 40 63 78 58 22 87 7 90 17 20 97 9 31",
"output": "5530"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 10\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "2 10\n1 1 1 2 2 2 1 1 1 2",
"output": "3"
},
{
"input": "3 6\n1 2 3 3 2 1",
"output": "6"
}
] | 1,697,517,507
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 154
| 13,721,600
|
# https://codeforces.com/problemset/problem/339/B
n, m = [int(x) for x in input().split()]
a = [int(x) for x in input().split()]
c = 0
prev = -1
for e in a:
if e < prev:
c += n
prev = e
print(c + a[-1] -1)
|
Title: Xenia and Ringroad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
Output Specification:
Print a single integer — the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n3 2 3\n', '4 3\n2 3 3\n']
Demo Output:
['6\n', '2\n']
Note:
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1 → 2 → 3 → 4 → 1 → 2 → 3. This is optimal sequence. So, she needs 6 time units.
|
```python
# https://codeforces.com/problemset/problem/339/B
n, m = [int(x) for x in input().split()]
a = [int(x) for x in input().split()]
c = 0
prev = -1
for e in a:
if e < prev:
c += n
prev = e
print(c + a[-1] -1)
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,672,425,476
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
b,c,a=map(int,input().split())
print(-b//a*(-c//a))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
b,c,a=map(int,input().split())
print(-b//a*(-c//a))
```
| 3.977
|
2
|
A
|
Winner
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation"
] |
A. Winner
|
1
|
64
|
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
|
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
|
Print the name of the winner.
|
[
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] |
[
"andrew\n",
"andrew\n"
] |
none
| 0
|
[
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,545,232,679
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 280
| 307,200
|
# -*- coding: utf-8 -*-
"""
Created on Wed Dec 19 22:45:37 2018
@author: Lenovo
"""
x = []
y = {}
n = int(input())
for i in range(n):
a, b = input().split()
b = int(b)
y[a] = y.get(a, 0) + b
x.append([y[a], a])
m = max(y.values())
for n, a in x:
if n >= m and y[a] >= m:
print(a)
break
|
Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
"""
Created on Wed Dec 19 22:45:37 2018
@author: Lenovo
"""
x = []
y = {}
n = int(input())
for i in range(n):
a, b = input().split()
b = int(b)
y[a] = y.get(a, 0) + b
x.append([y[a], a])
m = max(y.values())
for n, a in x:
if n >= m and y[a] >= m:
print(a)
break
```
| 3.857711
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,694,533,080
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 92
| 0
|
from sys import stdin
input = stdin.readline
if __name__ == "__main__":
n = int(input())
data = [[0]*n, [0]*n, [0]*n]
for i in range(n):
data[0][i], data[1][i], data[2][i] = map(int, input().split())
print(["NO", "YES"][sum(data[0]) == sum(data[1]) == sum(data[2]) == 0])
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
from sys import stdin
input = stdin.readline
if __name__ == "__main__":
n = int(input())
data = [[0]*n, [0]*n, [0]*n]
for i in range(n):
data[0][i], data[1][i], data[2][i] = map(int, input().split())
print(["NO", "YES"][sum(data[0]) == sum(data[1]) == sum(data[2]) == 0])
```
| 3.977
|
92
|
A
|
Chips
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] |
A. Chips
|
2
|
256
|
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
|
Print the number of chips the presenter ended up with.
|
[
"4 11\n",
"17 107\n",
"3 8\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
| 500
|
[
{
"input": "4 11",
"output": "0"
},
{
"input": "17 107",
"output": "2"
},
{
"input": "3 8",
"output": "1"
},
{
"input": "46 7262",
"output": "35"
},
{
"input": "32 6864",
"output": "0"
},
{
"input": "36 6218",
"output": "14"
},
{
"input": "25 9712",
"output": "11"
},
{
"input": "9 7601",
"output": "5"
},
{
"input": "1 9058",
"output": "0"
},
{
"input": "29 7772",
"output": "26"
},
{
"input": "45 9465",
"output": "14"
},
{
"input": "46 866",
"output": "5"
},
{
"input": "29 1241",
"output": "20"
},
{
"input": "17 4248",
"output": "12"
},
{
"input": "20 8082",
"output": "11"
},
{
"input": "50 9555",
"output": "0"
},
{
"input": "4 7455",
"output": "2"
},
{
"input": "36 880",
"output": "4"
},
{
"input": "24 7440",
"output": "9"
},
{
"input": "44 7888",
"output": "12"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "50 10000",
"output": "40"
},
{
"input": "1 10000",
"output": "0"
},
{
"input": "50 1",
"output": "0"
},
{
"input": "50 50",
"output": "5"
}
] | 1,614,376,323
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 124
| 0
|
n,m = map(int,input().split())
i=1
while(i<=m):
m-=i
i+=1
if i==n+1:
i=1
print(m)
|
Title: Chips
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
Output Specification:
Print the number of chips the presenter ended up with.
Demo Input:
['4 11\n', '17 107\n', '3 8\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
|
```python
n,m = map(int,input().split())
i=1
while(i<=m):
m-=i
i+=1
if i==n+1:
i=1
print(m)
```
| 3.969
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,696,482,917
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
n=int(input())
a=list(map(int,input().split()))
sc1=0
sc2=0
p1=0
p2=n-1
for i in range(n):
if(i%2==0):
if (a[p1]>a[p2]):
sc1+=a[p1]
p1+=1
elif(a[p1]<a[p2]):
sc1+=a[p2]
p2-=1
else:
sc1+=a[p1]
else:
if (a[p1]>a[p2]):
sc2+=a[p1]
p1+=1
elif(a[p1]<a[p2]):
sc2+=a[p2]
p2-=1
else:
sc2+=a[p1]
print(sc1,sc2)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
n=int(input())
a=list(map(int,input().split()))
sc1=0
sc2=0
p1=0
p2=n-1
for i in range(n):
if(i%2==0):
if (a[p1]>a[p2]):
sc1+=a[p1]
p1+=1
elif(a[p1]<a[p2]):
sc1+=a[p2]
p2-=1
else:
sc1+=a[p1]
else:
if (a[p1]>a[p2]):
sc2+=a[p1]
p1+=1
elif(a[p1]<a[p2]):
sc2+=a[p2]
p2-=1
else:
sc2+=a[p1]
print(sc1,sc2)
```
| 3
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,697,695,076
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
n=int(input())
c=0
for i in range (0,n):
#print("sakib")
x,y,z=map(int,input().split())
sum=x+y+z
if sum>1:
c+=1
print(c)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
n=int(input())
c=0
for i in range (0,n):
#print("sakib")
x,y,z=map(int,input().split())
sum=x+y+z
if sum>1:
c+=1
print(c)
```
| 3
|
|
864
|
B
|
Polycarp and Letters
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
|
Print maximum number of elements in pretty set of positions for string *s*.
|
[
"11\naaaaBaabAbA\n",
"12\nzACaAbbaazzC\n",
"3\nABC\n"
] |
[
"2\n",
"3\n",
"0\n"
] |
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
| 1,000
|
[
{
"input": "11\naaaaBaabAbA",
"output": "2"
},
{
"input": "12\nzACaAbbaazzC",
"output": "3"
},
{
"input": "3\nABC",
"output": "0"
},
{
"input": "1\na",
"output": "1"
},
{
"input": "2\naz",
"output": "2"
},
{
"input": "200\nXbTJZqcbpYuZQEoUrbxlPXAPCtVLrRExpQzxzqzcqsqzsiisswqitswzCtJQxOavicSdBIodideVRKHPojCNHmbnrLgwJlwOpyrJJIhrUePszxSjJGeUgTtOfewPQnPVWhZAtogRPrJLwyShNQaeNsvrJwjuuBOMPCeSckBMISQzGngfOmeyfDObncyeNsihYVtQbSEh",
"output": "8"
},
{
"input": "2\nAZ",
"output": "0"
},
{
"input": "28\nAabcBabcCBNMaaaaabbbbbcccccc",
"output": "3"
},
{
"input": "200\nrsgraosldglhdoorwhkrsehjpuxrjuwgeanjgezhekprzarelduuaxdnspzjuooguuwnzkowkuhzduakdrzpnslauejhrrkalwpurpuuswdgeadlhjwzjgegwpknepazwwleulppwrlgrgedlwdzuodzropsrrkxusjnuzshdkjrxxpgzanzdrpnggdwxarpwohxdepJ",
"output": "17"
},
{
"input": "1\nk",
"output": "1"
},
{
"input": "1\nH",
"output": "0"
},
{
"input": "2\nzG",
"output": "1"
},
{
"input": "2\ngg",
"output": "1"
},
{
"input": "2\nai",
"output": "2"
},
{
"input": "20\npEjVrKWLIFCZjIHgggVU",
"output": "1"
},
{
"input": "20\niFSiiigiYFSKmDnMGcgM",
"output": "2"
},
{
"input": "20\nedxedxxxCQiIVmYEUtLi",
"output": "3"
},
{
"input": "20\nprnchweyabjvzkoqiltm",
"output": "20"
},
{
"input": "35\nQLDZNKFXKVSVLUVHRTDPQYMSTDXBELXBOTS",
"output": "0"
},
{
"input": "35\nbvZWiitgxodztelnYUyljYGnCoWluXTvBLp",
"output": "10"
},
{
"input": "35\nBTexnaeplecllxwlanarpcollawHLVMHIIF",
"output": "10"
},
{
"input": "35\nhhwxqysolegsthsvfcqiryenbujbrrScobu",
"output": "20"
},
{
"input": "26\npbgfqosklxjuzmdheyvawrictn",
"output": "26"
},
{
"input": "100\nchMRWwymTDuZDZuSTvUmmuxvSscnTasyjlwwodhzcoifeahnbmcifyeobbydwparebduoLDCgHlOsPtVRbYGGQXfnkdvrWKIwCRl",
"output": "20"
},
{
"input": "100\nhXYLXKUMBrGkjqQJTGbGWAfmztqqapdbjbhcualhypgnaieKXmhzGMnqXVlcPesskfaEVgvWQTTShRRnEtFahWDyuBzySMpugxCM",
"output": "19"
},
{
"input": "100\nucOgELrgjMrFOgtHzqgvUgtHngKJxdMFKBjfcCppciqmGZXXoiSZibgpadshyljqrwxbomzeutvnhTLGVckZUmyiFPLlwuLBFito",
"output": "23"
},
{
"input": "200\nWTCKAKLVGXSYFVMVJDUYERXNMVNTGWXUGRFCGMYXJQGLODYZTUIDENHYEGFKXFIEUILAMESAXAWZXVCZPJPEYUXBITHMTZOTMKWITGRSFHODKVJHPAHVVWTCTHIVAWAREQXWMPUWQSTPPJFHKGKELBTPUYDAVIUMGASPUEDIODRYXIWCORHOSLIBLOZUNJPHHMXEXOAY",
"output": "0"
},
{
"input": "200\neLCCuYMPPwQoNlCpPOtKWJaQJmWfHeZCKiMSpILHSKjFOYGpRMzMCfMXdDuQdBGNsCNrHIVJzEFfBZcNMwNcFjOFVJvEtUQmLbFNKVHgNDyFkFVQhUTUQDgXhMjJZgFSSiHhMKuTgZQYJqAqKBpHoHddddddddddddddddXSSYNKNnRrKuOjAVKZlRLzCjExPdHaDHBT",
"output": "1"
},
{
"input": "200\nitSYxgOLlwOoAkkkkkzzzzzzzzkzkzkzkkkkkzkzzkzUDJSKybRPBvaIDsNuWImPJvrHkKiMeYukWmtHtgZSyQsgYanZvXNbKXBlFLSUcqRnGWSriAvKxsTkDJfROqaKdzXhvJsPEDATueCraWOGEvRDWjPwXuiNpWsEnCuhDcKWOQxjBkdBqmFatWFkgKsbZuLtRGtY",
"output": "2"
},
{
"input": "200\noggqoqqogoqoggggoggqgooqggogogooogqqgggoqgggqoqogogggogggqgooqgqggqqqoqgqgoooqgqogqoggoqqgqoqgoooqoogooqoogqoqoqqgoqgoqgggogqqqoqoggoqoqqoqggqoggooqqqoqggoggqqqqqqqqqgogqgggggooogogqgggqogqgoqoqogoooq",
"output": "3"
},
{
"input": "200\nCtclUtUnmqFniaLqGRmMoUMeLyFfAgWxIZxdrBarcRQprSOGcdUYsmDbooSuOvBLgrYlgaIjJtFgcxJKHGkCXpYfVKmUbouuIqGstFrrwJzYQqjjqqppqqqqqpqqqjpjjpjqjXRYkfPhGAatOigFuItkKxkjCBLdiNMVGjmdWNMgOOvmaJEdGsWNoaERrINNKqKeQajv",
"output": "3"
},
{
"input": "200\nmeZNrhqtSTSmktGQnnNOTcnyAMTKSixxKQKiagrMqRYBqgbRlsbJhvtNeHVUuMCyZLCnsIixRYrYEAkfQOxSVqXkrPqeCZQksInzRsRKBgvIqlGVPxPQnypknSXjgMjsjElcqGsaJRbegJVAKtWcHoOnzHqzhoKReqBBsOhZYLaYJhmqOMQsizdCsQfjUDHcTtHoeYwu",
"output": "4"
},
{
"input": "200\nvFAYTHJLZaivWzSYmiuDBDUFACDSVbkImnVaXBpCgrbgmTfXKJfoglIkZxWPSeVSFPnHZDNUAqLyhjLXSuAqGLskBlDxjxGPJyGdwzlPfIekwsblIrkxzfhJeNoHywdfAGlJzqXOfQaKceSqViVFTRJEGfACnsFeSFpOYisIHJciqTMNAmgeXeublTvfWoPnddtvKIyF",
"output": "6"
},
{
"input": "200\ngnDdkqJjYvduVYDSsswZDvoCouyaYZTfhmpSakERWLhufZtthWsfbQdTGwhKYjEcrqWBOyxBbiFhdLlIjChLOPiOpYmcrJgDtXsJfmHtLrabyGKOfHQRukEtTzwoqBHfmyVXPebfcpGQacLkGWFwerszjdHpTBXGssYXmGHlcCBgBXyGJqxbVhvDffLyCrZnxonABEXV",
"output": "7"
},
{
"input": "200\nBmggKNRZBXPtJqlJaXLdKKQLDJvXpDuQGupiRQfDwCJCJvAlDDGpPZNOvXkrdKOFOEFBVfrsZjWyHPoKGzXmTAyPJGEmxCyCXpeAdTwbrMtWLmlmGNqxvuxmqpmtpuhrmxxtrquSLFYVlnSYgRJDYHWgHBbziBLZRwCIJNvbtsEdLLxmTbnjkoqSPAuzEeTYLlmejOUH",
"output": "9"
},
{
"input": "200\nMkuxcDWdcnqsrlTsejehQKrTwoOBRCUAywqSnZkDLRmVBDVoOqdZHbrInQQyeRFAjiYYmHGrBbWgWstCPfLPRdNVDXBdqFJsGQfSXbufsiogybEhKDlWfPazIuhpONwGzZWaQNwVnmhTqWdewaklgjwaumXYDGwjSeEcYXjkVtLiYSWULEnTFukIlWQGWsXwWRMJGTcI",
"output": "10"
},
{
"input": "200\nOgMBgYeuMJdjPtLybvwmGDrQEOhliaabEtwulzNEjsfnaznXUMoBbbxkLEwSQzcLrlJdjJCLGVNBxorghPxTYCoqniySJMcilpsqpBAbqdzqRUDVaYOgqGhGrxlIJkyYgkOdTUgRZwpgIkeZFXojLXpDilzirHVVadiHaMrxhzodzpdvhvrzdzxbhmhdpxqqpoDegfFQ",
"output": "11"
},
{
"input": "200\nOLaJOtwultZLiZPSYAVGIbYvbIuZkqFZXwfsqpsavCDmBMStAuUFLBVknWDXNzmiuUYIsUMGxtoadWlPYPqvqSvpYdOiJRxFzGGnnmstniltvitnrmyrblnqyruylummmlsqtqitlbulvtuitiqimuintbimqyurviuntqnnvslynlNYMpYVKYwKVTbIUVdlNGrcFZON",
"output": "12"
},
{
"input": "200\nGAcmlaqfjSAQLvXlkhxujXgSbxdFAwnoxDuldDvYmpUhTWJdcEQSdARLrozJzIgFVCkzPUztWIpaGfiKeqzoXinEjVuoKqyBHmtFjBWcRdBmyjviNlGAIkpikjAimmBgayfphrstfbjexjbttzfzfzaysxfyrjazfhtpghnbbeffjhxrjxpttesgzrnrfbgzzsRsCgmz",
"output": "15"
},
{
"input": "200\nYRvIopNqSTYDhViTqCLMwEbTTIdHkoeuBmAJWhgtOgVxlcHSsavDNzMfpwTghkBvYEtCYQxicLUxdgAcaCzOOgbQYsfnaTXFlFxbeEiGwdNvxwHzkTdKtWlqzalwniDDBDipkxfflpaqkfkgfezbkxdvzemlfohwtgytzzywmwhvzUgPlPdeAVqTPAUZbogQheRXetvT",
"output": "20"
},
{
"input": "200\nNcYVomemswLCUqVRSDKHCknlBmqeSWhVyRzQrnZaOANnTGqsRFMjpczllcEVebqpxdavzppvztxsnfmtcharzqlginndyjkawzurqkxJLXiXKNZTIIxhSQghDpjwzatEqnLMTLxwoEKpHytvWkKFDUcZjLShCiVdocxRvvJtbXHCDGpJvMwRKWLhcTFtswdLUHkbhfau",
"output": "25"
},
{
"input": "200\nDxNZuvkTkQEqdWIkLzcKAwfqvZQiptnTazydSCTIfGjDhLMrlPZiKEsqIdDhgKPAlEvXyzNwWtYorotgkcwydpabjqnzubaksdchucxtkmjzfretdmvlxgklyvicrtftvztsbiUaQorfNIYUOdwQDRsKpxLUiLknbLbinilpPXPTTwLAnXVpMHBaAcKWgDBeOFabPtXU",
"output": "26"
},
{
"input": "4\nabbc",
"output": "3"
},
{
"input": "3\naaa",
"output": "1"
},
{
"input": "3\naba",
"output": "2"
},
{
"input": "3\nabb",
"output": "2"
},
{
"input": "3\nbba",
"output": "2"
},
{
"input": "3\nAaa",
"output": "1"
},
{
"input": "3\nAba",
"output": "2"
},
{
"input": "3\naBa",
"output": "1"
},
{
"input": "3\naAa",
"output": "1"
},
{
"input": "3\naAb",
"output": "1"
},
{
"input": "3\nAaA",
"output": "1"
},
{
"input": "5\naBacd",
"output": "3"
},
{
"input": "5\naAabc",
"output": "3"
}
] | 1,539,246,968
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 124
| 0
|
##a = list(map(int, input().split()))
##print(' '.join(map(str, res)))
n = int(input())
s = input()
res = 0
p = 0
while p < n:
q = p
while q < n and s[q].islower():
q += 1
if q-p > 0:
h = dict()
for i in range(p, q):
if s[i] in h.keys():
h[s[i]] += 1
else:
h.update({s[i]:1})
res = max(res, len(h))
p = q+1
print(res)
|
Title: Polycarp and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
Output Specification:
Print maximum number of elements in pretty set of positions for string *s*.
Demo Input:
['11\naaaaBaabAbA\n', '12\nzACaAbbaazzC\n', '3\nABC\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
|
```python
##a = list(map(int, input().split()))
##print(' '.join(map(str, res)))
n = int(input())
s = input()
res = 0
p = 0
while p < n:
q = p
while q < n and s[q].islower():
q += 1
if q-p > 0:
h = dict()
for i in range(p, q):
if s[i] in h.keys():
h[s[i]] += 1
else:
h.update({s[i]:1})
res = max(res, len(h))
p = q+1
print(res)
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,682,418,331
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 48
| 93
| 0
|
a,b,c=map(int, input().split())
x=a+b+c-max(a,b,c)-min(a,b,c)
print(abs(a-x)+abs(b-x)+abs(c-x))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
a,b,c=map(int, input().split())
x=a+b+c-max(a,b,c)-min(a,b,c)
print(abs(a-x)+abs(b-x)+abs(c-x))
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,641,374,065
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
x = list(map(int,input().strip().split()))
a = x[0]
b = x[1]
if a%2==0 or b%2==0:
print(int(a*b/2))
if a%2!=0 and b%2!=0:
print(int(((a-1)*b/2)+(b-1)/2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
x = list(map(int,input().strip().split()))
a = x[0]
b = x[1]
if a%2==0 or b%2==0:
print(int(a*b/2))
if a%2!=0 and b%2!=0:
print(int(((a-1)*b/2)+(b-1)/2))
```
| 3.977
|
467
|
A
|
George and Accommodation
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
|
Print a single integer — the number of rooms where George and Alex can move in.
|
[
"3\n1 1\n2 2\n3 3\n",
"3\n1 10\n0 10\n10 10\n"
] |
[
"0\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "0"
},
{
"input": "3\n1 10\n0 10\n10 10",
"output": "2"
},
{
"input": "2\n36 67\n61 69",
"output": "2"
},
{
"input": "3\n21 71\n10 88\n43 62",
"output": "3"
},
{
"input": "3\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100",
"output": "10"
},
{
"input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9",
"output": "4"
},
{
"input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54",
"output": "12"
},
{
"input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68",
"output": "10"
},
{
"input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30",
"output": "8"
},
{
"input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14",
"output": "7"
},
{
"input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28",
"output": "22"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "0"
},
{
"input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2",
"output": "68"
},
{
"input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8",
"output": "5"
},
{
"input": "1\n0 0",
"output": "0"
},
{
"input": "1\n100 100",
"output": "0"
},
{
"input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73",
"output": "42"
},
{
"input": "3\n1 3\n2 7\n8 9",
"output": "2"
},
{
"input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53",
"output": "0"
},
{
"input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54",
"output": "0"
},
{
"input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60",
"output": "12"
},
{
"input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3",
"output": "8"
}
] | 1,692,899,006
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 46
| 0
|
n = int(input())
count = 0
for i in range(n):
string = input().split()
p, q = int(string[0]), int(string[1])
if q - p >= 2:
count += 1
else:
continue
print(count)
|
Title: George and Accommodation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Output Specification:
Print a single integer — the number of rooms where George and Alex can move in.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n']
Demo Output:
['0\n', '2\n']
Note:
none
|
```python
n = int(input())
count = 0
for i in range(n):
string = input().split()
p, q = int(string[0]), int(string[1])
if q - p >= 2:
count += 1
else:
continue
print(count)
```
| 3
|
|
863
|
A
|
Quasi-palindrome
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
Let quasi-palindromic number be such number that adding some leading zeros (possible none) to it produces a palindromic string.
String *t* is called a palindrome, if it reads the same from left to right and from right to left.
For example, numbers 131 and 2010200 are quasi-palindromic, they can be transformed to strings "131" and "002010200", respectively, which are palindromes.
You are given some integer number *x*. Check if it's a quasi-palindromic number.
|
The first line contains one integer number *x* (1<=≤<=*x*<=≤<=109). This number is given without any leading zeroes.
|
Print "YES" if number *x* is quasi-palindromic. Otherwise, print "NO" (without quotes).
|
[
"131\n",
"320\n",
"2010200\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
none
| 0
|
[
{
"input": "131",
"output": "YES"
},
{
"input": "320",
"output": "NO"
},
{
"input": "2010200",
"output": "YES"
},
{
"input": "1",
"output": "YES"
},
{
"input": "1000000000",
"output": "YES"
},
{
"input": "999999999",
"output": "YES"
},
{
"input": "999999998",
"output": "NO"
},
{
"input": "102000",
"output": "NO"
},
{
"input": "210000000",
"output": "NO"
},
{
"input": "213443120",
"output": "YES"
},
{
"input": "99",
"output": "YES"
},
{
"input": "22002",
"output": "NO"
},
{
"input": "1010",
"output": "YES"
},
{
"input": "1201",
"output": "NO"
},
{
"input": "6460046",
"output": "NO"
},
{
"input": "503435",
"output": "NO"
},
{
"input": "21002",
"output": "NO"
},
{
"input": "101001",
"output": "NO"
},
{
"input": "200102",
"output": "NO"
},
{
"input": "20010002",
"output": "NO"
},
{
"input": "33003",
"output": "NO"
},
{
"input": "100101",
"output": "NO"
},
{
"input": "1021",
"output": "NO"
},
{
"input": "1101",
"output": "NO"
},
{
"input": "10101100",
"output": "NO"
},
{
"input": "101",
"output": "YES"
},
{
"input": "1011",
"output": "NO"
},
{
"input": "11010",
"output": "NO"
},
{
"input": "10110",
"output": "NO"
},
{
"input": "110000",
"output": "YES"
},
{
"input": "2011",
"output": "NO"
},
{
"input": "10020001",
"output": "NO"
},
{
"input": "12505021",
"output": "NO"
},
{
"input": "12310",
"output": "NO"
},
{
"input": "100501",
"output": "NO"
},
{
"input": "11001",
"output": "NO"
},
{
"input": "20020002",
"output": "NO"
},
{
"input": "202002",
"output": "NO"
},
{
"input": "1001",
"output": "YES"
},
{
"input": "1020021",
"output": "NO"
},
{
"input": "60660",
"output": "NO"
},
{
"input": "98809",
"output": "NO"
},
{
"input": "11000000",
"output": "YES"
},
{
"input": "807008",
"output": "NO"
}
] | 1,588,940,786
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 109
| 6,656,000
|
#ROUNIAUDI
string1=input().strip().strip("0")
str1=string1[::-1]
print("YES" if str1==string1 else "NO")
|
Title: Quasi-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let quasi-palindromic number be such number that adding some leading zeros (possible none) to it produces a palindromic string.
String *t* is called a palindrome, if it reads the same from left to right and from right to left.
For example, numbers 131 and 2010200 are quasi-palindromic, they can be transformed to strings "131" and "002010200", respectively, which are palindromes.
You are given some integer number *x*. Check if it's a quasi-palindromic number.
Input Specification:
The first line contains one integer number *x* (1<=≤<=*x*<=≤<=109). This number is given without any leading zeroes.
Output Specification:
Print "YES" if number *x* is quasi-palindromic. Otherwise, print "NO" (without quotes).
Demo Input:
['131\n', '320\n', '2010200\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none
|
```python
#ROUNIAUDI
string1=input().strip().strip("0")
str1=string1[::-1]
print("YES" if str1==string1 else "NO")
```
| 3
|
|
676
|
A
|
Nicholas and Permutation
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
|
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
|
[
"5\n4 5 1 3 2\n",
"7\n1 6 5 3 4 7 2\n",
"6\n6 5 4 3 2 1\n"
] |
[
"3\n",
"6\n",
"5\n"
] |
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
| 500
|
[
{
"input": "5\n4 5 1 3 2",
"output": "3"
},
{
"input": "7\n1 6 5 3 4 7 2",
"output": "6"
},
{
"input": "6\n6 5 4 3 2 1",
"output": "5"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "5\n1 4 5 2 3",
"output": "4"
},
{
"input": "6\n4 6 3 5 2 1",
"output": "5"
},
{
"input": "7\n1 5 3 6 2 4 7",
"output": "6"
},
{
"input": "100\n76 70 67 54 40 1 48 63 64 36 42 90 99 27 47 17 93 7 13 84 16 57 74 5 83 61 19 56 52 92 38 91 82 79 34 66 71 28 37 98 35 94 77 53 73 10 26 80 15 32 8 81 3 95 44 46 72 6 33 11 21 85 4 30 24 51 49 96 87 55 14 31 12 60 45 9 29 22 58 18 88 2 50 59 20 86 23 41 100 39 62 68 69 97 78 43 25 89 65 75",
"output": "94"
},
{
"input": "8\n4 5 3 8 6 7 1 2",
"output": "6"
},
{
"input": "9\n6 8 5 3 4 7 9 2 1",
"output": "8"
},
{
"input": "10\n8 7 10 1 2 3 4 6 5 9",
"output": "7"
},
{
"input": "11\n5 4 6 9 10 11 7 3 1 2 8",
"output": "8"
},
{
"input": "12\n3 6 7 8 9 10 12 5 4 2 11 1",
"output": "11"
},
{
"input": "13\n8 4 3 7 5 11 9 1 10 2 13 12 6",
"output": "10"
},
{
"input": "14\n6 10 13 9 7 1 12 14 3 2 5 4 11 8",
"output": "8"
},
{
"input": "15\n3 14 13 12 7 2 4 11 15 1 8 6 5 10 9",
"output": "9"
},
{
"input": "16\n11 6 9 8 7 14 12 13 10 15 2 5 3 1 4 16",
"output": "15"
},
{
"input": "17\n13 12 5 3 9 16 8 14 2 4 10 1 6 11 7 15 17",
"output": "16"
},
{
"input": "18\n8 6 14 17 9 11 15 13 5 3 18 1 2 7 12 16 4 10",
"output": "11"
},
{
"input": "19\n12 19 3 11 15 6 18 14 5 10 2 13 9 7 4 8 17 16 1",
"output": "18"
},
{
"input": "20\n15 17 10 20 7 2 16 9 13 6 18 5 19 8 11 14 4 12 3 1",
"output": "19"
},
{
"input": "21\n1 9 14 18 13 12 11 20 16 2 4 19 15 7 6 17 8 5 3 10 21",
"output": "20"
},
{
"input": "22\n8 3 17 4 16 21 14 11 10 15 6 18 13 12 22 20 5 2 9 7 19 1",
"output": "21"
},
{
"input": "23\n1 23 11 20 9 3 12 4 7 17 5 15 2 10 18 16 8 22 14 13 19 21 6",
"output": "22"
},
{
"input": "24\n2 10 23 22 20 19 18 16 11 12 15 17 21 8 24 13 1 5 6 7 14 3 9 4",
"output": "16"
},
{
"input": "25\n12 13 22 17 1 18 14 5 21 2 10 4 3 23 11 6 20 8 24 16 15 19 9 7 25",
"output": "24"
},
{
"input": "26\n6 21 20 16 26 17 11 2 24 4 1 12 14 8 25 7 15 10 22 5 13 18 9 23 19 3",
"output": "21"
},
{
"input": "27\n20 14 18 10 5 3 9 4 24 22 21 27 17 15 26 2 23 7 12 11 6 8 19 25 16 13 1",
"output": "26"
},
{
"input": "28\n28 13 16 6 1 12 4 27 22 7 18 3 21 26 25 11 5 10 20 24 19 15 14 8 23 17 9 2",
"output": "27"
},
{
"input": "29\n21 11 10 25 2 5 9 16 29 8 17 4 15 13 6 22 7 24 19 12 18 20 1 3 23 28 27 14 26",
"output": "22"
},
{
"input": "30\n6 19 14 22 26 17 27 8 25 3 24 30 4 18 23 16 9 13 29 20 15 2 5 11 28 12 1 10 21 7",
"output": "26"
},
{
"input": "31\n29 13 26 27 9 28 2 16 30 21 12 11 3 31 23 6 22 20 1 5 14 24 19 18 8 4 10 17 15 25 7",
"output": "18"
},
{
"input": "32\n15 32 11 3 18 23 19 14 5 8 6 21 13 24 25 4 16 9 27 20 17 31 2 22 7 12 30 1 26 10 29 28",
"output": "30"
},
{
"input": "33\n22 13 10 33 8 25 15 14 21 28 27 19 26 24 1 12 5 11 32 20 30 31 18 4 6 23 7 29 16 2 17 9 3",
"output": "29"
},
{
"input": "34\n34 30 7 16 6 1 10 23 29 13 15 25 32 26 18 11 28 3 14 21 19 5 31 33 4 17 8 9 24 20 27 22 2 12",
"output": "33"
},
{
"input": "35\n24 33 20 8 34 11 31 25 2 4 18 13 9 35 16 30 23 32 17 1 14 22 19 21 28 26 3 15 5 12 27 29 10 6 7",
"output": "21"
},
{
"input": "36\n1 32 27 35 22 7 34 15 18 36 31 28 13 2 10 21 20 17 16 4 3 24 19 29 11 12 25 5 33 26 14 6 9 23 30 8",
"output": "35"
},
{
"input": "37\n24 1 12 23 11 6 30 15 4 21 13 20 25 17 5 8 36 19 32 26 14 9 7 18 10 29 37 35 16 2 22 34 3 27 31 33 28",
"output": "35"
},
{
"input": "38\n9 35 37 28 36 21 10 25 19 4 26 5 22 7 27 18 6 14 15 24 1 17 11 34 20 8 2 16 3 23 32 31 13 12 38 33 30 29",
"output": "34"
},
{
"input": "39\n16 28 4 33 26 36 25 23 22 30 27 7 12 34 17 6 3 38 10 24 13 31 29 39 14 32 9 20 35 11 18 21 8 2 15 37 5 19 1",
"output": "38"
},
{
"input": "40\n35 39 28 11 9 31 36 8 5 32 26 19 38 33 2 22 23 25 6 37 12 7 3 10 17 24 20 16 27 4 34 15 40 14 18 13 29 21 30 1",
"output": "39"
},
{
"input": "41\n24 18 7 23 3 15 1 17 25 5 30 10 34 36 2 14 9 21 41 40 20 28 33 35 12 22 11 8 19 16 31 27 26 32 29 4 13 38 37 39 6",
"output": "34"
},
{
"input": "42\n42 15 24 26 4 34 19 29 38 32 31 33 14 41 21 3 11 39 25 6 5 20 23 10 16 36 18 28 27 1 7 40 22 30 9 2 37 17 8 12 13 35",
"output": "41"
},
{
"input": "43\n43 24 20 13 22 29 28 4 30 3 32 40 31 8 7 9 35 27 18 5 42 6 17 19 23 12 41 21 16 37 33 34 2 14 36 38 25 10 15 39 26 11 1",
"output": "42"
},
{
"input": "44\n4 38 6 40 29 3 44 2 30 35 25 36 34 10 11 31 21 7 14 23 37 19 27 18 5 22 1 16 17 9 39 13 15 32 43 8 41 26 42 12 24 33 20 28",
"output": "37"
},
{
"input": "45\n45 29 24 2 31 5 34 41 26 44 33 43 15 3 4 11 21 37 27 12 14 39 23 42 16 6 13 19 8 38 20 9 25 22 40 17 32 35 18 10 28 7 30 36 1",
"output": "44"
},
{
"input": "46\n29 3 12 33 45 40 19 17 25 27 28 1 16 23 24 46 31 8 44 15 5 32 22 11 4 36 34 10 35 26 21 7 14 2 18 9 20 41 6 43 42 37 38 13 39 30",
"output": "34"
},
{
"input": "47\n7 3 8 12 24 16 29 10 28 38 1 20 37 40 21 5 15 6 45 23 36 44 25 43 41 4 11 42 18 35 32 31 39 33 27 30 22 34 14 13 17 47 19 9 46 26 2",
"output": "41"
},
{
"input": "48\n29 26 14 18 34 33 13 39 32 1 37 20 35 19 28 48 30 23 46 27 5 22 24 38 12 15 8 36 43 45 16 47 6 9 31 40 44 17 2 41 11 42 25 4 21 3 10 7",
"output": "38"
},
{
"input": "49\n16 7 42 32 11 35 15 8 23 41 6 20 47 24 9 45 49 2 37 48 25 28 5 18 3 19 12 4 22 33 13 14 10 36 44 17 40 38 30 26 1 43 29 46 21 34 27 39 31",
"output": "40"
},
{
"input": "50\n31 45 3 34 13 43 32 4 42 9 7 8 24 14 35 6 19 46 44 17 18 1 25 20 27 41 2 16 12 10 11 47 38 21 28 49 30 15 50 36 29 26 22 39 48 5 23 37 33 40",
"output": "38"
},
{
"input": "51\n47 29 2 11 43 44 27 1 39 14 25 30 33 21 38 45 34 51 16 50 42 31 41 46 15 48 13 19 6 37 35 7 22 28 20 4 17 10 5 8 24 40 9 36 18 49 12 26 23 3 32",
"output": "43"
},
{
"input": "52\n16 45 23 7 15 19 43 20 4 32 35 36 9 50 5 26 38 46 13 33 12 2 48 37 41 31 10 28 8 42 3 21 11 1 17 27 34 30 44 40 6 51 49 47 25 22 18 24 52 29 14 39",
"output": "48"
},
{
"input": "53\n53 30 50 22 51 31 32 38 12 7 39 43 1 23 6 8 24 52 2 21 34 13 3 35 5 15 19 11 47 18 9 20 29 4 36 45 27 41 25 48 16 46 44 17 10 14 42 26 40 28 33 37 49",
"output": "52"
},
{
"input": "54\n6 39 17 3 45 52 16 21 23 48 42 36 13 37 46 10 43 27 49 7 38 32 31 30 15 25 2 29 8 51 54 19 41 44 24 34 22 5 20 14 12 1 33 40 4 26 9 35 18 28 47 50 11 53",
"output": "41"
},
{
"input": "55\n26 15 31 21 32 43 34 51 7 12 5 44 17 54 18 25 48 47 20 3 41 24 45 2 11 22 29 39 37 53 35 28 36 9 50 10 30 38 19 13 4 8 27 1 42 6 49 23 55 40 33 16 46 14 52",
"output": "48"
},
{
"input": "56\n6 20 38 46 10 11 40 19 5 1 47 33 4 18 32 36 37 45 56 49 48 52 12 26 31 14 2 9 24 3 16 51 41 43 23 17 34 7 29 50 55 25 39 44 22 27 54 8 28 35 30 42 13 53 21 15",
"output": "46"
},
{
"input": "57\n39 28 53 36 3 6 12 56 55 20 50 19 43 42 18 40 24 52 38 17 33 23 22 41 14 7 26 44 45 16 35 1 8 47 31 5 30 51 32 4 37 25 13 34 54 21 46 10 15 11 2 27 29 48 49 9 57",
"output": "56"
},
{
"input": "58\n1 26 28 14 22 33 57 40 9 42 44 37 24 19 58 12 48 3 34 31 49 4 16 47 55 52 27 23 46 18 20 32 56 6 39 36 41 38 13 43 45 21 53 54 29 17 5 10 25 30 2 35 11 7 15 51 8 50",
"output": "57"
},
{
"input": "59\n1 27 10 37 53 9 14 49 46 26 50 42 59 11 47 15 24 56 43 45 44 38 5 8 58 30 52 12 23 32 22 3 31 41 2 25 29 6 54 16 35 33 18 55 4 51 57 28 40 19 13 21 7 39 36 48 34 17 20",
"output": "58"
},
{
"input": "60\n60 27 34 32 54 55 33 12 40 3 47 44 50 39 38 59 11 25 17 15 16 30 21 31 10 52 5 23 4 48 6 26 36 57 14 22 8 56 58 9 24 7 37 53 42 43 20 49 51 19 2 46 28 18 35 13 29 45 41 1",
"output": "59"
},
{
"input": "61\n61 11 26 29 31 40 32 30 35 3 18 52 9 53 42 4 50 54 20 58 28 49 22 12 2 19 16 15 57 34 51 43 7 17 25 41 56 47 55 60 46 14 44 45 24 27 33 1 48 13 59 23 38 39 6 5 36 10 8 37 21",
"output": "60"
},
{
"input": "62\n21 23 34 38 11 61 55 30 37 48 54 51 46 47 6 56 36 49 1 35 12 28 29 20 43 42 5 8 22 57 44 4 53 10 58 33 27 25 16 45 50 40 18 15 3 41 39 2 7 60 59 13 32 24 52 31 14 9 19 26 17 62",
"output": "61"
},
{
"input": "63\n2 5 29 48 31 26 21 16 47 24 43 22 61 28 6 39 60 27 14 52 37 7 53 8 62 56 63 10 50 18 44 13 4 9 25 11 23 42 45 41 59 12 32 36 40 51 1 35 49 54 57 20 19 34 38 46 33 3 55 15 30 58 17",
"output": "46"
},
{
"input": "64\n23 5 51 40 12 46 44 8 64 31 58 55 45 24 54 39 21 19 52 61 30 42 16 18 15 32 53 22 28 26 11 25 48 56 27 9 29 41 35 49 59 38 62 7 34 1 20 33 60 17 2 3 43 37 57 14 6 36 13 10 50 4 63 47",
"output": "55"
},
{
"input": "65\n10 11 55 43 53 25 35 26 16 37 41 38 59 21 48 2 65 49 17 23 18 30 62 36 3 4 47 15 28 63 57 54 31 46 44 12 51 7 29 13 56 52 14 22 39 19 8 27 45 5 6 34 32 61 20 50 9 24 33 58 60 40 1 42 64",
"output": "62"
},
{
"input": "66\n66 39 3 2 55 53 60 54 12 49 10 30 59 26 32 46 50 56 7 13 43 36 24 28 11 8 6 21 35 25 42 57 23 45 64 5 34 61 27 51 52 9 15 1 38 17 63 48 37 20 58 14 47 19 22 41 31 44 33 65 4 62 40 18 16 29",
"output": "65"
},
{
"input": "67\n66 16 2 53 35 38 49 28 18 6 36 58 21 47 27 5 50 62 44 12 52 37 11 56 15 31 25 65 17 29 59 41 7 42 4 43 39 10 1 40 24 13 20 54 19 67 46 60 51 45 64 30 8 33 26 9 3 22 34 23 57 48 55 14 63 61 32",
"output": "45"
},
{
"input": "68\n13 6 27 21 65 23 59 14 62 43 33 31 38 41 67 20 16 25 42 4 28 40 29 9 64 17 2 26 32 58 60 53 46 48 47 54 44 50 39 19 30 57 61 1 11 18 37 24 55 15 63 34 8 52 56 7 10 12 35 66 5 36 45 49 68 22 51 3",
"output": "64"
},
{
"input": "69\n29 49 25 51 21 35 11 61 39 54 40 37 60 42 27 33 59 53 34 10 46 2 23 69 8 47 58 36 1 38 19 12 7 48 13 3 6 22 18 5 65 24 50 41 66 44 67 57 4 56 62 43 9 30 14 15 28 31 64 26 16 55 68 17 32 20 45 52 63",
"output": "45"
},
{
"input": "70\n19 12 15 18 36 16 61 69 24 7 11 13 3 48 55 21 37 17 43 31 41 22 28 32 27 63 38 49 59 56 30 25 67 51 52 45 50 44 66 57 26 60 5 46 33 6 23 34 8 40 2 68 14 39 65 64 62 42 47 54 10 53 9 1 70 58 20 4 29 35",
"output": "64"
},
{
"input": "71\n40 6 62 3 41 52 31 66 27 16 35 5 17 60 2 15 51 22 67 61 71 53 1 64 8 45 28 18 50 30 12 69 20 26 10 37 36 49 70 32 33 11 57 14 9 55 4 58 29 25 44 65 39 48 24 47 19 46 56 38 34 42 59 63 54 23 7 68 43 13 21",
"output": "50"
},
{
"input": "72\n52 64 71 40 32 10 62 21 11 37 38 13 22 70 1 66 41 50 27 20 42 47 25 68 49 12 15 72 44 60 53 5 23 14 43 29 65 36 51 54 35 67 7 19 55 48 58 46 39 24 33 30 61 45 57 2 31 3 18 59 6 9 4 63 8 16 26 34 28 69 17 56",
"output": "57"
},
{
"input": "73\n58 38 47 34 39 64 69 66 72 57 9 4 67 22 35 13 61 14 28 52 56 20 31 70 27 24 36 1 62 17 10 5 12 33 16 73 18 49 63 71 44 65 23 30 40 8 50 46 60 25 11 26 37 55 29 68 42 2 3 32 59 7 15 43 41 48 51 53 6 45 54 19 21",
"output": "45"
},
{
"input": "74\n19 51 59 34 8 40 42 55 65 16 74 26 49 63 64 70 35 72 7 12 43 18 61 27 47 31 13 32 71 22 25 67 9 1 48 50 33 10 21 46 11 45 17 37 28 60 69 66 38 2 30 3 39 15 53 68 57 41 6 36 24 73 4 23 5 62 44 14 20 29 52 54 56 58",
"output": "63"
},
{
"input": "75\n75 28 60 19 59 17 65 26 32 23 18 64 8 62 4 11 42 16 47 5 72 46 9 1 25 21 2 50 33 6 36 68 30 12 20 40 53 45 34 7 37 39 38 44 63 61 67 3 66 51 29 73 24 57 70 27 10 56 22 55 13 49 35 15 54 41 14 74 69 48 52 31 71 43 58",
"output": "74"
},
{
"input": "76\n1 47 54 17 38 37 12 32 14 48 43 71 60 56 4 13 64 41 52 57 62 24 23 49 20 10 63 3 25 66 59 40 58 33 53 46 70 7 35 61 72 74 73 19 30 5 29 6 15 28 21 27 51 55 50 9 65 8 67 39 76 42 31 34 16 2 36 11 26 44 22 45 75 18 69 68",
"output": "75"
},
{
"input": "77\n10 20 57 65 53 69 59 45 58 32 28 72 4 14 1 33 40 47 7 5 51 76 37 16 41 61 42 2 21 26 38 74 35 64 43 77 71 50 39 48 27 63 73 44 52 66 9 18 23 54 25 6 8 56 13 67 36 22 15 46 62 75 55 11 31 17 24 29 60 68 12 30 3 70 49 19 34",
"output": "62"
},
{
"input": "78\n7 61 69 47 68 42 65 78 70 3 32 59 49 51 23 71 11 63 22 18 43 34 24 13 27 16 19 40 21 46 48 77 28 66 54 67 60 15 75 62 9 26 52 58 4 25 8 37 41 76 1 6 30 50 44 36 5 14 29 53 17 12 2 57 73 35 64 39 56 10 33 20 45 74 31 55 38 72",
"output": "70"
},
{
"input": "79\n75 79 43 66 72 52 29 65 74 38 24 1 5 51 13 7 71 33 4 61 2 36 63 47 64 44 34 27 3 21 17 37 54 53 49 20 28 60 39 10 16 76 6 77 73 22 50 48 78 30 67 56 31 26 40 59 41 11 18 45 69 62 15 23 32 70 19 55 68 57 35 25 12 46 14 42 9 8 58",
"output": "77"
},
{
"input": "80\n51 20 37 12 68 11 28 52 76 21 7 5 3 16 64 34 25 2 6 40 60 62 75 13 45 17 56 29 32 47 79 73 49 72 15 46 30 54 80 27 43 24 74 18 42 71 14 4 44 63 65 33 1 77 55 57 41 59 58 70 69 35 19 67 10 36 26 23 48 50 39 61 9 66 38 8 31 22 53 78",
"output": "52"
},
{
"input": "81\n63 22 4 41 43 74 64 39 10 35 20 81 11 28 70 67 53 79 16 61 68 52 27 37 58 9 50 49 18 30 72 47 7 60 78 51 23 48 73 66 44 13 15 57 56 38 1 76 25 45 36 34 42 8 75 26 59 14 71 21 6 77 5 17 2 32 40 54 46 24 29 3 31 19 65 62 33 69 12 80 55",
"output": "69"
},
{
"input": "82\n50 24 17 41 49 18 80 11 79 72 57 31 21 35 2 51 36 66 20 65 38 3 45 32 59 81 28 30 70 55 29 76 73 6 33 39 8 7 19 48 63 1 77 43 4 13 78 54 69 9 40 46 74 82 60 71 16 64 12 14 47 26 44 5 10 75 53 25 27 15 56 42 58 34 23 61 67 62 68 22 37 52",
"output": "53"
},
{
"input": "83\n64 8 58 17 67 46 3 82 23 70 72 16 53 45 13 20 12 48 40 4 6 47 76 60 19 44 30 78 28 22 75 15 25 29 63 74 55 32 14 51 35 31 62 77 27 42 65 71 56 61 66 41 68 49 7 34 2 83 36 5 33 26 37 80 59 50 1 9 54 21 18 24 38 73 81 52 10 39 43 79 57 11 69",
"output": "66"
},
{
"input": "84\n75 8 66 21 61 63 72 51 52 13 59 25 28 58 64 53 79 41 34 7 67 11 39 56 44 24 50 9 49 55 1 80 26 6 73 74 27 69 65 37 18 43 36 17 30 3 47 29 76 78 32 22 12 68 46 5 42 81 57 31 33 83 54 48 14 62 10 16 4 20 71 70 35 15 45 19 60 77 2 23 84 40 82 38",
"output": "80"
},
{
"input": "85\n1 18 58 8 22 76 3 61 12 33 54 41 6 24 82 15 10 17 38 64 26 4 62 28 47 14 66 9 84 75 2 71 67 43 37 32 85 21 69 52 55 63 81 51 74 59 65 34 29 36 30 45 27 53 13 79 39 57 5 70 19 40 7 42 68 48 16 80 83 23 46 35 72 31 11 44 73 77 50 56 49 25 60 20 78",
"output": "84"
},
{
"input": "86\n64 56 41 10 31 69 47 39 37 36 27 19 9 42 15 6 78 59 52 17 71 45 72 14 2 54 38 79 4 18 16 8 46 75 50 82 44 24 20 55 58 86 61 43 35 32 33 40 63 30 28 60 13 53 12 57 77 81 76 66 73 84 85 62 68 22 51 5 49 7 1 70 80 65 34 48 23 21 83 11 74 26 29 67 25 3",
"output": "70"
},
{
"input": "87\n14 20 82 47 39 75 71 45 3 37 63 19 32 68 7 41 48 76 27 46 84 49 4 44 26 69 17 64 1 18 58 33 11 23 21 86 67 52 70 16 77 78 6 74 15 87 10 59 13 34 22 2 65 38 66 61 51 57 35 60 81 40 36 80 31 43 83 56 79 55 29 5 12 8 50 30 53 72 54 9 24 25 42 62 73 28 85",
"output": "58"
},
{
"input": "88\n1 83 73 46 61 31 39 86 57 43 16 29 26 80 82 7 36 42 13 20 6 64 19 40 24 12 47 87 8 34 75 9 69 3 11 52 14 25 84 59 27 10 54 51 81 74 65 77 70 17 60 35 23 44 49 2 4 88 5 21 41 32 68 66 15 55 48 58 78 53 22 38 45 33 30 50 85 76 37 79 63 18 28 62 72 56 71 67",
"output": "87"
},
{
"input": "89\n68 40 14 58 56 25 8 44 49 55 9 76 66 54 33 81 42 15 59 17 21 30 75 60 4 48 64 6 52 63 61 27 12 57 72 67 23 86 77 80 22 13 43 73 26 78 50 51 18 62 1 29 82 16 74 2 87 24 3 41 11 46 47 69 10 84 65 39 35 79 70 32 34 31 20 19 53 71 36 28 83 88 38 85 7 5 37 45 89",
"output": "88"
},
{
"input": "90\n2 67 26 58 9 49 76 22 60 30 77 20 13 7 37 81 47 16 19 12 14 45 41 68 85 54 28 24 46 1 27 43 32 89 53 35 59 75 18 51 17 64 66 80 31 88 87 90 38 72 55 71 42 11 73 69 62 78 23 74 65 79 84 4 86 52 10 6 3 82 56 5 48 33 21 57 40 29 61 63 34 36 83 8 15 44 50 70 39 25",
"output": "60"
},
{
"input": "91\n91 69 56 16 73 55 14 82 80 46 57 81 22 71 63 76 43 37 77 75 70 3 26 2 28 17 51 38 30 67 41 47 54 62 34 25 84 11 87 39 32 52 31 36 50 19 21 53 29 24 79 8 74 64 44 7 6 18 10 42 13 9 83 58 4 88 65 60 20 90 66 49 86 89 78 48 5 27 23 59 61 15 72 45 40 33 68 85 35 12 1",
"output": "90"
},
{
"input": "92\n67 57 76 78 25 89 6 82 11 16 26 17 59 48 73 10 21 31 27 80 4 5 22 13 92 55 45 85 63 28 75 60 54 88 91 47 29 35 7 87 1 39 43 51 71 84 83 81 46 9 38 56 90 24 37 41 19 86 50 61 79 20 18 14 69 23 62 65 49 52 58 53 36 2 68 64 15 42 30 34 66 32 44 40 8 33 3 77 74 12 70 72",
"output": "67"
},
{
"input": "93\n76 35 5 87 7 21 59 71 24 37 2 73 31 74 4 52 28 20 56 27 65 86 16 45 85 67 68 70 47 72 91 88 14 32 62 69 78 41 15 22 57 18 50 13 39 58 17 83 64 51 25 11 38 77 82 90 8 26 29 61 10 43 79 53 48 6 23 55 63 49 81 92 80 44 89 60 66 30 1 9 36 33 19 46 75 93 3 12 42 84 40 54 34",
"output": "85"
},
{
"input": "94\n29 85 82 78 61 83 80 63 11 38 50 43 9 24 4 87 79 45 3 17 90 7 34 27 1 76 26 39 84 47 22 41 81 19 44 23 56 92 35 31 72 62 70 53 40 88 13 14 73 2 59 86 46 94 15 12 77 57 89 42 75 48 18 51 32 55 71 30 49 91 20 60 5 93 33 64 21 36 10 28 8 65 66 69 74 58 6 52 25 67 16 37 54 68",
"output": "69"
},
{
"input": "95\n36 73 18 77 15 71 50 57 79 65 94 88 9 69 52 70 26 66 78 89 55 20 72 83 75 68 32 28 45 74 19 22 54 23 84 90 86 12 42 58 11 81 39 31 85 47 60 44 59 43 21 7 30 41 64 76 93 46 87 48 10 40 3 14 38 49 29 35 2 67 5 34 13 37 27 56 91 17 62 80 8 61 53 95 24 92 6 82 63 33 51 25 4 16 1",
"output": "94"
},
{
"input": "96\n64 3 47 83 19 10 72 61 73 95 16 40 54 84 8 86 28 4 37 42 92 48 63 76 67 1 59 66 20 35 93 2 43 7 45 70 34 33 26 91 85 89 13 29 58 68 44 25 87 75 49 71 41 17 55 36 32 31 74 22 52 79 30 88 50 78 38 39 65 27 69 77 81 94 82 53 21 80 57 60 24 46 51 9 18 15 96 62 6 23 11 12 90 5 14 56",
"output": "86"
},
{
"input": "97\n40 63 44 64 84 92 38 41 28 91 3 70 76 67 94 96 35 79 29 22 78 88 85 8 21 1 93 54 71 80 37 17 13 26 62 59 75 87 69 33 89 49 77 61 12 39 6 36 58 18 73 50 82 45 74 52 11 34 95 7 23 30 15 32 31 16 55 19 20 83 60 72 10 53 51 14 27 9 68 47 5 2 81 46 57 86 56 43 48 66 24 25 4 42 65 97 90",
"output": "95"
},
{
"input": "98\n85 94 69 86 22 52 27 79 53 91 35 55 33 88 8 75 76 95 64 54 67 30 70 49 6 16 2 48 80 32 25 90 98 46 9 96 36 81 10 92 28 11 37 97 15 41 38 40 83 44 29 47 23 3 31 61 87 39 78 20 68 12 17 73 59 18 77 72 43 51 84 24 89 65 26 7 74 93 21 19 5 14 50 42 82 71 60 56 34 62 58 57 45 66 13 63 4 1",
"output": "97"
},
{
"input": "99\n33 48 19 41 59 64 16 12 17 13 7 1 9 6 4 92 61 49 60 25 74 65 22 97 30 32 10 62 14 55 80 66 82 78 31 23 87 93 27 98 20 29 88 84 77 34 83 96 79 90 56 89 58 72 52 47 21 76 24 70 44 94 5 39 8 18 57 36 40 68 43 75 3 2 35 99 63 26 67 73 15 11 53 28 42 46 69 50 51 95 38 37 54 85 81 91 45 86 71",
"output": "87"
},
{
"input": "100\n28 30 77 4 81 67 31 25 66 56 88 73 83 51 57 34 21 90 38 76 22 99 53 70 91 3 64 54 6 94 8 5 97 80 50 45 61 40 16 95 36 98 9 2 17 44 72 55 18 58 47 12 87 24 7 32 14 23 65 41 63 48 62 39 92 27 43 19 46 13 42 52 96 84 26 69 100 79 93 49 35 60 71 59 68 15 10 29 20 1 78 33 75 86 11 85 74 82 89 37",
"output": "89"
},
{
"input": "100\n100 97 35 55 45 3 46 98 77 64 94 85 73 43 49 79 72 9 70 62 80 88 29 58 61 20 89 83 66 86 82 15 6 87 42 96 90 75 63 38 81 40 5 23 4 18 41 19 99 60 8 12 76 51 39 93 53 26 21 50 47 28 13 30 68 59 34 54 24 56 31 27 65 16 32 10 36 52 44 91 22 14 33 25 7 78 67 17 57 37 92 11 2 69 84 95 74 71 48 1",
"output": "99"
},
{
"input": "100\n83 96 73 70 30 25 7 77 58 89 76 85 49 82 45 51 14 62 50 9 31 32 16 15 97 64 4 37 20 93 24 10 80 71 100 39 75 72 78 74 8 29 53 86 79 48 3 68 90 99 56 87 63 94 36 1 40 65 6 44 43 84 17 52 34 95 38 47 60 57 98 59 33 41 46 81 23 27 19 2 54 91 55 35 26 12 92 18 28 66 69 21 5 67 13 11 22 88 61 42",
"output": "65"
},
{
"input": "100\n96 80 47 60 56 9 78 20 37 72 68 15 100 94 51 26 65 38 50 19 4 70 25 63 22 30 13 58 43 69 18 33 5 66 39 73 12 55 95 92 97 1 14 83 10 28 64 31 46 91 32 86 74 54 29 52 89 53 90 44 62 40 16 24 67 81 36 34 7 23 79 87 75 98 84 3 41 77 76 42 71 35 49 61 2 27 59 82 99 85 21 11 45 6 88 48 17 57 8 93",
"output": "87"
},
{
"input": "100\n5 6 88 37 97 51 25 81 54 17 57 98 99 44 67 24 30 93 100 36 8 38 84 42 21 4 75 31 85 48 70 77 43 50 65 94 29 32 68 86 56 39 69 47 20 60 52 53 10 34 79 2 95 40 89 64 71 26 22 46 1 62 91 76 83 41 9 78 16 63 13 3 28 92 27 49 7 12 96 72 80 23 14 19 18 66 59 87 90 45 73 82 33 74 35 61 55 15 58 11",
"output": "81"
},
{
"input": "100\n100 97 92 12 62 17 19 58 37 26 30 95 31 35 87 10 13 43 98 61 28 89 76 1 23 21 11 22 50 56 91 74 3 24 96 55 64 67 14 4 71 16 18 9 77 68 51 81 32 82 46 88 86 60 29 66 72 85 70 7 53 63 33 45 83 2 25 94 52 93 5 69 20 47 49 54 57 39 34 27 90 80 78 59 40 42 79 6 38 8 48 15 65 73 99 44 41 84 36 75",
"output": "99"
},
{
"input": "100\n22 47 34 65 69 5 68 78 53 54 41 23 80 51 11 8 2 85 81 75 25 58 29 73 30 49 10 71 17 96 76 89 79 20 12 15 55 7 46 32 19 3 82 35 74 44 38 40 92 14 6 50 97 63 45 93 37 18 62 77 87 36 83 9 90 61 57 28 39 43 52 42 24 56 21 84 26 99 88 59 33 70 4 60 98 95 94 100 13 48 66 72 16 31 64 91 1 86 27 67",
"output": "96"
},
{
"input": "100\n41 67 94 18 14 83 59 12 19 54 13 68 75 26 15 65 80 40 23 30 34 78 47 21 63 79 4 70 3 31 86 69 92 10 61 74 97 100 9 99 32 27 91 55 85 52 16 17 28 1 64 29 58 76 98 25 84 7 2 96 20 72 36 46 49 82 93 44 45 6 38 87 57 50 53 35 60 33 8 89 39 42 37 48 62 81 73 43 95 11 66 88 90 22 24 77 71 51 5 56",
"output": "62"
},
{
"input": "100\n1 88 38 56 62 99 39 80 12 33 57 24 28 84 37 42 10 95 83 58 8 40 20 2 30 78 60 79 36 71 51 31 27 65 22 47 6 19 61 94 75 4 74 35 15 23 92 9 70 13 11 59 90 18 66 81 64 72 16 32 34 67 46 91 21 87 77 97 82 41 7 86 26 43 45 3 93 17 52 96 50 63 48 5 53 44 29 25 98 54 49 14 73 69 89 55 76 85 68 100",
"output": "99"
},
{
"input": "100\n22 59 25 77 68 79 32 45 20 28 61 60 38 86 33 10 100 15 53 75 78 39 67 13 66 34 96 4 63 23 73 29 31 35 71 55 16 14 72 56 94 97 17 93 47 84 57 8 21 51 54 85 26 76 49 81 2 92 62 44 91 87 11 24 95 69 5 7 99 6 65 48 70 12 41 18 74 27 42 3 80 30 50 98 58 37 82 89 83 36 40 52 19 9 88 46 43 1 90 64",
"output": "97"
},
{
"input": "100\n12 1 76 78 97 82 59 80 48 8 91 51 54 74 16 10 89 99 83 63 93 90 55 25 30 33 29 6 9 65 92 79 44 39 15 58 37 46 32 19 27 3 75 49 62 71 98 42 69 50 26 81 96 5 7 61 60 21 20 36 18 34 40 4 47 85 64 38 22 84 2 68 11 56 31 66 17 14 95 43 53 35 23 52 70 13 72 45 41 77 73 87 88 94 28 86 24 67 100 57",
"output": "98"
},
{
"input": "100\n66 100 53 88 7 73 54 41 31 42 8 46 65 90 78 14 94 30 79 39 89 5 83 50 38 61 37 86 22 95 60 98 34 57 91 10 75 25 15 43 23 17 96 35 93 48 87 47 56 13 19 9 82 62 67 80 11 55 99 70 18 26 58 85 12 44 16 45 4 49 20 71 92 24 81 2 76 32 6 21 84 36 52 97 59 63 40 51 27 64 68 3 77 72 28 33 29 1 74 69",
"output": "98"
},
{
"input": "100\n56 64 1 95 72 39 9 49 87 29 94 7 32 6 30 48 50 25 31 78 90 45 60 44 80 68 17 20 73 15 75 98 83 13 71 22 36 26 96 88 35 3 85 54 16 41 92 99 69 86 93 33 43 62 77 46 47 37 12 10 18 40 27 4 63 55 28 59 23 34 61 53 76 42 51 91 21 70 8 58 38 19 5 66 84 11 52 24 81 82 79 67 97 65 57 74 2 89 100 14",
"output": "98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "4\n1 2 3 4",
"output": "3"
},
{
"input": "4\n1 2 4 3",
"output": "3"
},
{
"input": "4\n1 3 2 4",
"output": "3"
},
{
"input": "4\n1 3 4 2",
"output": "3"
},
{
"input": "4\n1 4 2 3",
"output": "3"
},
{
"input": "4\n1 4 3 2",
"output": "3"
},
{
"input": "4\n2 1 3 4",
"output": "3"
},
{
"input": "4\n2 1 4 3",
"output": "2"
},
{
"input": "4\n2 4 1 3",
"output": "2"
},
{
"input": "4\n2 4 3 1",
"output": "3"
},
{
"input": "4\n3 1 2 4",
"output": "3"
},
{
"input": "4\n3 1 4 2",
"output": "2"
},
{
"input": "4\n3 2 1 4",
"output": "3"
},
{
"input": "4\n3 2 4 1",
"output": "3"
},
{
"input": "4\n3 4 1 2",
"output": "2"
},
{
"input": "4\n3 4 2 1",
"output": "3"
},
{
"input": "4\n4 1 2 3",
"output": "3"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "4\n4 2 1 3",
"output": "3"
},
{
"input": "4\n4 2 3 1",
"output": "3"
},
{
"input": "4\n4 3 1 2",
"output": "3"
},
{
"input": "4\n4 3 2 1",
"output": "3"
},
{
"input": "8\n2 5 6 4 8 3 1 7",
"output": "6"
},
{
"input": "5\n2 3 1 5 4",
"output": "3"
},
{
"input": "6\n2 5 3 6 4 1",
"output": "5"
},
{
"input": "6\n5 4 2 6 1 3",
"output": "4"
},
{
"input": "6\n4 2 3 1 6 5",
"output": "4"
},
{
"input": "6\n5 4 2 1 6 3",
"output": "4"
},
{
"input": "9\n7 2 3 4 5 6 1 9 8",
"output": "7"
},
{
"input": "6\n3 2 1 4 6 5",
"output": "4"
},
{
"input": "6\n2 3 4 1 6 5",
"output": "4"
},
{
"input": "10\n5 2 3 4 1 6 7 8 10 9",
"output": "8"
},
{
"input": "6\n5 2 3 1 6 4",
"output": "4"
},
{
"input": "10\n2 9 3 4 1 10 5 6 7 8",
"output": "5"
},
{
"input": "10\n2 3 4 5 6 7 1 8 10 9",
"output": "8"
},
{
"input": "8\n2 3 4 5 1 6 8 7",
"output": "6"
},
{
"input": "6\n2 1 3 4 5 6",
"output": "5"
}
] | 1,676,206,737
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 159
| 46
| 0
|
def max_dist(n,a):
minpos = a.index(min(a))
maxpos = a.index(max(a))
if minpos<maxpos:
ldist=minpos
rdist = n-maxpos-1
if ldist>rdist:
dist=maxpos
else:
dist=n-minpos-1
else:
ldist=maxpos
rdist=n-minpos-1
if ldist>rdist:
dist=minpos
else:
dist=n-maxpos-1
return dist
n=int(input())
a=[int(x) for x in input().split()]
result=max_dist(n,a)
print(result)
|
Title: Nicholas and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
Output Specification:
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
Demo Input:
['5\n4 5 1 3 2\n', '7\n1 6 5 3 4 7 2\n', '6\n6 5 4 3 2 1\n']
Demo Output:
['3\n', '6\n', '5\n']
Note:
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
|
```python
def max_dist(n,a):
minpos = a.index(min(a))
maxpos = a.index(max(a))
if minpos<maxpos:
ldist=minpos
rdist = n-maxpos-1
if ldist>rdist:
dist=maxpos
else:
dist=n-minpos-1
else:
ldist=maxpos
rdist=n-minpos-1
if ldist>rdist:
dist=minpos
else:
dist=n-maxpos-1
return dist
n=int(input())
a=[int(x) for x in input().split()]
result=max_dist(n,a)
print(result)
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integer — the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,651,871,410
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 46
| 0
|
#If I read a Q i need to create a sequence AND
# see if I have a sequence with QA, if I have + 1 QAQ
#If I read an A I need to add it to create a new seq QA for each seq Q that exists
listOfQAQ = []
text = input()
totalQAQ = 0
for i in range(len(text)):
if(text[i] == 'Q'):
#See if I have a seq
for seq in listOfQAQ:
if(seq == 'QA'):
totalQAQ = totalQAQ + 1
#Create a new seq
listOfQAQ.append('Q')
elif(text[i] == 'A'):
for i in range(len(listOfQAQ)):
#
if(listOfQAQ[i] == 'Q'):
listOfQAQ.append('QA')
print(totalQAQ)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
#If I read a Q i need to create a sequence AND
# see if I have a sequence with QA, if I have + 1 QAQ
#If I read an A I need to add it to create a new seq QA for each seq Q that exists
listOfQAQ = []
text = input()
totalQAQ = 0
for i in range(len(text)):
if(text[i] == 'Q'):
#See if I have a seq
for seq in listOfQAQ:
if(seq == 'QA'):
totalQAQ = totalQAQ + 1
#Create a new seq
listOfQAQ.append('Q')
elif(text[i] == 'A'):
for i in range(len(listOfQAQ)):
#
if(listOfQAQ[i] == 'Q'):
listOfQAQ.append('QA')
print(totalQAQ)
```
| 3
|
|
478
|
B
|
Random Teams
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null |
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
|
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
|
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
|
[
"5 1\n",
"3 2\n",
"6 3\n"
] |
[
"10 10\n",
"1 1\n",
"3 6\n"
] |
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
| 1,000
|
[
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,686,337,561
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 77
| 716,800
|
# Solution here
def solve(tt):
n, m = __list(int)
mx = nc2(n-m+1)
mn = (n % m) * nc2(n//m + 1) + (m - n % m) * nc2(n//m)
print(mn, mx)
def nc2(x):
return x*(x-1)//2
def main():
t = 1
# t = __int()
for tt in range(1, t + 1):
solve(f"{tt}: -------------")
return
class IntKeyDict(dict):
from random import randrange
rand = randrange(1 << 62)
def __setitem__(self, k, v): super().__setitem__(k ^ self.rand, v)
def __getitem__(self, k): return super().__getitem__(k ^ self.rand)
def __contains__(self, k): return super().__contains__(k ^ self.rand)
def __repr__(self): return str({k: v for k, v in self.items()})
def get(self, k, default=None): return super().get(k ^ self.rand, default)
def keys(self): return [k ^ self.rand for k in super().keys()]
def items(self): return [(k ^ self.rand, v) for k, v in super().items()]
def dbg(*args):
from inspect import currentframe, getframeinfo
from re import search
debug = lambda *args, end="\n": stderr.write(
" ".join([str(x) for x in args]) + end)
frame = currentframe().f_back
s = getframeinfo(frame).code_context[0]
r = search(r"\((.*)\)", s).group(1)
var_name = r.split(", ")
stderr.write("\n")
prefix = f"{currentframe().f_back.f_lineno:02d}) "
stderr.write(prefix)
for var, val in zip(var_name, args):
debug(f"{var} = {val}")
if __name__ == "__main__":
from sys import stdin, stderr, stdout, maxsize
from math import *
from bisect import *
from collections import Counter, deque, defaultdict as dd
from heapq import nsmallest, nlargest, heapify, heappop, heappush
def input(): return stdin.buffer.readline().decode().rstrip()
def __int(): return int(input())
def __list(dtype): return list(map(dtype, input().split()))
print = lambda *args, end="\n", sep=" ": stdout.write(
sep.join(map(str, args)) + end
)
main()
|
Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
|
```python
# Solution here
def solve(tt):
n, m = __list(int)
mx = nc2(n-m+1)
mn = (n % m) * nc2(n//m + 1) + (m - n % m) * nc2(n//m)
print(mn, mx)
def nc2(x):
return x*(x-1)//2
def main():
t = 1
# t = __int()
for tt in range(1, t + 1):
solve(f"{tt}: -------------")
return
class IntKeyDict(dict):
from random import randrange
rand = randrange(1 << 62)
def __setitem__(self, k, v): super().__setitem__(k ^ self.rand, v)
def __getitem__(self, k): return super().__getitem__(k ^ self.rand)
def __contains__(self, k): return super().__contains__(k ^ self.rand)
def __repr__(self): return str({k: v for k, v in self.items()})
def get(self, k, default=None): return super().get(k ^ self.rand, default)
def keys(self): return [k ^ self.rand for k in super().keys()]
def items(self): return [(k ^ self.rand, v) for k, v in super().items()]
def dbg(*args):
from inspect import currentframe, getframeinfo
from re import search
debug = lambda *args, end="\n": stderr.write(
" ".join([str(x) for x in args]) + end)
frame = currentframe().f_back
s = getframeinfo(frame).code_context[0]
r = search(r"\((.*)\)", s).group(1)
var_name = r.split(", ")
stderr.write("\n")
prefix = f"{currentframe().f_back.f_lineno:02d}) "
stderr.write(prefix)
for var, val in zip(var_name, args):
debug(f"{var} = {val}")
if __name__ == "__main__":
from sys import stdin, stderr, stdout, maxsize
from math import *
from bisect import *
from collections import Counter, deque, defaultdict as dd
from heapq import nsmallest, nlargest, heapify, heappop, heappush
def input(): return stdin.buffer.readline().decode().rstrip()
def __int(): return int(input())
def __list(dtype): return list(map(dtype, input().split()))
print = lambda *args, end="\n", sep=" ": stdout.write(
sep.join(map(str, args)) + end
)
main()
```
| 3
|
|
658
|
A
|
Bear and Reverse Radewoosh
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
|
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
|
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
|
[
"3 2\n50 85 250\n10 15 25\n",
"3 6\n50 85 250\n10 15 25\n",
"8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n"
] |
[
"Limak\n",
"Radewoosh\n",
"Tie\n"
] |
In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
| 500
|
[
{
"input": "3 2\n50 85 250\n10 15 25",
"output": "Limak"
},
{
"input": "3 6\n50 85 250\n10 15 25",
"output": "Radewoosh"
},
{
"input": "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76",
"output": "Tie"
},
{
"input": "4 1\n3 5 6 9\n1 2 4 8",
"output": "Limak"
},
{
"input": "4 1\n1 3 6 10\n1 5 7 8",
"output": "Radewoosh"
},
{
"input": "4 1\n2 4 5 10\n2 3 9 10",
"output": "Tie"
},
{
"input": "18 4\n68 97 121 132 146 277 312 395 407 431 458 461 595 634 751 855 871 994\n1 2 3 4 9 10 13 21 22 29 31 34 37 38 39 41 48 49",
"output": "Radewoosh"
},
{
"input": "50 1\n5 14 18 73 137 187 195 197 212 226 235 251 262 278 287 304 310 322 342 379 393 420 442 444 448 472 483 485 508 515 517 523 559 585 618 627 636 646 666 682 703 707 780 853 937 951 959 989 991 992\n30 84 113 173 199 220 235 261 266 277 300 306 310 312 347 356 394 396 397 409 414 424 446 462 468 487 507 517 537 566 594 643 656 660 662 668 706 708 773 774 779 805 820 827 868 896 929 942 961 995",
"output": "Tie"
},
{
"input": "4 1\n4 6 9 10\n2 3 4 5",
"output": "Radewoosh"
},
{
"input": "4 1\n4 6 9 10\n3 4 5 7",
"output": "Radewoosh"
},
{
"input": "4 1\n1 6 7 10\n2 7 8 10",
"output": "Tie"
},
{
"input": "4 1\n4 5 7 9\n1 4 5 8",
"output": "Limak"
},
{
"input": "50 1\n6 17 44 82 94 127 134 156 187 211 212 252 256 292 294 303 352 355 379 380 398 409 424 434 480 524 584 594 631 714 745 756 777 778 789 793 799 821 841 849 859 878 879 895 925 932 944 952 958 990\n15 16 40 42 45 71 99 100 117 120 174 181 186 204 221 268 289 332 376 394 403 409 411 444 471 487 499 539 541 551 567 589 619 623 639 669 689 722 735 776 794 822 830 840 847 907 917 927 936 988",
"output": "Radewoosh"
},
{
"input": "50 10\n25 49 52 73 104 117 127 136 149 164 171 184 226 251 257 258 286 324 337 341 386 390 428 453 464 470 492 517 543 565 609 634 636 660 678 693 710 714 729 736 739 749 781 836 866 875 956 960 977 979\n2 4 7 10 11 22 24 26 27 28 31 35 37 38 42 44 45 46 52 53 55 56 57 59 60 61 64 66 67 68 69 71 75 76 77 78 79 81 83 85 86 87 89 90 92 93 94 98 99 100",
"output": "Limak"
},
{
"input": "50 10\n11 15 25 71 77 83 95 108 143 150 182 183 198 203 213 223 279 280 346 348 350 355 375 376 412 413 415 432 470 545 553 562 589 595 607 633 635 637 688 719 747 767 771 799 842 883 905 924 942 944\n1 3 5 6 7 10 11 12 13 14 15 16 19 20 21 23 25 32 35 36 37 38 40 41 42 43 47 50 51 54 55 56 57 58 59 60 62 63 64 65 66 68 69 70 71 72 73 75 78 80",
"output": "Radewoosh"
},
{
"input": "32 6\n25 77 141 148 157 159 192 196 198 244 245 255 332 392 414 457 466 524 575 603 629 700 738 782 838 841 845 847 870 945 984 985\n1 2 4 5 8 9 10 12 13 14 15 16 17 18 20 21 22 23 24 26 28 31 38 39 40 41 42 43 45 47 48 49",
"output": "Radewoosh"
},
{
"input": "5 1\n256 275 469 671 842\n7 9 14 17 26",
"output": "Limak"
},
{
"input": "2 1000\n1 2\n1 2",
"output": "Tie"
},
{
"input": "3 1\n1 50 809\n2 8 800",
"output": "Limak"
},
{
"input": "1 13\n866\n10",
"output": "Tie"
},
{
"input": "15 1\n9 11 66 128 199 323 376 386 393 555 585 718 935 960 971\n3 11 14 19 20 21 24 26 32 38 40 42 44 47 50",
"output": "Limak"
},
{
"input": "1 10\n546\n45",
"output": "Tie"
},
{
"input": "50 20\n21 43 51 99 117 119 158 167 175 190 196 244 250 316 335 375 391 403 423 428 451 457 460 480 487 522 539 559 566 584 598 602 604 616 626 666 675 730 771 787 828 841 861 867 886 889 898 970 986 991\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
},
{
"input": "50 21\n13 20 22 38 62 84 118 135 141 152 170 175 194 218 227 229 232 253 260 263 278 313 329 357 396 402 422 452 454 533 575 576 580 594 624 644 653 671 676 759 789 811 816 823 831 833 856 924 933 987\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "1 36\n312\n42",
"output": "Tie"
},
{
"input": "1 1000\n1\n1000",
"output": "Tie"
},
{
"input": "1 1\n1000\n1",
"output": "Tie"
},
{
"input": "50 35\n9 17 28 107 136 152 169 174 186 188 201 262 291 312 324 330 341 358 385 386 393 397 425 431 479 498 502 523 530 540 542 554 578 588 622 623 684 696 709 722 784 819 836 845 850 932 945 969 983 984\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "50 20\n12 113 116 120 138 156 167 183 185 194 211 228 234 261 278 287 310 317 346 361 364 397 424 470 496 522 527 536 611 648 668 704 707 712 717 752 761 766 815 828 832 864 872 885 889 901 904 929 982 993\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
}
] | 1,586,449,465
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 109
| 307,200
|
n,c=map(int,input().split())
p=list(map(int,input().split()))
t=list(map(int,input().split()))
points_limak=0
points_rade=0
time=0
for i in range(n):
time+=t[i]
points_limak+=max(0,p[i] - c * time)
time=0
for i in range(n-1,-1,-1):
time+=t[i]
points_rade+=max(0,p[i] - c * time)
if points_limak>points_rade:
print('Limak')
elif points_limak<points_rade:
print('Radewoosh')
else:
print('Tie')
|
Title: Bear and Reverse Radewoosh
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
Output Specification:
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
Demo Input:
['3 2\n50 85 250\n10 15 25\n', '3 6\n50 85 250\n10 15 25\n', '8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n']
Demo Output:
['Limak\n', 'Radewoosh\n', 'Tie\n']
Note:
In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
|
```python
n,c=map(int,input().split())
p=list(map(int,input().split()))
t=list(map(int,input().split()))
points_limak=0
points_rade=0
time=0
for i in range(n):
time+=t[i]
points_limak+=max(0,p[i] - c * time)
time=0
for i in range(n-1,-1,-1):
time+=t[i]
points_rade+=max(0,p[i] - c * time)
if points_limak>points_rade:
print('Limak')
elif points_limak<points_rade:
print('Radewoosh')
else:
print('Tie')
```
| 3
|
|
716
|
A
|
Crazy Computer
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
|
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
|
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
|
[
"6 5\n1 3 8 14 19 20\n",
"6 1\n1 3 5 7 9 10\n"
] |
[
"3",
"2"
] |
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
| 500
|
[
{
"input": "6 5\n1 3 8 14 19 20",
"output": "3"
},
{
"input": "6 1\n1 3 5 7 9 10",
"output": "2"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 7 12 13 14",
"output": "4"
},
{
"input": "2 1000000000\n1 1000000000",
"output": "2"
},
{
"input": "3 5\n1 10 20",
"output": "1"
},
{
"input": "3 10\n1 2 3",
"output": "3"
},
{
"input": "2 1\n1 100",
"output": "1"
},
{
"input": "3 1\n1 2 10",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
}
] | 1,632,073,167
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 155
| 15,155,200
|
temp = input().split(" ")
n = int(temp[0])
c = int(temp[1])
x=0
temp2 = input().split(" ")
sec = []
for i in range(0,n):
sec.append(int(temp2[i]))
for i in range (1,n) :
diff = sec[i] - sec[i-1]
if(diff <= c):
x=x+1
else :
x=0
x=x+1
print(x,"\n")
|
Title: Crazy Computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Output Specification:
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
Demo Input:
['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n']
Demo Output:
['3', '2']
Note:
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
|
```python
temp = input().split(" ")
n = int(temp[0])
c = int(temp[1])
x=0
temp2 = input().split(" ")
sec = []
for i in range(0,n):
sec.append(int(temp2[i]))
for i in range (1,n) :
diff = sec[i] - sec[i-1]
if(diff <= c):
x=x+1
else :
x=0
x=x+1
print(x,"\n")
```
| 3
|
|
363
|
A
|
Soroban
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You know that Japan is the country with almost the largest 'electronic devices per person' ratio. So you might be quite surprised to find out that the primary school in Japan teaches to count using a Soroban — an abacus developed in Japan. This phenomenon has its reasons, of course, but we are not going to speak about them. Let's have a look at the Soroban's construction.
Soroban consists of some number of rods, each rod contains five beads. We will assume that the rods are horizontal lines. One bead on each rod (the leftmost one) is divided from the others by a bar (the reckoning bar). This single bead is called go-dama and four others are ichi-damas. Each rod is responsible for representing a single digit from 0 to 9. We can obtain the value of a digit by following simple algorithm:
- Set the value of a digit equal to 0. - If the go-dama is shifted to the right, add 5. - Add the number of ichi-damas shifted to the left.
Thus, the upper rod on the picture shows digit 0, the middle one shows digit 2 and the lower one shows 7. We will consider the top rod to represent the last decimal digit of a number, so the picture shows number 720.
Write the program that prints the way Soroban shows the given number *n*.
|
The first line contains a single integer *n* (0<=≤<=*n*<=<<=109).
|
Print the description of the decimal digits of number *n* from the last one to the first one (as mentioned on the picture in the statement), one per line. Print the beads as large English letters 'O', rod pieces as character '-' and the reckoning bar as '|'. Print as many rods, as many digits are in the decimal representation of number *n* without leading zeroes. We can assume that number 0 has no leading zeroes.
|
[
"2\n",
"13\n",
"720\n"
] |
[
"O-|OO-OO\n",
"O-|OOO-O\nO-|O-OOO\n",
"O-|-OOOO\nO-|OO-OO\n-O|OO-OO\n"
] |
none
| 500
|
[
{
"input": "2",
"output": "O-|OO-OO"
},
{
"input": "13",
"output": "O-|OOO-O\nO-|O-OOO"
},
{
"input": "720",
"output": "O-|-OOOO\nO-|OO-OO\n-O|OO-OO"
},
{
"input": "0",
"output": "O-|-OOOO"
},
{
"input": "1",
"output": "O-|O-OOO"
},
{
"input": "3",
"output": "O-|OOO-O"
},
{
"input": "4",
"output": "O-|OOOO-"
},
{
"input": "5",
"output": "-O|-OOOO"
},
{
"input": "6",
"output": "-O|O-OOO"
},
{
"input": "637",
"output": "-O|OO-OO\nO-|OOO-O\n-O|O-OOO"
},
{
"input": "7",
"output": "-O|OO-OO"
},
{
"input": "8",
"output": "-O|OOO-O"
},
{
"input": "9",
"output": "-O|OOOO-"
},
{
"input": "10",
"output": "O-|-OOOO\nO-|O-OOO"
},
{
"input": "11",
"output": "O-|O-OOO\nO-|O-OOO"
},
{
"input": "100",
"output": "O-|-OOOO\nO-|-OOOO\nO-|O-OOO"
},
{
"input": "99",
"output": "-O|OOOO-\n-O|OOOO-"
},
{
"input": "245",
"output": "-O|-OOOO\nO-|OOOO-\nO-|OO-OO"
},
{
"input": "118",
"output": "-O|OOO-O\nO-|O-OOO\nO-|O-OOO"
},
{
"input": "429",
"output": "-O|OOOO-\nO-|OO-OO\nO-|OOOO-"
},
{
"input": "555",
"output": "-O|-OOOO\n-O|-OOOO\n-O|-OOOO"
},
{
"input": "660",
"output": "O-|-OOOO\n-O|O-OOO\n-O|O-OOO"
},
{
"input": "331",
"output": "O-|O-OOO\nO-|OOO-O\nO-|OOO-O"
},
{
"input": "987",
"output": "-O|OO-OO\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "123456789",
"output": "-O|OOOO-\n-O|OOO-O\n-O|OO-OO\n-O|O-OOO\n-O|-OOOO\nO-|OOOO-\nO-|OOO-O\nO-|OO-OO\nO-|O-OOO"
},
{
"input": "234567890",
"output": "O-|-OOOO\n-O|OOOO-\n-O|OOO-O\n-O|OO-OO\n-O|O-OOO\n-O|-OOOO\nO-|OOOO-\nO-|OOO-O\nO-|OO-OO"
},
{
"input": "100000000",
"output": "O-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO"
},
{
"input": "111111111",
"output": "O-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO"
},
{
"input": "90909090",
"output": "O-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-"
},
{
"input": "987654321",
"output": "O-|O-OOO\nO-|OO-OO\nO-|OOO-O\nO-|OOOO-\n-O|-OOOO\n-O|O-OOO\n-O|OO-OO\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "45165125",
"output": "-O|-OOOO\nO-|OO-OO\nO-|O-OOO\n-O|-OOOO\n-O|O-OOO\nO-|O-OOO\n-O|-OOOO\nO-|OOOO-"
},
{
"input": "445511006",
"output": "-O|O-OOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO\nO-|O-OOO\n-O|-OOOO\n-O|-OOOO\nO-|OOOO-\nO-|OOOO-"
},
{
"input": "999999999",
"output": "-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-"
},
{
"input": "984218523",
"output": "O-|OOO-O\nO-|OO-OO\n-O|-OOOO\n-O|OOO-O\nO-|O-OOO\nO-|OO-OO\nO-|OOOO-\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "19",
"output": "-O|OOOO-\nO-|O-OOO"
},
{
"input": "10000000",
"output": "O-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO"
}
] | 1,678,370,285
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 46
| 0
|
n = input()
l = ["O-|-OOOO" , "O-|O-OOO" ,"O-|OO-OO" ,"O-|OOO-O","O-|OOOO-", "-O|-OOOO","-O|O-OOO","-O|OO-OO","-O|OOO-O","-O|OOOO-" ]
for i in n[::-1] :
print(l[int(i)])
|
Title: Soroban
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You know that Japan is the country with almost the largest 'electronic devices per person' ratio. So you might be quite surprised to find out that the primary school in Japan teaches to count using a Soroban — an abacus developed in Japan. This phenomenon has its reasons, of course, but we are not going to speak about them. Let's have a look at the Soroban's construction.
Soroban consists of some number of rods, each rod contains five beads. We will assume that the rods are horizontal lines. One bead on each rod (the leftmost one) is divided from the others by a bar (the reckoning bar). This single bead is called go-dama and four others are ichi-damas. Each rod is responsible for representing a single digit from 0 to 9. We can obtain the value of a digit by following simple algorithm:
- Set the value of a digit equal to 0. - If the go-dama is shifted to the right, add 5. - Add the number of ichi-damas shifted to the left.
Thus, the upper rod on the picture shows digit 0, the middle one shows digit 2 and the lower one shows 7. We will consider the top rod to represent the last decimal digit of a number, so the picture shows number 720.
Write the program that prints the way Soroban shows the given number *n*.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=<<=109).
Output Specification:
Print the description of the decimal digits of number *n* from the last one to the first one (as mentioned on the picture in the statement), one per line. Print the beads as large English letters 'O', rod pieces as character '-' and the reckoning bar as '|'. Print as many rods, as many digits are in the decimal representation of number *n* without leading zeroes. We can assume that number 0 has no leading zeroes.
Demo Input:
['2\n', '13\n', '720\n']
Demo Output:
['O-|OO-OO\n', 'O-|OOO-O\nO-|O-OOO\n', 'O-|-OOOO\nO-|OO-OO\n-O|OO-OO\n']
Note:
none
|
```python
n = input()
l = ["O-|-OOOO" , "O-|O-OOO" ,"O-|OO-OO" ,"O-|OOO-O","O-|OOOO-", "-O|-OOOO","-O|O-OOO","-O|OO-OO","-O|OOO-O","-O|OOOO-" ]
for i in n[::-1] :
print(l[int(i)])
```
| 3
|
|
732
|
A
|
Buy a Shovel
|
PROGRAMMING
| 800
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
|
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
|
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
|
[
"117 3\n",
"237 7\n",
"15 2\n"
] |
[
"9\n",
"1\n",
"2\n"
] |
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
| 500
|
[
{
"input": "117 3",
"output": "9"
},
{
"input": "237 7",
"output": "1"
},
{
"input": "15 2",
"output": "2"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1000 3",
"output": "1"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 9",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "999 9",
"output": "1"
},
{
"input": "999 8",
"output": "2"
},
{
"input": "105 6",
"output": "2"
},
{
"input": "403 9",
"output": "3"
},
{
"input": "546 4",
"output": "4"
},
{
"input": "228 9",
"output": "5"
},
{
"input": "57 2",
"output": "6"
},
{
"input": "437 9",
"output": "7"
},
{
"input": "997 6",
"output": "8"
},
{
"input": "109 1",
"output": "9"
},
{
"input": "998 9",
"output": "5"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "9 3",
"output": "7"
},
{
"input": "8 2",
"output": "4"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "7"
},
{
"input": "1 8",
"output": "8"
},
{
"input": "100 3",
"output": "1"
},
{
"input": "1000 2",
"output": "1"
},
{
"input": "1000 4",
"output": "1"
},
{
"input": "1000 5",
"output": "1"
},
{
"input": "1000 6",
"output": "1"
},
{
"input": "1000 7",
"output": "1"
},
{
"input": "1000 8",
"output": "1"
},
{
"input": "23 4",
"output": "8"
},
{
"input": "33 1",
"output": "7"
},
{
"input": "33 2",
"output": "4"
},
{
"input": "666 5",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "12 4",
"output": "2"
},
{
"input": "15 5",
"output": "1"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "25 5",
"output": "1"
},
{
"input": "2 9",
"output": "5"
},
{
"input": "6 7",
"output": "5"
},
{
"input": "8 9",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "4 7",
"output": "5"
},
{
"input": "2 1",
"output": "5"
},
{
"input": "261 1",
"output": "1"
}
] | 1,692,940,198
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 62
| 0
|
k, r = map(int, input().split())
for ans in range(1, 11):
if (k * ans - r) % 10 == 0 or (k * ans) % 10 == 0:
print(ans)
break
|
Title: Buy a Shovel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
Input Specification:
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Output Specification:
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
Demo Input:
['117 3\n', '237 7\n', '15 2\n']
Demo Output:
['9\n', '1\n', '2\n']
Note:
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
|
```python
k, r = map(int, input().split())
for ans in range(1, 11):
if (k * ans - r) % 10 == 0 or (k * ans) % 10 == 0:
print(ans)
break
```
| 3
|
|
633
|
B
|
A Trivial Problem
|
PROGRAMMING
| 1,300
|
[
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null |
Mr. Santa asks all the great programmers of the world to solve a trivial problem. He gives them an integer *m* and asks for the number of positive integers *n*, such that the factorial of *n* ends with exactly *m* zeroes. Are you among those great programmers who can solve this problem?
|
The only line of input contains an integer *m* (1<=≤<=*m*<=≤<=100<=000) — the required number of trailing zeroes in factorial.
|
First print *k* — the number of values of *n* such that the factorial of *n* ends with *m* zeroes. Then print these *k* integers in increasing order.
|
[
"1\n",
"5\n"
] |
[
"5\n5 6 7 8 9 ",
"0"
] |
The factorial of *n* is equal to the product of all integers from 1 to *n* inclusive, that is *n*! = 1·2·3·...·*n*.
In the first sample, 5! = 120, 6! = 720, 7! = 5040, 8! = 40320 and 9! = 362880.
| 500
|
[
{
"input": "1",
"output": "5\n5 6 7 8 9 "
},
{
"input": "5",
"output": "0"
},
{
"input": "2",
"output": "5\n10 11 12 13 14 "
},
{
"input": "3",
"output": "5\n15 16 17 18 19 "
},
{
"input": "7",
"output": "5\n30 31 32 33 34 "
},
{
"input": "12",
"output": "5\n50 51 52 53 54 "
},
{
"input": "15",
"output": "5\n65 66 67 68 69 "
},
{
"input": "18",
"output": "5\n75 76 77 78 79 "
},
{
"input": "38",
"output": "5\n155 156 157 158 159 "
},
{
"input": "47",
"output": "5\n195 196 197 198 199 "
},
{
"input": "58",
"output": "5\n240 241 242 243 244 "
},
{
"input": "66",
"output": "5\n270 271 272 273 274 "
},
{
"input": "70",
"output": "5\n285 286 287 288 289 "
},
{
"input": "89",
"output": "5\n365 366 367 368 369 "
},
{
"input": "417",
"output": "5\n1675 1676 1677 1678 1679 "
},
{
"input": "815",
"output": "5\n3265 3266 3267 3268 3269 "
},
{
"input": "394",
"output": "5\n1585 1586 1587 1588 1589 "
},
{
"input": "798",
"output": "0"
},
{
"input": "507",
"output": "5\n2035 2036 2037 2038 2039 "
},
{
"input": "406",
"output": "5\n1630 1631 1632 1633 1634 "
},
{
"input": "570",
"output": "5\n2290 2291 2292 2293 2294 "
},
{
"input": "185",
"output": "0"
},
{
"input": "765",
"output": "0"
},
{
"input": "967",
"output": "0"
},
{
"input": "112",
"output": "5\n455 456 457 458 459 "
},
{
"input": "729",
"output": "5\n2925 2926 2927 2928 2929 "
},
{
"input": "4604",
"output": "5\n18425 18426 18427 18428 18429 "
},
{
"input": "8783",
"output": "5\n35140 35141 35142 35143 35144 "
},
{
"input": "1059",
"output": "0"
},
{
"input": "6641",
"output": "5\n26575 26576 26577 26578 26579 "
},
{
"input": "9353",
"output": "5\n37425 37426 37427 37428 37429 "
},
{
"input": "1811",
"output": "5\n7250 7251 7252 7253 7254 "
},
{
"input": "2528",
"output": "0"
},
{
"input": "8158",
"output": "5\n32640 32641 32642 32643 32644 "
},
{
"input": "3014",
"output": "5\n12070 12071 12072 12073 12074 "
},
{
"input": "7657",
"output": "5\n30640 30641 30642 30643 30644 "
},
{
"input": "4934",
"output": "0"
},
{
"input": "9282",
"output": "5\n37140 37141 37142 37143 37144 "
},
{
"input": "2610",
"output": "5\n10450 10451 10452 10453 10454 "
},
{
"input": "2083",
"output": "5\n8345 8346 8347 8348 8349 "
},
{
"input": "26151",
"output": "5\n104620 104621 104622 104623 104624 "
},
{
"input": "64656",
"output": "5\n258640 258641 258642 258643 258644 "
},
{
"input": "46668",
"output": "5\n186690 186691 186692 186693 186694 "
},
{
"input": "95554",
"output": "5\n382235 382236 382237 382238 382239 "
},
{
"input": "37320",
"output": "0"
},
{
"input": "52032",
"output": "5\n208140 208141 208142 208143 208144 "
},
{
"input": "11024",
"output": "5\n44110 44111 44112 44113 44114 "
},
{
"input": "63218",
"output": "5\n252885 252886 252887 252888 252889 "
},
{
"input": "40095",
"output": "5\n160390 160391 160392 160393 160394 "
},
{
"input": "42724",
"output": "5\n170910 170911 170912 170913 170914 "
},
{
"input": "24381",
"output": "5\n97530 97531 97532 97533 97534 "
},
{
"input": "73138",
"output": "5\n292570 292571 292572 292573 292574 "
},
{
"input": "93346",
"output": "5\n373400 373401 373402 373403 373404 "
},
{
"input": "18338",
"output": "5\n73370 73371 73372 73373 73374 "
},
{
"input": "42662",
"output": "5\n170660 170661 170662 170663 170664 "
},
{
"input": "81221",
"output": "5\n324900 324901 324902 324903 324904 "
},
{
"input": "100000",
"output": "5\n400005 400006 400007 400008 400009 "
},
{
"input": "100000",
"output": "5\n400005 400006 400007 400008 400009 "
},
{
"input": "99998",
"output": "0"
},
{
"input": "30",
"output": "0"
},
{
"input": "11",
"output": "0"
},
{
"input": "780",
"output": "0"
},
{
"input": "97656",
"output": "5\n390625 390626 390627 390628 390629 "
},
{
"input": "12499",
"output": "5\n50000 50001 50002 50003 50004 "
},
{
"input": "65",
"output": "5\n265 266 267 268 269 "
},
{
"input": "41",
"output": "5\n170 171 172 173 174 "
},
{
"input": "31",
"output": "5\n125 126 127 128 129 "
},
{
"input": "86577",
"output": "0"
}
] | 1,619,953,459
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 68
| 171
| 6,553,600
|
#n,m,k = map(int, input().strip().split(' '))
m=int(input())
#a = list(map(int, input().strip().split(' ')))
l=[1]
i=1
l1=[i]
l2=0
#building the array
while(i<100000):
i+=1
l2=5*i
c=0
while(l2%5==0):
l2=l2//5
c+=1
l.append(l[-1]+c)
l1.append(i)
#print(l)
if m not in l:
print(0)
else:
print(5)
ind=l.index(m)
i1=5*l1[ind]
print(i1,i1+1,i1+2,i1+3,i1+4,end=" ")
|
Title: A Trivial Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Santa asks all the great programmers of the world to solve a trivial problem. He gives them an integer *m* and asks for the number of positive integers *n*, such that the factorial of *n* ends with exactly *m* zeroes. Are you among those great programmers who can solve this problem?
Input Specification:
The only line of input contains an integer *m* (1<=≤<=*m*<=≤<=100<=000) — the required number of trailing zeroes in factorial.
Output Specification:
First print *k* — the number of values of *n* such that the factorial of *n* ends with *m* zeroes. Then print these *k* integers in increasing order.
Demo Input:
['1\n', '5\n']
Demo Output:
['5\n5 6 7 8 9 ', '0']
Note:
The factorial of *n* is equal to the product of all integers from 1 to *n* inclusive, that is *n*! = 1·2·3·...·*n*.
In the first sample, 5! = 120, 6! = 720, 7! = 5040, 8! = 40320 and 9! = 362880.
|
```python
#n,m,k = map(int, input().strip().split(' '))
m=int(input())
#a = list(map(int, input().strip().split(' ')))
l=[1]
i=1
l1=[i]
l2=0
#building the array
while(i<100000):
i+=1
l2=5*i
c=0
while(l2%5==0):
l2=l2//5
c+=1
l.append(l[-1]+c)
l1.append(i)
#print(l)
if m not in l:
print(0)
else:
print(5)
ind=l.index(m)
i1=5*l1[ind]
print(i1,i1+1,i1+2,i1+3,i1+4,end=" ")
```
| 3
|
|
486
|
A
|
Calculating Function
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
For a positive integer *n* let's define a function *f*:
*f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n*
Your task is to calculate *f*(*n*) for a given integer *n*.
|
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
|
Print *f*(*n*) in a single line.
|
[
"4\n",
"5\n"
] |
[
"2\n",
"-3\n"
] |
*f*(4) = - 1 + 2 - 3 + 4 = 2
*f*(5) = - 1 + 2 - 3 + 4 - 5 = - 3
| 500
|
[
{
"input": "4",
"output": "2"
},
{
"input": "5",
"output": "-3"
},
{
"input": "1000000000",
"output": "500000000"
},
{
"input": "1000000001",
"output": "-500000001"
},
{
"input": "1000000000000000",
"output": "500000000000000"
},
{
"input": "100",
"output": "50"
},
{
"input": "101",
"output": "-51"
},
{
"input": "102",
"output": "51"
},
{
"input": "103",
"output": "-52"
},
{
"input": "104",
"output": "52"
},
{
"input": "105",
"output": "-53"
},
{
"input": "106",
"output": "53"
},
{
"input": "107",
"output": "-54"
},
{
"input": "108",
"output": "54"
},
{
"input": "109",
"output": "-55"
},
{
"input": "208170109961052",
"output": "104085054980526"
},
{
"input": "46017661651072",
"output": "23008830825536"
},
{
"input": "4018154546667",
"output": "-2009077273334"
},
{
"input": "288565475053",
"output": "-144282737527"
},
{
"input": "3052460231",
"output": "-1526230116"
},
{
"input": "29906716",
"output": "14953358"
},
{
"input": "87897701693326",
"output": "43948850846663"
},
{
"input": "8240",
"output": "4120"
},
{
"input": "577935",
"output": "-288968"
},
{
"input": "62",
"output": "31"
},
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "1"
},
{
"input": "9999999999999",
"output": "-5000000000000"
},
{
"input": "1000000000000",
"output": "500000000000"
},
{
"input": "99999999999999",
"output": "-50000000000000"
},
{
"input": "999999999999999",
"output": "-500000000000000"
},
{
"input": "42191359342",
"output": "21095679671"
},
{
"input": "100000000000000",
"output": "50000000000000"
},
{
"input": "145645214654154",
"output": "72822607327077"
},
{
"input": "4294967296",
"output": "2147483648"
},
{
"input": "3037000499",
"output": "-1518500250"
},
{
"input": "10000000000001",
"output": "-5000000000001"
},
{
"input": "100000017040846",
"output": "50000008520423"
},
{
"input": "98979894985999",
"output": "-49489947493000"
}
] | 1,696,102,605
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 46
| 0
|
n = int(input())
if n%2 != 0:
val = -(n + 1) / 2
else:
val = n/2
print(int(val))
|
Title: Calculating Function
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a positive integer *n* let's define a function *f*:
*f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n*
Your task is to calculate *f*(*n*) for a given integer *n*.
Input Specification:
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
Output Specification:
Print *f*(*n*) in a single line.
Demo Input:
['4\n', '5\n']
Demo Output:
['2\n', '-3\n']
Note:
*f*(4) = - 1 + 2 - 3 + 4 = 2
*f*(5) = - 1 + 2 - 3 + 4 - 5 = - 3
|
```python
n = int(input())
if n%2 != 0:
val = -(n + 1) / 2
else:
val = n/2
print(int(val))
```
| 3
|
|
676
|
A
|
Nicholas and Permutation
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
|
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
|
[
"5\n4 5 1 3 2\n",
"7\n1 6 5 3 4 7 2\n",
"6\n6 5 4 3 2 1\n"
] |
[
"3\n",
"6\n",
"5\n"
] |
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
| 500
|
[
{
"input": "5\n4 5 1 3 2",
"output": "3"
},
{
"input": "7\n1 6 5 3 4 7 2",
"output": "6"
},
{
"input": "6\n6 5 4 3 2 1",
"output": "5"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "5\n1 4 5 2 3",
"output": "4"
},
{
"input": "6\n4 6 3 5 2 1",
"output": "5"
},
{
"input": "7\n1 5 3 6 2 4 7",
"output": "6"
},
{
"input": "100\n76 70 67 54 40 1 48 63 64 36 42 90 99 27 47 17 93 7 13 84 16 57 74 5 83 61 19 56 52 92 38 91 82 79 34 66 71 28 37 98 35 94 77 53 73 10 26 80 15 32 8 81 3 95 44 46 72 6 33 11 21 85 4 30 24 51 49 96 87 55 14 31 12 60 45 9 29 22 58 18 88 2 50 59 20 86 23 41 100 39 62 68 69 97 78 43 25 89 65 75",
"output": "94"
},
{
"input": "8\n4 5 3 8 6 7 1 2",
"output": "6"
},
{
"input": "9\n6 8 5 3 4 7 9 2 1",
"output": "8"
},
{
"input": "10\n8 7 10 1 2 3 4 6 5 9",
"output": "7"
},
{
"input": "11\n5 4 6 9 10 11 7 3 1 2 8",
"output": "8"
},
{
"input": "12\n3 6 7 8 9 10 12 5 4 2 11 1",
"output": "11"
},
{
"input": "13\n8 4 3 7 5 11 9 1 10 2 13 12 6",
"output": "10"
},
{
"input": "14\n6 10 13 9 7 1 12 14 3 2 5 4 11 8",
"output": "8"
},
{
"input": "15\n3 14 13 12 7 2 4 11 15 1 8 6 5 10 9",
"output": "9"
},
{
"input": "16\n11 6 9 8 7 14 12 13 10 15 2 5 3 1 4 16",
"output": "15"
},
{
"input": "17\n13 12 5 3 9 16 8 14 2 4 10 1 6 11 7 15 17",
"output": "16"
},
{
"input": "18\n8 6 14 17 9 11 15 13 5 3 18 1 2 7 12 16 4 10",
"output": "11"
},
{
"input": "19\n12 19 3 11 15 6 18 14 5 10 2 13 9 7 4 8 17 16 1",
"output": "18"
},
{
"input": "20\n15 17 10 20 7 2 16 9 13 6 18 5 19 8 11 14 4 12 3 1",
"output": "19"
},
{
"input": "21\n1 9 14 18 13 12 11 20 16 2 4 19 15 7 6 17 8 5 3 10 21",
"output": "20"
},
{
"input": "22\n8 3 17 4 16 21 14 11 10 15 6 18 13 12 22 20 5 2 9 7 19 1",
"output": "21"
},
{
"input": "23\n1 23 11 20 9 3 12 4 7 17 5 15 2 10 18 16 8 22 14 13 19 21 6",
"output": "22"
},
{
"input": "24\n2 10 23 22 20 19 18 16 11 12 15 17 21 8 24 13 1 5 6 7 14 3 9 4",
"output": "16"
},
{
"input": "25\n12 13 22 17 1 18 14 5 21 2 10 4 3 23 11 6 20 8 24 16 15 19 9 7 25",
"output": "24"
},
{
"input": "26\n6 21 20 16 26 17 11 2 24 4 1 12 14 8 25 7 15 10 22 5 13 18 9 23 19 3",
"output": "21"
},
{
"input": "27\n20 14 18 10 5 3 9 4 24 22 21 27 17 15 26 2 23 7 12 11 6 8 19 25 16 13 1",
"output": "26"
},
{
"input": "28\n28 13 16 6 1 12 4 27 22 7 18 3 21 26 25 11 5 10 20 24 19 15 14 8 23 17 9 2",
"output": "27"
},
{
"input": "29\n21 11 10 25 2 5 9 16 29 8 17 4 15 13 6 22 7 24 19 12 18 20 1 3 23 28 27 14 26",
"output": "22"
},
{
"input": "30\n6 19 14 22 26 17 27 8 25 3 24 30 4 18 23 16 9 13 29 20 15 2 5 11 28 12 1 10 21 7",
"output": "26"
},
{
"input": "31\n29 13 26 27 9 28 2 16 30 21 12 11 3 31 23 6 22 20 1 5 14 24 19 18 8 4 10 17 15 25 7",
"output": "18"
},
{
"input": "32\n15 32 11 3 18 23 19 14 5 8 6 21 13 24 25 4 16 9 27 20 17 31 2 22 7 12 30 1 26 10 29 28",
"output": "30"
},
{
"input": "33\n22 13 10 33 8 25 15 14 21 28 27 19 26 24 1 12 5 11 32 20 30 31 18 4 6 23 7 29 16 2 17 9 3",
"output": "29"
},
{
"input": "34\n34 30 7 16 6 1 10 23 29 13 15 25 32 26 18 11 28 3 14 21 19 5 31 33 4 17 8 9 24 20 27 22 2 12",
"output": "33"
},
{
"input": "35\n24 33 20 8 34 11 31 25 2 4 18 13 9 35 16 30 23 32 17 1 14 22 19 21 28 26 3 15 5 12 27 29 10 6 7",
"output": "21"
},
{
"input": "36\n1 32 27 35 22 7 34 15 18 36 31 28 13 2 10 21 20 17 16 4 3 24 19 29 11 12 25 5 33 26 14 6 9 23 30 8",
"output": "35"
},
{
"input": "37\n24 1 12 23 11 6 30 15 4 21 13 20 25 17 5 8 36 19 32 26 14 9 7 18 10 29 37 35 16 2 22 34 3 27 31 33 28",
"output": "35"
},
{
"input": "38\n9 35 37 28 36 21 10 25 19 4 26 5 22 7 27 18 6 14 15 24 1 17 11 34 20 8 2 16 3 23 32 31 13 12 38 33 30 29",
"output": "34"
},
{
"input": "39\n16 28 4 33 26 36 25 23 22 30 27 7 12 34 17 6 3 38 10 24 13 31 29 39 14 32 9 20 35 11 18 21 8 2 15 37 5 19 1",
"output": "38"
},
{
"input": "40\n35 39 28 11 9 31 36 8 5 32 26 19 38 33 2 22 23 25 6 37 12 7 3 10 17 24 20 16 27 4 34 15 40 14 18 13 29 21 30 1",
"output": "39"
},
{
"input": "41\n24 18 7 23 3 15 1 17 25 5 30 10 34 36 2 14 9 21 41 40 20 28 33 35 12 22 11 8 19 16 31 27 26 32 29 4 13 38 37 39 6",
"output": "34"
},
{
"input": "42\n42 15 24 26 4 34 19 29 38 32 31 33 14 41 21 3 11 39 25 6 5 20 23 10 16 36 18 28 27 1 7 40 22 30 9 2 37 17 8 12 13 35",
"output": "41"
},
{
"input": "43\n43 24 20 13 22 29 28 4 30 3 32 40 31 8 7 9 35 27 18 5 42 6 17 19 23 12 41 21 16 37 33 34 2 14 36 38 25 10 15 39 26 11 1",
"output": "42"
},
{
"input": "44\n4 38 6 40 29 3 44 2 30 35 25 36 34 10 11 31 21 7 14 23 37 19 27 18 5 22 1 16 17 9 39 13 15 32 43 8 41 26 42 12 24 33 20 28",
"output": "37"
},
{
"input": "45\n45 29 24 2 31 5 34 41 26 44 33 43 15 3 4 11 21 37 27 12 14 39 23 42 16 6 13 19 8 38 20 9 25 22 40 17 32 35 18 10 28 7 30 36 1",
"output": "44"
},
{
"input": "46\n29 3 12 33 45 40 19 17 25 27 28 1 16 23 24 46 31 8 44 15 5 32 22 11 4 36 34 10 35 26 21 7 14 2 18 9 20 41 6 43 42 37 38 13 39 30",
"output": "34"
},
{
"input": "47\n7 3 8 12 24 16 29 10 28 38 1 20 37 40 21 5 15 6 45 23 36 44 25 43 41 4 11 42 18 35 32 31 39 33 27 30 22 34 14 13 17 47 19 9 46 26 2",
"output": "41"
},
{
"input": "48\n29 26 14 18 34 33 13 39 32 1 37 20 35 19 28 48 30 23 46 27 5 22 24 38 12 15 8 36 43 45 16 47 6 9 31 40 44 17 2 41 11 42 25 4 21 3 10 7",
"output": "38"
},
{
"input": "49\n16 7 42 32 11 35 15 8 23 41 6 20 47 24 9 45 49 2 37 48 25 28 5 18 3 19 12 4 22 33 13 14 10 36 44 17 40 38 30 26 1 43 29 46 21 34 27 39 31",
"output": "40"
},
{
"input": "50\n31 45 3 34 13 43 32 4 42 9 7 8 24 14 35 6 19 46 44 17 18 1 25 20 27 41 2 16 12 10 11 47 38 21 28 49 30 15 50 36 29 26 22 39 48 5 23 37 33 40",
"output": "38"
},
{
"input": "51\n47 29 2 11 43 44 27 1 39 14 25 30 33 21 38 45 34 51 16 50 42 31 41 46 15 48 13 19 6 37 35 7 22 28 20 4 17 10 5 8 24 40 9 36 18 49 12 26 23 3 32",
"output": "43"
},
{
"input": "52\n16 45 23 7 15 19 43 20 4 32 35 36 9 50 5 26 38 46 13 33 12 2 48 37 41 31 10 28 8 42 3 21 11 1 17 27 34 30 44 40 6 51 49 47 25 22 18 24 52 29 14 39",
"output": "48"
},
{
"input": "53\n53 30 50 22 51 31 32 38 12 7 39 43 1 23 6 8 24 52 2 21 34 13 3 35 5 15 19 11 47 18 9 20 29 4 36 45 27 41 25 48 16 46 44 17 10 14 42 26 40 28 33 37 49",
"output": "52"
},
{
"input": "54\n6 39 17 3 45 52 16 21 23 48 42 36 13 37 46 10 43 27 49 7 38 32 31 30 15 25 2 29 8 51 54 19 41 44 24 34 22 5 20 14 12 1 33 40 4 26 9 35 18 28 47 50 11 53",
"output": "41"
},
{
"input": "55\n26 15 31 21 32 43 34 51 7 12 5 44 17 54 18 25 48 47 20 3 41 24 45 2 11 22 29 39 37 53 35 28 36 9 50 10 30 38 19 13 4 8 27 1 42 6 49 23 55 40 33 16 46 14 52",
"output": "48"
},
{
"input": "56\n6 20 38 46 10 11 40 19 5 1 47 33 4 18 32 36 37 45 56 49 48 52 12 26 31 14 2 9 24 3 16 51 41 43 23 17 34 7 29 50 55 25 39 44 22 27 54 8 28 35 30 42 13 53 21 15",
"output": "46"
},
{
"input": "57\n39 28 53 36 3 6 12 56 55 20 50 19 43 42 18 40 24 52 38 17 33 23 22 41 14 7 26 44 45 16 35 1 8 47 31 5 30 51 32 4 37 25 13 34 54 21 46 10 15 11 2 27 29 48 49 9 57",
"output": "56"
},
{
"input": "58\n1 26 28 14 22 33 57 40 9 42 44 37 24 19 58 12 48 3 34 31 49 4 16 47 55 52 27 23 46 18 20 32 56 6 39 36 41 38 13 43 45 21 53 54 29 17 5 10 25 30 2 35 11 7 15 51 8 50",
"output": "57"
},
{
"input": "59\n1 27 10 37 53 9 14 49 46 26 50 42 59 11 47 15 24 56 43 45 44 38 5 8 58 30 52 12 23 32 22 3 31 41 2 25 29 6 54 16 35 33 18 55 4 51 57 28 40 19 13 21 7 39 36 48 34 17 20",
"output": "58"
},
{
"input": "60\n60 27 34 32 54 55 33 12 40 3 47 44 50 39 38 59 11 25 17 15 16 30 21 31 10 52 5 23 4 48 6 26 36 57 14 22 8 56 58 9 24 7 37 53 42 43 20 49 51 19 2 46 28 18 35 13 29 45 41 1",
"output": "59"
},
{
"input": "61\n61 11 26 29 31 40 32 30 35 3 18 52 9 53 42 4 50 54 20 58 28 49 22 12 2 19 16 15 57 34 51 43 7 17 25 41 56 47 55 60 46 14 44 45 24 27 33 1 48 13 59 23 38 39 6 5 36 10 8 37 21",
"output": "60"
},
{
"input": "62\n21 23 34 38 11 61 55 30 37 48 54 51 46 47 6 56 36 49 1 35 12 28 29 20 43 42 5 8 22 57 44 4 53 10 58 33 27 25 16 45 50 40 18 15 3 41 39 2 7 60 59 13 32 24 52 31 14 9 19 26 17 62",
"output": "61"
},
{
"input": "63\n2 5 29 48 31 26 21 16 47 24 43 22 61 28 6 39 60 27 14 52 37 7 53 8 62 56 63 10 50 18 44 13 4 9 25 11 23 42 45 41 59 12 32 36 40 51 1 35 49 54 57 20 19 34 38 46 33 3 55 15 30 58 17",
"output": "46"
},
{
"input": "64\n23 5 51 40 12 46 44 8 64 31 58 55 45 24 54 39 21 19 52 61 30 42 16 18 15 32 53 22 28 26 11 25 48 56 27 9 29 41 35 49 59 38 62 7 34 1 20 33 60 17 2 3 43 37 57 14 6 36 13 10 50 4 63 47",
"output": "55"
},
{
"input": "65\n10 11 55 43 53 25 35 26 16 37 41 38 59 21 48 2 65 49 17 23 18 30 62 36 3 4 47 15 28 63 57 54 31 46 44 12 51 7 29 13 56 52 14 22 39 19 8 27 45 5 6 34 32 61 20 50 9 24 33 58 60 40 1 42 64",
"output": "62"
},
{
"input": "66\n66 39 3 2 55 53 60 54 12 49 10 30 59 26 32 46 50 56 7 13 43 36 24 28 11 8 6 21 35 25 42 57 23 45 64 5 34 61 27 51 52 9 15 1 38 17 63 48 37 20 58 14 47 19 22 41 31 44 33 65 4 62 40 18 16 29",
"output": "65"
},
{
"input": "67\n66 16 2 53 35 38 49 28 18 6 36 58 21 47 27 5 50 62 44 12 52 37 11 56 15 31 25 65 17 29 59 41 7 42 4 43 39 10 1 40 24 13 20 54 19 67 46 60 51 45 64 30 8 33 26 9 3 22 34 23 57 48 55 14 63 61 32",
"output": "45"
},
{
"input": "68\n13 6 27 21 65 23 59 14 62 43 33 31 38 41 67 20 16 25 42 4 28 40 29 9 64 17 2 26 32 58 60 53 46 48 47 54 44 50 39 19 30 57 61 1 11 18 37 24 55 15 63 34 8 52 56 7 10 12 35 66 5 36 45 49 68 22 51 3",
"output": "64"
},
{
"input": "69\n29 49 25 51 21 35 11 61 39 54 40 37 60 42 27 33 59 53 34 10 46 2 23 69 8 47 58 36 1 38 19 12 7 48 13 3 6 22 18 5 65 24 50 41 66 44 67 57 4 56 62 43 9 30 14 15 28 31 64 26 16 55 68 17 32 20 45 52 63",
"output": "45"
},
{
"input": "70\n19 12 15 18 36 16 61 69 24 7 11 13 3 48 55 21 37 17 43 31 41 22 28 32 27 63 38 49 59 56 30 25 67 51 52 45 50 44 66 57 26 60 5 46 33 6 23 34 8 40 2 68 14 39 65 64 62 42 47 54 10 53 9 1 70 58 20 4 29 35",
"output": "64"
},
{
"input": "71\n40 6 62 3 41 52 31 66 27 16 35 5 17 60 2 15 51 22 67 61 71 53 1 64 8 45 28 18 50 30 12 69 20 26 10 37 36 49 70 32 33 11 57 14 9 55 4 58 29 25 44 65 39 48 24 47 19 46 56 38 34 42 59 63 54 23 7 68 43 13 21",
"output": "50"
},
{
"input": "72\n52 64 71 40 32 10 62 21 11 37 38 13 22 70 1 66 41 50 27 20 42 47 25 68 49 12 15 72 44 60 53 5 23 14 43 29 65 36 51 54 35 67 7 19 55 48 58 46 39 24 33 30 61 45 57 2 31 3 18 59 6 9 4 63 8 16 26 34 28 69 17 56",
"output": "57"
},
{
"input": "73\n58 38 47 34 39 64 69 66 72 57 9 4 67 22 35 13 61 14 28 52 56 20 31 70 27 24 36 1 62 17 10 5 12 33 16 73 18 49 63 71 44 65 23 30 40 8 50 46 60 25 11 26 37 55 29 68 42 2 3 32 59 7 15 43 41 48 51 53 6 45 54 19 21",
"output": "45"
},
{
"input": "74\n19 51 59 34 8 40 42 55 65 16 74 26 49 63 64 70 35 72 7 12 43 18 61 27 47 31 13 32 71 22 25 67 9 1 48 50 33 10 21 46 11 45 17 37 28 60 69 66 38 2 30 3 39 15 53 68 57 41 6 36 24 73 4 23 5 62 44 14 20 29 52 54 56 58",
"output": "63"
},
{
"input": "75\n75 28 60 19 59 17 65 26 32 23 18 64 8 62 4 11 42 16 47 5 72 46 9 1 25 21 2 50 33 6 36 68 30 12 20 40 53 45 34 7 37 39 38 44 63 61 67 3 66 51 29 73 24 57 70 27 10 56 22 55 13 49 35 15 54 41 14 74 69 48 52 31 71 43 58",
"output": "74"
},
{
"input": "76\n1 47 54 17 38 37 12 32 14 48 43 71 60 56 4 13 64 41 52 57 62 24 23 49 20 10 63 3 25 66 59 40 58 33 53 46 70 7 35 61 72 74 73 19 30 5 29 6 15 28 21 27 51 55 50 9 65 8 67 39 76 42 31 34 16 2 36 11 26 44 22 45 75 18 69 68",
"output": "75"
},
{
"input": "77\n10 20 57 65 53 69 59 45 58 32 28 72 4 14 1 33 40 47 7 5 51 76 37 16 41 61 42 2 21 26 38 74 35 64 43 77 71 50 39 48 27 63 73 44 52 66 9 18 23 54 25 6 8 56 13 67 36 22 15 46 62 75 55 11 31 17 24 29 60 68 12 30 3 70 49 19 34",
"output": "62"
},
{
"input": "78\n7 61 69 47 68 42 65 78 70 3 32 59 49 51 23 71 11 63 22 18 43 34 24 13 27 16 19 40 21 46 48 77 28 66 54 67 60 15 75 62 9 26 52 58 4 25 8 37 41 76 1 6 30 50 44 36 5 14 29 53 17 12 2 57 73 35 64 39 56 10 33 20 45 74 31 55 38 72",
"output": "70"
},
{
"input": "79\n75 79 43 66 72 52 29 65 74 38 24 1 5 51 13 7 71 33 4 61 2 36 63 47 64 44 34 27 3 21 17 37 54 53 49 20 28 60 39 10 16 76 6 77 73 22 50 48 78 30 67 56 31 26 40 59 41 11 18 45 69 62 15 23 32 70 19 55 68 57 35 25 12 46 14 42 9 8 58",
"output": "77"
},
{
"input": "80\n51 20 37 12 68 11 28 52 76 21 7 5 3 16 64 34 25 2 6 40 60 62 75 13 45 17 56 29 32 47 79 73 49 72 15 46 30 54 80 27 43 24 74 18 42 71 14 4 44 63 65 33 1 77 55 57 41 59 58 70 69 35 19 67 10 36 26 23 48 50 39 61 9 66 38 8 31 22 53 78",
"output": "52"
},
{
"input": "81\n63 22 4 41 43 74 64 39 10 35 20 81 11 28 70 67 53 79 16 61 68 52 27 37 58 9 50 49 18 30 72 47 7 60 78 51 23 48 73 66 44 13 15 57 56 38 1 76 25 45 36 34 42 8 75 26 59 14 71 21 6 77 5 17 2 32 40 54 46 24 29 3 31 19 65 62 33 69 12 80 55",
"output": "69"
},
{
"input": "82\n50 24 17 41 49 18 80 11 79 72 57 31 21 35 2 51 36 66 20 65 38 3 45 32 59 81 28 30 70 55 29 76 73 6 33 39 8 7 19 48 63 1 77 43 4 13 78 54 69 9 40 46 74 82 60 71 16 64 12 14 47 26 44 5 10 75 53 25 27 15 56 42 58 34 23 61 67 62 68 22 37 52",
"output": "53"
},
{
"input": "83\n64 8 58 17 67 46 3 82 23 70 72 16 53 45 13 20 12 48 40 4 6 47 76 60 19 44 30 78 28 22 75 15 25 29 63 74 55 32 14 51 35 31 62 77 27 42 65 71 56 61 66 41 68 49 7 34 2 83 36 5 33 26 37 80 59 50 1 9 54 21 18 24 38 73 81 52 10 39 43 79 57 11 69",
"output": "66"
},
{
"input": "84\n75 8 66 21 61 63 72 51 52 13 59 25 28 58 64 53 79 41 34 7 67 11 39 56 44 24 50 9 49 55 1 80 26 6 73 74 27 69 65 37 18 43 36 17 30 3 47 29 76 78 32 22 12 68 46 5 42 81 57 31 33 83 54 48 14 62 10 16 4 20 71 70 35 15 45 19 60 77 2 23 84 40 82 38",
"output": "80"
},
{
"input": "85\n1 18 58 8 22 76 3 61 12 33 54 41 6 24 82 15 10 17 38 64 26 4 62 28 47 14 66 9 84 75 2 71 67 43 37 32 85 21 69 52 55 63 81 51 74 59 65 34 29 36 30 45 27 53 13 79 39 57 5 70 19 40 7 42 68 48 16 80 83 23 46 35 72 31 11 44 73 77 50 56 49 25 60 20 78",
"output": "84"
},
{
"input": "86\n64 56 41 10 31 69 47 39 37 36 27 19 9 42 15 6 78 59 52 17 71 45 72 14 2 54 38 79 4 18 16 8 46 75 50 82 44 24 20 55 58 86 61 43 35 32 33 40 63 30 28 60 13 53 12 57 77 81 76 66 73 84 85 62 68 22 51 5 49 7 1 70 80 65 34 48 23 21 83 11 74 26 29 67 25 3",
"output": "70"
},
{
"input": "87\n14 20 82 47 39 75 71 45 3 37 63 19 32 68 7 41 48 76 27 46 84 49 4 44 26 69 17 64 1 18 58 33 11 23 21 86 67 52 70 16 77 78 6 74 15 87 10 59 13 34 22 2 65 38 66 61 51 57 35 60 81 40 36 80 31 43 83 56 79 55 29 5 12 8 50 30 53 72 54 9 24 25 42 62 73 28 85",
"output": "58"
},
{
"input": "88\n1 83 73 46 61 31 39 86 57 43 16 29 26 80 82 7 36 42 13 20 6 64 19 40 24 12 47 87 8 34 75 9 69 3 11 52 14 25 84 59 27 10 54 51 81 74 65 77 70 17 60 35 23 44 49 2 4 88 5 21 41 32 68 66 15 55 48 58 78 53 22 38 45 33 30 50 85 76 37 79 63 18 28 62 72 56 71 67",
"output": "87"
},
{
"input": "89\n68 40 14 58 56 25 8 44 49 55 9 76 66 54 33 81 42 15 59 17 21 30 75 60 4 48 64 6 52 63 61 27 12 57 72 67 23 86 77 80 22 13 43 73 26 78 50 51 18 62 1 29 82 16 74 2 87 24 3 41 11 46 47 69 10 84 65 39 35 79 70 32 34 31 20 19 53 71 36 28 83 88 38 85 7 5 37 45 89",
"output": "88"
},
{
"input": "90\n2 67 26 58 9 49 76 22 60 30 77 20 13 7 37 81 47 16 19 12 14 45 41 68 85 54 28 24 46 1 27 43 32 89 53 35 59 75 18 51 17 64 66 80 31 88 87 90 38 72 55 71 42 11 73 69 62 78 23 74 65 79 84 4 86 52 10 6 3 82 56 5 48 33 21 57 40 29 61 63 34 36 83 8 15 44 50 70 39 25",
"output": "60"
},
{
"input": "91\n91 69 56 16 73 55 14 82 80 46 57 81 22 71 63 76 43 37 77 75 70 3 26 2 28 17 51 38 30 67 41 47 54 62 34 25 84 11 87 39 32 52 31 36 50 19 21 53 29 24 79 8 74 64 44 7 6 18 10 42 13 9 83 58 4 88 65 60 20 90 66 49 86 89 78 48 5 27 23 59 61 15 72 45 40 33 68 85 35 12 1",
"output": "90"
},
{
"input": "92\n67 57 76 78 25 89 6 82 11 16 26 17 59 48 73 10 21 31 27 80 4 5 22 13 92 55 45 85 63 28 75 60 54 88 91 47 29 35 7 87 1 39 43 51 71 84 83 81 46 9 38 56 90 24 37 41 19 86 50 61 79 20 18 14 69 23 62 65 49 52 58 53 36 2 68 64 15 42 30 34 66 32 44 40 8 33 3 77 74 12 70 72",
"output": "67"
},
{
"input": "93\n76 35 5 87 7 21 59 71 24 37 2 73 31 74 4 52 28 20 56 27 65 86 16 45 85 67 68 70 47 72 91 88 14 32 62 69 78 41 15 22 57 18 50 13 39 58 17 83 64 51 25 11 38 77 82 90 8 26 29 61 10 43 79 53 48 6 23 55 63 49 81 92 80 44 89 60 66 30 1 9 36 33 19 46 75 93 3 12 42 84 40 54 34",
"output": "85"
},
{
"input": "94\n29 85 82 78 61 83 80 63 11 38 50 43 9 24 4 87 79 45 3 17 90 7 34 27 1 76 26 39 84 47 22 41 81 19 44 23 56 92 35 31 72 62 70 53 40 88 13 14 73 2 59 86 46 94 15 12 77 57 89 42 75 48 18 51 32 55 71 30 49 91 20 60 5 93 33 64 21 36 10 28 8 65 66 69 74 58 6 52 25 67 16 37 54 68",
"output": "69"
},
{
"input": "95\n36 73 18 77 15 71 50 57 79 65 94 88 9 69 52 70 26 66 78 89 55 20 72 83 75 68 32 28 45 74 19 22 54 23 84 90 86 12 42 58 11 81 39 31 85 47 60 44 59 43 21 7 30 41 64 76 93 46 87 48 10 40 3 14 38 49 29 35 2 67 5 34 13 37 27 56 91 17 62 80 8 61 53 95 24 92 6 82 63 33 51 25 4 16 1",
"output": "94"
},
{
"input": "96\n64 3 47 83 19 10 72 61 73 95 16 40 54 84 8 86 28 4 37 42 92 48 63 76 67 1 59 66 20 35 93 2 43 7 45 70 34 33 26 91 85 89 13 29 58 68 44 25 87 75 49 71 41 17 55 36 32 31 74 22 52 79 30 88 50 78 38 39 65 27 69 77 81 94 82 53 21 80 57 60 24 46 51 9 18 15 96 62 6 23 11 12 90 5 14 56",
"output": "86"
},
{
"input": "97\n40 63 44 64 84 92 38 41 28 91 3 70 76 67 94 96 35 79 29 22 78 88 85 8 21 1 93 54 71 80 37 17 13 26 62 59 75 87 69 33 89 49 77 61 12 39 6 36 58 18 73 50 82 45 74 52 11 34 95 7 23 30 15 32 31 16 55 19 20 83 60 72 10 53 51 14 27 9 68 47 5 2 81 46 57 86 56 43 48 66 24 25 4 42 65 97 90",
"output": "95"
},
{
"input": "98\n85 94 69 86 22 52 27 79 53 91 35 55 33 88 8 75 76 95 64 54 67 30 70 49 6 16 2 48 80 32 25 90 98 46 9 96 36 81 10 92 28 11 37 97 15 41 38 40 83 44 29 47 23 3 31 61 87 39 78 20 68 12 17 73 59 18 77 72 43 51 84 24 89 65 26 7 74 93 21 19 5 14 50 42 82 71 60 56 34 62 58 57 45 66 13 63 4 1",
"output": "97"
},
{
"input": "99\n33 48 19 41 59 64 16 12 17 13 7 1 9 6 4 92 61 49 60 25 74 65 22 97 30 32 10 62 14 55 80 66 82 78 31 23 87 93 27 98 20 29 88 84 77 34 83 96 79 90 56 89 58 72 52 47 21 76 24 70 44 94 5 39 8 18 57 36 40 68 43 75 3 2 35 99 63 26 67 73 15 11 53 28 42 46 69 50 51 95 38 37 54 85 81 91 45 86 71",
"output": "87"
},
{
"input": "100\n28 30 77 4 81 67 31 25 66 56 88 73 83 51 57 34 21 90 38 76 22 99 53 70 91 3 64 54 6 94 8 5 97 80 50 45 61 40 16 95 36 98 9 2 17 44 72 55 18 58 47 12 87 24 7 32 14 23 65 41 63 48 62 39 92 27 43 19 46 13 42 52 96 84 26 69 100 79 93 49 35 60 71 59 68 15 10 29 20 1 78 33 75 86 11 85 74 82 89 37",
"output": "89"
},
{
"input": "100\n100 97 35 55 45 3 46 98 77 64 94 85 73 43 49 79 72 9 70 62 80 88 29 58 61 20 89 83 66 86 82 15 6 87 42 96 90 75 63 38 81 40 5 23 4 18 41 19 99 60 8 12 76 51 39 93 53 26 21 50 47 28 13 30 68 59 34 54 24 56 31 27 65 16 32 10 36 52 44 91 22 14 33 25 7 78 67 17 57 37 92 11 2 69 84 95 74 71 48 1",
"output": "99"
},
{
"input": "100\n83 96 73 70 30 25 7 77 58 89 76 85 49 82 45 51 14 62 50 9 31 32 16 15 97 64 4 37 20 93 24 10 80 71 100 39 75 72 78 74 8 29 53 86 79 48 3 68 90 99 56 87 63 94 36 1 40 65 6 44 43 84 17 52 34 95 38 47 60 57 98 59 33 41 46 81 23 27 19 2 54 91 55 35 26 12 92 18 28 66 69 21 5 67 13 11 22 88 61 42",
"output": "65"
},
{
"input": "100\n96 80 47 60 56 9 78 20 37 72 68 15 100 94 51 26 65 38 50 19 4 70 25 63 22 30 13 58 43 69 18 33 5 66 39 73 12 55 95 92 97 1 14 83 10 28 64 31 46 91 32 86 74 54 29 52 89 53 90 44 62 40 16 24 67 81 36 34 7 23 79 87 75 98 84 3 41 77 76 42 71 35 49 61 2 27 59 82 99 85 21 11 45 6 88 48 17 57 8 93",
"output": "87"
},
{
"input": "100\n5 6 88 37 97 51 25 81 54 17 57 98 99 44 67 24 30 93 100 36 8 38 84 42 21 4 75 31 85 48 70 77 43 50 65 94 29 32 68 86 56 39 69 47 20 60 52 53 10 34 79 2 95 40 89 64 71 26 22 46 1 62 91 76 83 41 9 78 16 63 13 3 28 92 27 49 7 12 96 72 80 23 14 19 18 66 59 87 90 45 73 82 33 74 35 61 55 15 58 11",
"output": "81"
},
{
"input": "100\n100 97 92 12 62 17 19 58 37 26 30 95 31 35 87 10 13 43 98 61 28 89 76 1 23 21 11 22 50 56 91 74 3 24 96 55 64 67 14 4 71 16 18 9 77 68 51 81 32 82 46 88 86 60 29 66 72 85 70 7 53 63 33 45 83 2 25 94 52 93 5 69 20 47 49 54 57 39 34 27 90 80 78 59 40 42 79 6 38 8 48 15 65 73 99 44 41 84 36 75",
"output": "99"
},
{
"input": "100\n22 47 34 65 69 5 68 78 53 54 41 23 80 51 11 8 2 85 81 75 25 58 29 73 30 49 10 71 17 96 76 89 79 20 12 15 55 7 46 32 19 3 82 35 74 44 38 40 92 14 6 50 97 63 45 93 37 18 62 77 87 36 83 9 90 61 57 28 39 43 52 42 24 56 21 84 26 99 88 59 33 70 4 60 98 95 94 100 13 48 66 72 16 31 64 91 1 86 27 67",
"output": "96"
},
{
"input": "100\n41 67 94 18 14 83 59 12 19 54 13 68 75 26 15 65 80 40 23 30 34 78 47 21 63 79 4 70 3 31 86 69 92 10 61 74 97 100 9 99 32 27 91 55 85 52 16 17 28 1 64 29 58 76 98 25 84 7 2 96 20 72 36 46 49 82 93 44 45 6 38 87 57 50 53 35 60 33 8 89 39 42 37 48 62 81 73 43 95 11 66 88 90 22 24 77 71 51 5 56",
"output": "62"
},
{
"input": "100\n1 88 38 56 62 99 39 80 12 33 57 24 28 84 37 42 10 95 83 58 8 40 20 2 30 78 60 79 36 71 51 31 27 65 22 47 6 19 61 94 75 4 74 35 15 23 92 9 70 13 11 59 90 18 66 81 64 72 16 32 34 67 46 91 21 87 77 97 82 41 7 86 26 43 45 3 93 17 52 96 50 63 48 5 53 44 29 25 98 54 49 14 73 69 89 55 76 85 68 100",
"output": "99"
},
{
"input": "100\n22 59 25 77 68 79 32 45 20 28 61 60 38 86 33 10 100 15 53 75 78 39 67 13 66 34 96 4 63 23 73 29 31 35 71 55 16 14 72 56 94 97 17 93 47 84 57 8 21 51 54 85 26 76 49 81 2 92 62 44 91 87 11 24 95 69 5 7 99 6 65 48 70 12 41 18 74 27 42 3 80 30 50 98 58 37 82 89 83 36 40 52 19 9 88 46 43 1 90 64",
"output": "97"
},
{
"input": "100\n12 1 76 78 97 82 59 80 48 8 91 51 54 74 16 10 89 99 83 63 93 90 55 25 30 33 29 6 9 65 92 79 44 39 15 58 37 46 32 19 27 3 75 49 62 71 98 42 69 50 26 81 96 5 7 61 60 21 20 36 18 34 40 4 47 85 64 38 22 84 2 68 11 56 31 66 17 14 95 43 53 35 23 52 70 13 72 45 41 77 73 87 88 94 28 86 24 67 100 57",
"output": "98"
},
{
"input": "100\n66 100 53 88 7 73 54 41 31 42 8 46 65 90 78 14 94 30 79 39 89 5 83 50 38 61 37 86 22 95 60 98 34 57 91 10 75 25 15 43 23 17 96 35 93 48 87 47 56 13 19 9 82 62 67 80 11 55 99 70 18 26 58 85 12 44 16 45 4 49 20 71 92 24 81 2 76 32 6 21 84 36 52 97 59 63 40 51 27 64 68 3 77 72 28 33 29 1 74 69",
"output": "98"
},
{
"input": "100\n56 64 1 95 72 39 9 49 87 29 94 7 32 6 30 48 50 25 31 78 90 45 60 44 80 68 17 20 73 15 75 98 83 13 71 22 36 26 96 88 35 3 85 54 16 41 92 99 69 86 93 33 43 62 77 46 47 37 12 10 18 40 27 4 63 55 28 59 23 34 61 53 76 42 51 91 21 70 8 58 38 19 5 66 84 11 52 24 81 82 79 67 97 65 57 74 2 89 100 14",
"output": "98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "4\n1 2 3 4",
"output": "3"
},
{
"input": "4\n1 2 4 3",
"output": "3"
},
{
"input": "4\n1 3 2 4",
"output": "3"
},
{
"input": "4\n1 3 4 2",
"output": "3"
},
{
"input": "4\n1 4 2 3",
"output": "3"
},
{
"input": "4\n1 4 3 2",
"output": "3"
},
{
"input": "4\n2 1 3 4",
"output": "3"
},
{
"input": "4\n2 1 4 3",
"output": "2"
},
{
"input": "4\n2 4 1 3",
"output": "2"
},
{
"input": "4\n2 4 3 1",
"output": "3"
},
{
"input": "4\n3 1 2 4",
"output": "3"
},
{
"input": "4\n3 1 4 2",
"output": "2"
},
{
"input": "4\n3 2 1 4",
"output": "3"
},
{
"input": "4\n3 2 4 1",
"output": "3"
},
{
"input": "4\n3 4 1 2",
"output": "2"
},
{
"input": "4\n3 4 2 1",
"output": "3"
},
{
"input": "4\n4 1 2 3",
"output": "3"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "4\n4 2 1 3",
"output": "3"
},
{
"input": "4\n4 2 3 1",
"output": "3"
},
{
"input": "4\n4 3 1 2",
"output": "3"
},
{
"input": "4\n4 3 2 1",
"output": "3"
},
{
"input": "8\n2 5 6 4 8 3 1 7",
"output": "6"
},
{
"input": "5\n2 3 1 5 4",
"output": "3"
},
{
"input": "6\n2 5 3 6 4 1",
"output": "5"
},
{
"input": "6\n5 4 2 6 1 3",
"output": "4"
},
{
"input": "6\n4 2 3 1 6 5",
"output": "4"
},
{
"input": "6\n5 4 2 1 6 3",
"output": "4"
},
{
"input": "9\n7 2 3 4 5 6 1 9 8",
"output": "7"
},
{
"input": "6\n3 2 1 4 6 5",
"output": "4"
},
{
"input": "6\n2 3 4 1 6 5",
"output": "4"
},
{
"input": "10\n5 2 3 4 1 6 7 8 10 9",
"output": "8"
},
{
"input": "6\n5 2 3 1 6 4",
"output": "4"
},
{
"input": "10\n2 9 3 4 1 10 5 6 7 8",
"output": "5"
},
{
"input": "10\n2 3 4 5 6 7 1 8 10 9",
"output": "8"
},
{
"input": "8\n2 3 4 5 1 6 8 7",
"output": "6"
},
{
"input": "6\n2 1 3 4 5 6",
"output": "5"
}
] | 1,616,261,176
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 159
| 62
| 0
|
import sys
input = sys.stdin.readline
n = int(input())
a = [int(i) for i in input().split()]
x, y = a.index(1), a.index(n)
ans = max(x, y, n - x - 1, n - y - 1)
print(ans)
|
Title: Nicholas and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
Output Specification:
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
Demo Input:
['5\n4 5 1 3 2\n', '7\n1 6 5 3 4 7 2\n', '6\n6 5 4 3 2 1\n']
Demo Output:
['3\n', '6\n', '5\n']
Note:
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
|
```python
import sys
input = sys.stdin.readline
n = int(input())
a = [int(i) for i in input().split()]
x, y = a.index(1), a.index(n)
ans = max(x, y, n - x - 1, n - y - 1)
print(ans)
```
| 3
|
|
748
|
B
|
Santa Claus and Keyboard Check
|
PROGRAMMING
| 1,500
|
[
"implementation",
"strings"
] | null | null |
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
|
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
|
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
|
[
"helloworld\nehoolwlroz\n",
"hastalavistababy\nhastalavistababy\n",
"merrychristmas\nchristmasmerry\n"
] |
[
"3\nh e\nl o\nd z\n",
"0\n",
"-1\n"
] |
none
| 1,000
|
[
{
"input": "helloworld\nehoolwlroz",
"output": "3\nh e\nl o\nd z"
},
{
"input": "hastalavistababy\nhastalavistababy",
"output": "0"
},
{
"input": "merrychristmas\nchristmasmerry",
"output": "-1"
},
{
"input": "kusyvdgccw\nkusyvdgccw",
"output": "0"
},
{
"input": "bbbbbabbab\naaaaabaaba",
"output": "1\nb a"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx",
"output": "-1"
},
{
"input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc",
"output": "1\nd b"
},
{
"input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd",
"output": "0"
},
{
"input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak",
"output": "5\ng f\nn i\nd h\ne o\nb k"
},
{
"input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc",
"output": "0"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "zz\nzy",
"output": "-1"
},
{
"input": "as\ndf",
"output": "2\na d\ns f"
},
{
"input": "abc\nbca",
"output": "-1"
},
{
"input": "rtfg\nrftg",
"output": "1\nt f"
},
{
"input": "y\ny",
"output": "0"
},
{
"input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm",
"output": "-1"
},
{
"input": "aaaaaa\nabcdef",
"output": "-1"
},
{
"input": "qwerty\nffffff",
"output": "-1"
},
{
"input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh",
"output": "0"
},
{
"input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe",
"output": "-1"
},
{
"input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba",
"output": "0"
},
{
"input": "dbadbddddb\nacbacaaaac",
"output": "-1"
},
{
"input": "dacbdbbbdd\nadbdadddaa",
"output": "-1"
},
{
"input": "bbbbcbcbbc\ndaddbabddb",
"output": "-1"
},
{
"input": "dddddbcdbd\nbcbbbdacdb",
"output": "-1"
},
{
"input": "cbadcbcdaa\nabbbababbb",
"output": "-1"
},
{
"input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk",
"output": "-1"
},
{
"input": "acbbccabaa\nabbbbbabaa",
"output": "-1"
},
{
"input": "ccccaccccc\naaaabaaaac",
"output": "-1"
},
{
"input": "acbacacbbb\nacbacacbbb",
"output": "0"
},
{
"input": "abbababbcc\nccccccccbb",
"output": "-1"
},
{
"input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh",
"output": "-1"
},
{
"input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage",
"output": "-1"
},
{
"input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai",
"output": "-1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "z\na",
"output": "1\nz a"
},
{
"input": "aa\nzz",
"output": "1\na z"
},
{
"input": "az\nza",
"output": "1\na z"
},
{
"input": "aa\nza",
"output": "-1"
},
{
"input": "za\nzz",
"output": "-1"
},
{
"input": "aa\nab",
"output": "-1"
},
{
"input": "hehe\nheeh",
"output": "-1"
},
{
"input": "bd\ncc",
"output": "-1"
},
{
"input": "he\nhh",
"output": "-1"
},
{
"input": "hee\nheh",
"output": "-1"
},
{
"input": "aa\nac",
"output": "-1"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "hello\nehlol",
"output": "-1"
},
{
"input": "ac\naa",
"output": "-1"
},
{
"input": "aaabbb\nbbbaab",
"output": "-1"
},
{
"input": "aa\nfa",
"output": "-1"
},
{
"input": "hg\nee",
"output": "-1"
},
{
"input": "helloworld\nehoolwlrow",
"output": "-1"
},
{
"input": "abb\nbab",
"output": "-1"
},
{
"input": "aaa\naae",
"output": "-1"
},
{
"input": "aba\nbaa",
"output": "-1"
},
{
"input": "aa\nba",
"output": "-1"
},
{
"input": "da\naa",
"output": "-1"
},
{
"input": "aaa\naab",
"output": "-1"
},
{
"input": "xy\nzz",
"output": "-1"
}
] | 1,485,021,984
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 86
| 77
| 4,608,000
|
dict = {}
l = []
o = input()
s = input()
for i in range(len(o)):
if o[i]==s[i]:
if o[i] not in l:
if o[i] not in dict.keys() and o[i] not in dict.values():
l.append(o[i])
else:
print("-1")
exit()
else:
if o[i] in l or s[i] in l:
print("-1")
exit()
elif o[i] in dict.keys():
if dict[o[i]] != s[i]:
print("-1")
exit()
elif s[i] in dict.keys():
if dict[s[i]] != o[i]:
print("-1")
exit()
elif s[i] in dict.values() or o[i] in dict.values():
print("-1")
exit()
else:
dict[o[i]]=s[i]
print(len(dict))
for c in dict.keys():
print(c,dict[c])
|
Title: Santa Claus and Keyboard Check
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
Input Specification:
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
Output Specification:
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
Demo Input:
['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n']
Demo Output:
['3\nh e\nl o\nd z\n', '0\n', '-1\n']
Note:
none
|
```python
dict = {}
l = []
o = input()
s = input()
for i in range(len(o)):
if o[i]==s[i]:
if o[i] not in l:
if o[i] not in dict.keys() and o[i] not in dict.values():
l.append(o[i])
else:
print("-1")
exit()
else:
if o[i] in l or s[i] in l:
print("-1")
exit()
elif o[i] in dict.keys():
if dict[o[i]] != s[i]:
print("-1")
exit()
elif s[i] in dict.keys():
if dict[s[i]] != o[i]:
print("-1")
exit()
elif s[i] in dict.values() or o[i] in dict.values():
print("-1")
exit()
else:
dict[o[i]]=s[i]
print(len(dict))
for c in dict.keys():
print(c,dict[c])
```
| 3
|
|
6
|
C
|
Alice, Bob and Chocolate
|
PROGRAMMING
| 1,200
|
[
"greedy",
"two pointers"
] |
C. Alice, Bob and Chocolate
|
2
|
64
|
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
|
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
|
[
"5\n2 9 8 2 7\n"
] |
[
"2 3\n"
] |
none
| 0
|
[
{
"input": "5\n2 9 8 2 7",
"output": "2 3"
},
{
"input": "1\n1",
"output": "1 0"
},
{
"input": "2\n1 1",
"output": "1 1"
},
{
"input": "3\n1 1 1",
"output": "2 1"
},
{
"input": "4\n1 1 1 1",
"output": "2 2"
},
{
"input": "1\n6",
"output": "1 0"
},
{
"input": "2\n8 2",
"output": "1 1"
},
{
"input": "3\n6 8 4",
"output": "1 2"
},
{
"input": "4\n4 3 2 8",
"output": "3 1"
},
{
"input": "5\n1 9 8 2 7",
"output": "2 3"
},
{
"input": "6\n1 4 7 3 2 1",
"output": "3 3"
},
{
"input": "11\n7 9 1 8 7 1 7 1 4 8 1",
"output": "4 7"
},
{
"input": "12\n4 2 7 1 9 5 6 2 7 8 5 7",
"output": "7 5"
},
{
"input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9",
"output": "7 6"
}
] | 1,672,912,720
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 218
| 6,860,800
|
# LUOGU_RID: 98755200
n = int(input())
lst = list(map(int,input().split()))
l,r = 0,n-1
sl,sr = 0,0
cntl,cntr=0,0
while l<=r:
if sl<=sr:
cntl+=1
sl += lst[l]
l+=1
else:
cntr+=1
sr += lst[r]
r-=1
print("%d %d"%(cntl,cntr))
|
Title: Alice, Bob and Chocolate
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Output Specification:
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
Demo Input:
['5\n2 9 8 2 7\n']
Demo Output:
['2 3\n']
Note:
none
|
```python
# LUOGU_RID: 98755200
n = int(input())
lst = list(map(int,input().split()))
l,r = 0,n-1
sl,sr = 0,0
cntl,cntr=0,0
while l<=r:
if sl<=sr:
cntl+=1
sl += lst[l]
l+=1
else:
cntr+=1
sr += lst[r]
r-=1
print("%d %d"%(cntl,cntr))
```
| 3.894383
|
478
|
B
|
Random Teams
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null |
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
|
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
|
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
|
[
"5 1\n",
"3 2\n",
"6 3\n"
] |
[
"10 10\n",
"1 1\n",
"3 6\n"
] |
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
| 1,000
|
[
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,684,767,935
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 62
| 0
|
n, m = map(int, input().split())
a = n // m
b = n % m
maksa = n - m + 1
ans1 = maksa*(maksa - 1) // 2
ans2 = b * (a+1)*a // 2 + (m-b)*a*(a-1) // 2
print(ans2, ans1)
|
Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
|
```python
n, m = map(int, input().split())
a = n // m
b = n % m
maksa = n - m + 1
ans1 = maksa*(maksa - 1) // 2
ans2 = b * (a+1)*a // 2 + (m-b)*a*(a-1) // 2
print(ans2, ans1)
```
| 3
|
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integer — the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,693,052,775
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 29
| 61
| 0
|
count_h = str(input())
count_h = count_h.split(" ")
height = int(count_h[1])
friends = str(input())
friends = friends.split(" ")
reuslt = 0
for friend in friends:
if(int(friend) <= height):
reuslt = reuslt + 1
else:
reuslt = reuslt + 2
print(reuslt)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
|
```python
count_h = str(input())
count_h = count_h.split(" ")
height = int(count_h[1])
friends = str(input())
friends = friends.split(" ")
reuslt = 0
for friend in friends:
if(int(friend) <= height):
reuslt = reuslt + 1
else:
reuslt = reuslt + 2
print(reuslt)
```
| 3
|
|
199
|
A
|
Hexadecimal's theorem
|
PROGRAMMING
| 900
|
[
"brute force",
"constructive algorithms",
"implementation",
"number theory"
] | null | null |
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
|
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
|
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
|
[
"3\n",
"13\n"
] |
[
"1 1 1\n",
"2 3 8\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "1 1 1"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "3",
"output": "1 1 1"
},
{
"input": "5",
"output": "1 1 3"
},
{
"input": "8",
"output": "1 2 5"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "21",
"output": "3 5 13"
},
{
"input": "34",
"output": "5 8 21"
},
{
"input": "55",
"output": "8 13 34"
},
{
"input": "89",
"output": "13 21 55"
},
{
"input": "144",
"output": "21 34 89"
},
{
"input": "233",
"output": "34 55 144"
},
{
"input": "377",
"output": "55 89 233"
},
{
"input": "610",
"output": "89 144 377"
},
{
"input": "987",
"output": "144 233 610"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "2584",
"output": "377 610 1597"
},
{
"input": "4181",
"output": "610 987 2584"
},
{
"input": "6765",
"output": "987 1597 4181"
},
{
"input": "10946",
"output": "1597 2584 6765"
},
{
"input": "17711",
"output": "2584 4181 10946"
},
{
"input": "28657",
"output": "4181 6765 17711"
},
{
"input": "46368",
"output": "6765 10946 28657"
},
{
"input": "75025",
"output": "10946 17711 46368"
},
{
"input": "121393",
"output": "17711 28657 75025"
},
{
"input": "196418",
"output": "28657 46368 121393"
},
{
"input": "317811",
"output": "46368 75025 196418"
},
{
"input": "514229",
"output": "75025 121393 317811"
},
{
"input": "832040",
"output": "121393 196418 514229"
},
{
"input": "1346269",
"output": "196418 317811 832040"
},
{
"input": "2178309",
"output": "317811 514229 1346269"
},
{
"input": "3524578",
"output": "514229 832040 2178309"
},
{
"input": "5702887",
"output": "832040 1346269 3524578"
},
{
"input": "9227465",
"output": "1346269 2178309 5702887"
},
{
"input": "14930352",
"output": "2178309 3524578 9227465"
},
{
"input": "24157817",
"output": "3524578 5702887 14930352"
},
{
"input": "39088169",
"output": "5702887 9227465 24157817"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "165580141",
"output": "24157817 39088169 102334155"
},
{
"input": "267914296",
"output": "39088169 63245986 165580141"
},
{
"input": "433494437",
"output": "63245986 102334155 267914296"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
}
] | 1,629,501,471
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 156
| 6,758,400
|
# Nome: Matheus de Souza Oliveira RA: 203407
fibonacciNumber = int(input())
print(f"0 0 {fibonacciNumber}")
|
Title: Hexadecimal's theorem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
Input Specification:
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
Output Specification:
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '13\n']
Demo Output:
['1 1 1\n', '2 3 8\n']
Note:
none
|
```python
# Nome: Matheus de Souza Oliveira RA: 203407
fibonacciNumber = int(input())
print(f"0 0 {fibonacciNumber}")
```
| 3
|
|
923
|
D
|
Picking Strings
|
PROGRAMMING
| 2,500
|
[
"constructive algorithms",
"implementation",
"strings"
] | null | null |
Alice has a string consisting of characters 'A', 'B' and 'C'. Bob can use the following transitions on any substring of our string in any order any number of times:
- A BC - B AC - C AB - AAA empty string
Note that a substring is one or more consecutive characters. For given queries, determine whether it is possible to obtain the target string from source.
|
The first line contains a string *S* (1<=≤<=|*S*|<=≤<=105). The second line contains a string *T* (1<=≤<=|*T*|<=≤<=105), each of these strings consists only of uppercase English letters 'A', 'B' and 'C'.
The third line contains the number of queries *Q* (1<=≤<=*Q*<=≤<=105).
The following *Q* lines describe queries. The *i*-th of these lines contains four space separated integers *a**i*, *b**i*, *c**i*, *d**i*. These represent the *i*-th query: is it possible to create *T*[*c**i*..*d**i*] from *S*[*a**i*..*b**i*] by applying the above transitions finite amount of times?
Here, *U*[*x*..*y*] is a substring of *U* that begins at index *x* (indexed from 1) and ends at index *y*. In particular, *U*[1..|*U*|] is the whole string *U*.
It is guaranteed that 1<=≤<=*a*<=≤<=*b*<=≤<=|*S*| and 1<=≤<=*c*<=≤<=*d*<=≤<=|*T*|.
|
Print a string of *Q* characters, where the *i*-th character is '1' if the answer to the *i*-th query is positive, and '0' otherwise.
|
[
"AABCCBAAB\nABCB\n5\n1 3 1 2\n2 2 2 4\n7 9 1 1\n3 4 2 3\n4 5 1 3\n"
] |
[
"10011\n"
] |
In the first query we can achieve the result, for instance, by using transitions <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c164f8b6e335aa51b97bbd019ca0d7326927314.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
The third query asks for changing AAB to A — but in this case we are not able to get rid of the character 'B'.
| 1,750
|
[
{
"input": "AABCCBAAB\nABCB\n5\n1 3 1 2\n2 2 2 4\n7 9 1 1\n3 4 2 3\n4 5 1 3",
"output": "10011"
},
{
"input": "AAAAAA\nAAAAAA\n30\n3 4 1 2\n3 3 4 4\n5 6 3 4\n3 3 2 3\n6 6 1 5\n2 4 4 6\n1 6 2 5\n6 6 3 4\n3 5 1 4\n4 5 3 6\n2 3 2 4\n3 4 4 4\n6 6 4 6\n3 3 2 5\n1 5 3 3\n4 6 1 2\n6 6 6 6\n3 3 3 4\n6 6 6 6\n5 6 4 4\n6 6 5 5\n2 3 1 4\n3 6 4 5\n3 5 6 6\n4 5 2 6\n5 6 6 6\n1 4 2 5\n4 5 2 5\n4 5 1 3\n2 2 4 6",
"output": "111001000000000010101000001000"
},
{
"input": "A\nA\n1\n1 1 1 1",
"output": "1"
},
{
"input": "CCBACACBCCCBBAAC\nCACCAAABAACBBBBAC\n20\n7 7 2 15\n3 11 14 15\n4 9 6 12\n10 15 13 17\n10 16 5 14\n14 15 12 16\n16 16 16 16\n3 15 9 14\n10 12 8 12\n15 15 9 10\n14 15 8 15\n7 14 17 17\n15 15 17 17\n15 15 5 9\n4 14 12 17\n13 15 8 12\n1 4 2 2\n6 13 17 17\n11 14 5 11\n15 16 2 9",
"output": "00001100101000010000"
},
{
"input": "ABAAAAAA\nABABBAAAAAA\n5\n3 8 4 11\n3 8 3 11\n2 8 2 11\n1 8 1 11\n1 8 2 11",
"output": "00111"
},
{
"input": "ABC\nABC\n9\n1 1 1 1\n1 1 2 2\n1 1 3 3\n2 2 1 1\n2 2 2 2\n2 2 3 3\n3 3 1 1\n3 3 2 2\n3 3 3 3",
"output": "100011011"
},
{
"input": "A\nBB\n1\n1 1 1 2",
"output": "1"
},
{
"input": "BBAACCBACACBCCCBBAAC\nCACCAAABAACBBBBACABC\n1\n3 10 6 13",
"output": "0"
},
{
"input": "AAAAACAAAAAB\nAAAAABAAAAAC\n20\n1 6 10 12\n10 12 7 12\n9 12 8 12\n2 6 8 12\n7 12 2 6\n9 12 7 12\n1 6 10 12\n4 6 3 6\n7 12 7 12\n4 6 5 6\n3 6 12 12\n5 6 8 12\n9 12 1 6\n2 6 3 6\n10 12 2 6\n1 6 12 12\n7 12 3 6\n9 12 3 6\n10 12 10 12\n11 12 11 12",
"output": "11111111111111111111"
},
{
"input": "AAABABACACACAAACAC\nAABCBBACABACBBCBCC\n20\n6 17 17 17\n14 17 13 14\n1 13 7 12\n11 17 5 17\n6 10 16 17\n16 17 16 16\n15 17 17 17\n15 15 7 10\n1 4 10 14\n4 11 2 17\n6 9 1 7\n16 16 11 18\n4 14 6 17\n1 17 6 18\n13 18 15 18\n1 12 5 11\n8 8 12 17\n10 15 3 7\n17 17 9 14\n6 17 6 6",
"output": "00010001011111100110"
},
{
"input": "AAACAABB\nCACBCCBB\n10\n2 2 4 5\n4 4 3 3\n1 4 1 8\n5 5 2 8\n7 7 3 4\n6 6 2 2\n1 7 1 1\n6 7 7 8\n4 6 6 8\n8 8 6 8",
"output": "1111010011"
},
{
"input": "A\nCB\n1\n1 1 1 2",
"output": "1"
},
{
"input": "BCBBC\nABBCB\n5\n2 2 2 4\n3 4 2 4\n1 2 2 2\n2 3 4 5\n5 5 2 4",
"output": "10011"
}
] | 1,680,538,015
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 109
| 1,512
| 15,052,800
|
a = input()
b = input()
w = [0]
x = [0]
for i in a:
if i == 'A':
w.append(w[-1]+1)
x.append(x[-1])
else:
w.append(0)
x.append(x[-1]+1)
y = [0]
z = [0]
for i in b:
if i == 'A':
y.append(y[-1]+1)
z.append(z[-1])
else:
y.append(0)
z.append(z[-1]+1)
ans = ''
for _ in range(int(input())):
a,b,c,d = map(int,input().split())
p = x[b]-x[a-1]
q = z[d]-z[c-1]
if p > q or p % 2 != q % 2:
ans += '0'
else:
m = min(w[b],b-a+1)
n = min(y[d],d-c+1)
if m < n or m % 3 != n % 3 and p == q:
ans += '0'
elif p == 0 and q > 0 and m == n:
ans += '0'
else:
ans += '1'
print(ans)
|
Title: Picking Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice has a string consisting of characters 'A', 'B' and 'C'. Bob can use the following transitions on any substring of our string in any order any number of times:
- A BC - B AC - C AB - AAA empty string
Note that a substring is one or more consecutive characters. For given queries, determine whether it is possible to obtain the target string from source.
Input Specification:
The first line contains a string *S* (1<=≤<=|*S*|<=≤<=105). The second line contains a string *T* (1<=≤<=|*T*|<=≤<=105), each of these strings consists only of uppercase English letters 'A', 'B' and 'C'.
The third line contains the number of queries *Q* (1<=≤<=*Q*<=≤<=105).
The following *Q* lines describe queries. The *i*-th of these lines contains four space separated integers *a**i*, *b**i*, *c**i*, *d**i*. These represent the *i*-th query: is it possible to create *T*[*c**i*..*d**i*] from *S*[*a**i*..*b**i*] by applying the above transitions finite amount of times?
Here, *U*[*x*..*y*] is a substring of *U* that begins at index *x* (indexed from 1) and ends at index *y*. In particular, *U*[1..|*U*|] is the whole string *U*.
It is guaranteed that 1<=≤<=*a*<=≤<=*b*<=≤<=|*S*| and 1<=≤<=*c*<=≤<=*d*<=≤<=|*T*|.
Output Specification:
Print a string of *Q* characters, where the *i*-th character is '1' if the answer to the *i*-th query is positive, and '0' otherwise.
Demo Input:
['AABCCBAAB\nABCB\n5\n1 3 1 2\n2 2 2 4\n7 9 1 1\n3 4 2 3\n4 5 1 3\n']
Demo Output:
['10011\n']
Note:
In the first query we can achieve the result, for instance, by using transitions <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c164f8b6e335aa51b97bbd019ca0d7326927314.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
The third query asks for changing AAB to A — but in this case we are not able to get rid of the character 'B'.
|
```python
a = input()
b = input()
w = [0]
x = [0]
for i in a:
if i == 'A':
w.append(w[-1]+1)
x.append(x[-1])
else:
w.append(0)
x.append(x[-1]+1)
y = [0]
z = [0]
for i in b:
if i == 'A':
y.append(y[-1]+1)
z.append(z[-1])
else:
y.append(0)
z.append(z[-1]+1)
ans = ''
for _ in range(int(input())):
a,b,c,d = map(int,input().split())
p = x[b]-x[a-1]
q = z[d]-z[c-1]
if p > q or p % 2 != q % 2:
ans += '0'
else:
m = min(w[b],b-a+1)
n = min(y[d],d-c+1)
if m < n or m % 3 != n % 3 and p == q:
ans += '0'
elif p == 0 and q > 0 and m == n:
ans += '0'
else:
ans += '1'
print(ans)
```
| 3
|
|
359
|
A
|
Table
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"greedy",
"implementation"
] | null | null |
Simon has a rectangular table consisting of *n* rows and *m* columns. Simon numbered the rows of the table from top to bottom starting from one and the columns — from left to right starting from one. We'll represent the cell on the *x*-th row and the *y*-th column as a pair of numbers (*x*,<=*y*). The table corners are cells: (1,<=1), (*n*,<=1), (1,<=*m*), (*n*,<=*m*).
Simon thinks that some cells in this table are good. Besides, it's known that no good cell is the corner of the table.
Initially, all cells of the table are colorless. Simon wants to color all cells of his table. In one move, he can choose any good cell of table (*x*1,<=*y*1), an arbitrary corner of the table (*x*2,<=*y*2) and color all cells of the table (*p*,<=*q*), which meet both inequations: *min*(*x*1,<=*x*2)<=≤<=*p*<=≤<=*max*(*x*1,<=*x*2), *min*(*y*1,<=*y*2)<=≤<=*q*<=≤<=*max*(*y*1,<=*y*2).
Help Simon! Find the minimum number of operations needed to color all cells of the table. Note that you can color one cell multiple times.
|
The first line contains exactly two integers *n*, *m* (3<=≤<=*n*,<=*m*<=≤<=50).
Next *n* lines contain the description of the table cells. Specifically, the *i*-th line contains *m* space-separated integers *a**i*1,<=*a**i*2,<=...,<=*a**im*. If *a**ij* equals zero, then cell (*i*,<=*j*) isn't good. Otherwise *a**ij* equals one. It is guaranteed that at least one cell is good. It is guaranteed that no good cell is a corner.
|
Print a single number — the minimum number of operations Simon needs to carry out his idea.
|
[
"3 3\n0 0 0\n0 1 0\n0 0 0\n",
"4 3\n0 0 0\n0 0 1\n1 0 0\n0 0 0\n"
] |
[
"4\n",
"2\n"
] |
In the first sample, the sequence of operations can be like this:
- For the first time you need to choose cell (2, 2) and corner (1, 1). - For the second time you need to choose cell (2, 2) and corner (3, 3). - For the third time you need to choose cell (2, 2) and corner (3, 1). - For the fourth time you need to choose cell (2, 2) and corner (1, 3).
In the second sample the sequence of operations can be like this:
- For the first time you need to choose cell (3, 1) and corner (4, 3). - For the second time you need to choose cell (2, 3) and corner (1, 1).
| 500
|
[
{
"input": "3 3\n0 0 0\n0 1 0\n0 0 0",
"output": "4"
},
{
"input": "4 3\n0 0 0\n0 0 1\n1 0 0\n0 0 0",
"output": "2"
},
{
"input": "50 4\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 1 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "4"
},
{
"input": "5 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "4 32\n0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "7 4\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 1 0 0",
"output": "2"
},
{
"input": "13 15\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 3\n0 1 0\n0 0 0\n0 0 0",
"output": "2"
},
{
"input": "3 3\n0 0 0\n0 0 0\n0 1 0",
"output": "2"
},
{
"input": "3 3\n0 0 0\n1 0 0\n0 0 0",
"output": "2"
},
{
"input": "3 3\n0 0 0\n0 0 1\n0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0 0\n0 0 0 0\n0 0 0 0",
"output": "2"
},
{
"input": "3 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "2"
},
{
"input": "3 5\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "3 5\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "2"
},
{
"input": "3 5\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "4 3\n0 1 0\n0 0 0\n0 0 0\n0 0 0",
"output": "2"
},
{
"input": "4 3\n0 0 0\n0 0 0\n0 0 0\n0 1 0",
"output": "2"
},
{
"input": "5 3\n0 0 0\n0 0 0\n1 0 0\n0 0 0\n0 0 0",
"output": "2"
},
{
"input": "5 3\n0 0 0\n0 0 1\n0 0 0\n0 0 0\n0 0 0",
"output": "2"
},
{
"input": "5 3\n0 0 0\n0 1 0\n0 0 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "4 4\n0 0 0 0\n0 1 1 0\n0 1 1 0\n0 0 0 0",
"output": "4"
},
{
"input": "5 3\n0 0 0\n0 0 1\n0 0 0\n0 1 0\n0 0 0",
"output": "2"
},
{
"input": "3 3\n0 0 0\n0 1 1\n0 0 0",
"output": "2"
},
{
"input": "4 3\n0 0 0\n0 0 0\n0 1 0\n0 0 0",
"output": "4"
},
{
"input": "5 5\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "5 3\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n0 0 0",
"output": "2"
}
] | 1,453,500,158
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 109
| 204,800
|
n, m = map(int, input().split())
matrix = [[] for i in range(n)]
for i in range(n):
matrix[i] = list(map(int, input().split()))
flag = 0
for i in range(n):
for j in range(m):
if matrix[i][j] == 1:
if i == 0 or i == n - 1 or j == 0 or j == m - 1:
flag = 1
if flag == 0:
print(4)
else:
print(2)
|
Title: Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Simon has a rectangular table consisting of *n* rows and *m* columns. Simon numbered the rows of the table from top to bottom starting from one and the columns — from left to right starting from one. We'll represent the cell on the *x*-th row and the *y*-th column as a pair of numbers (*x*,<=*y*). The table corners are cells: (1,<=1), (*n*,<=1), (1,<=*m*), (*n*,<=*m*).
Simon thinks that some cells in this table are good. Besides, it's known that no good cell is the corner of the table.
Initially, all cells of the table are colorless. Simon wants to color all cells of his table. In one move, he can choose any good cell of table (*x*1,<=*y*1), an arbitrary corner of the table (*x*2,<=*y*2) and color all cells of the table (*p*,<=*q*), which meet both inequations: *min*(*x*1,<=*x*2)<=≤<=*p*<=≤<=*max*(*x*1,<=*x*2), *min*(*y*1,<=*y*2)<=≤<=*q*<=≤<=*max*(*y*1,<=*y*2).
Help Simon! Find the minimum number of operations needed to color all cells of the table. Note that you can color one cell multiple times.
Input Specification:
The first line contains exactly two integers *n*, *m* (3<=≤<=*n*,<=*m*<=≤<=50).
Next *n* lines contain the description of the table cells. Specifically, the *i*-th line contains *m* space-separated integers *a**i*1,<=*a**i*2,<=...,<=*a**im*. If *a**ij* equals zero, then cell (*i*,<=*j*) isn't good. Otherwise *a**ij* equals one. It is guaranteed that at least one cell is good. It is guaranteed that no good cell is a corner.
Output Specification:
Print a single number — the minimum number of operations Simon needs to carry out his idea.
Demo Input:
['3 3\n0 0 0\n0 1 0\n0 0 0\n', '4 3\n0 0 0\n0 0 1\n1 0 0\n0 0 0\n']
Demo Output:
['4\n', '2\n']
Note:
In the first sample, the sequence of operations can be like this:
- For the first time you need to choose cell (2, 2) and corner (1, 1). - For the second time you need to choose cell (2, 2) and corner (3, 3). - For the third time you need to choose cell (2, 2) and corner (3, 1). - For the fourth time you need to choose cell (2, 2) and corner (1, 3).
In the second sample the sequence of operations can be like this:
- For the first time you need to choose cell (3, 1) and corner (4, 3). - For the second time you need to choose cell (2, 3) and corner (1, 1).
|
```python
n, m = map(int, input().split())
matrix = [[] for i in range(n)]
for i in range(n):
matrix[i] = list(map(int, input().split()))
flag = 0
for i in range(n):
for j in range(m):
if matrix[i][j] == 1:
if i == 0 or i == n - 1 or j == 0 or j == m - 1:
flag = 1
if flag == 0:
print(4)
else:
print(2)
```
| 3
|
|
965
|
B
|
Battleship
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Arkady is playing Battleship. The rules of this game aren't really important.
There is a field of $n \times n$ cells. There should be exactly one $k$-decker on the field, i. e. a ship that is $k$ cells long oriented either horizontally or vertically. However, Arkady doesn't know where it is located. For each cell Arkady knows if it is definitely empty or can contain a part of the ship.
Consider all possible locations of the ship. Find such a cell that belongs to the maximum possible number of different locations of the ship.
|
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the size of the field and the size of the ship.
The next $n$ lines contain the field. Each line contains $n$ characters, each of which is either '#' (denotes a definitely empty cell) or '.' (denotes a cell that can belong to the ship).
|
Output two integers — the row and the column of a cell that belongs to the maximum possible number of different locations of the ship.
If there are multiple answers, output any of them. In particular, if no ship can be placed on the field, you can output any cell.
|
[
"4 3\n#..#\n#.#.\n....\n.###\n",
"10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#\n",
"19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#\n"
] |
[
"3 2\n",
"6 1\n",
"1 8\n"
] |
The picture below shows the three possible locations of the ship that contain the cell $(3, 2)$ in the first sample.
| 1,000
|
[
{
"input": "4 3\n#..#\n#.#.\n....\n.###",
"output": "3 2"
},
{
"input": "10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#",
"output": "6 1"
},
{
"input": "19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#",
"output": "1 8"
},
{
"input": "10 4\n##..######\n#...######\n#...######\n#......###\n#.......##\n.##.######\n.##.######\n.##.######\n.#....####\n....######",
"output": "4 4"
},
{
"input": "1 1\n.",
"output": "1 1"
},
{
"input": "1 1\n#",
"output": "1 1"
},
{
"input": "5 2\n..##.\n.###.\n#####\n#####\n..#..",
"output": "1 1"
},
{
"input": "5 2\n..##.\n####.\n#####\n.####\n..#..",
"output": "5 1"
},
{
"input": "5 2\n..##.\n####.\n#####\n####.\n..#..",
"output": "5 5"
},
{
"input": "5 2\n.##..\n.###.\n#####\n#####\n..#..",
"output": "1 5"
},
{
"input": "2 2\n##\n##",
"output": "1 1"
},
{
"input": "4 1\n####\n####\n####\n###.",
"output": "4 4"
},
{
"input": "2 2\n#.\n.#",
"output": "1 1"
},
{
"input": "3 3\n###\n##.\n###",
"output": "1 1"
},
{
"input": "4 4\n####\n####\n####\n####",
"output": "1 1"
},
{
"input": "4 3\n####\n####\n####\n####",
"output": "1 1"
},
{
"input": "3 1\n###\n###\n###",
"output": "1 1"
},
{
"input": "3 2\n###\n###\n###",
"output": "1 1"
},
{
"input": "3 3\n.#.\n#.#\n.#.",
"output": "1 1"
}
] | 1,526,498,182
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 842
| 7,065,600
|
n, k = [int(x) for x in input().split()]
a = []
for i in range(n):
s = input()
a.append(s)
mx, I, J = 0, 0, 0
for i in range(n):
for j in range(n):
if a[i][j] == '#':
continue
iup, ido = i, i
jup, jdo = j, j
while iup >= 0 and a[iup][j] == '.':
iup -= 1
while ido < n and a[ido][j] == '.':
ido += 1
while jup >= 0 and a[i][jup] == '.':
jup -= 1
while jdo < n and a[i][jdo] == '.':
jdo += 1
iup = max(iup + 1, i - k + 1)
ido = min(ido - 1, i + k - 1)
jup = max(jup + 1, j - k + 1)
jdo = min(jdo - 1, j + k - 1)
tmp = max((ido - iup + 1)-(k-1), 0) + max(0, (jdo - jup + 1) - (k-1))
if tmp > mx:
mx = tmp
I, J = i, j
print(I + 1, end=" ")
print(J + 1)
|
Title: Battleship
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arkady is playing Battleship. The rules of this game aren't really important.
There is a field of $n \times n$ cells. There should be exactly one $k$-decker on the field, i. e. a ship that is $k$ cells long oriented either horizontally or vertically. However, Arkady doesn't know where it is located. For each cell Arkady knows if it is definitely empty or can contain a part of the ship.
Consider all possible locations of the ship. Find such a cell that belongs to the maximum possible number of different locations of the ship.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the size of the field and the size of the ship.
The next $n$ lines contain the field. Each line contains $n$ characters, each of which is either '#' (denotes a definitely empty cell) or '.' (denotes a cell that can belong to the ship).
Output Specification:
Output two integers — the row and the column of a cell that belongs to the maximum possible number of different locations of the ship.
If there are multiple answers, output any of them. In particular, if no ship can be placed on the field, you can output any cell.
Demo Input:
['4 3\n#..#\n#.#.\n....\n.###\n', '10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#\n', '19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#\n']
Demo Output:
['3 2\n', '6 1\n', '1 8\n']
Note:
The picture below shows the three possible locations of the ship that contain the cell $(3, 2)$ in the first sample.
|
```python
n, k = [int(x) for x in input().split()]
a = []
for i in range(n):
s = input()
a.append(s)
mx, I, J = 0, 0, 0
for i in range(n):
for j in range(n):
if a[i][j] == '#':
continue
iup, ido = i, i
jup, jdo = j, j
while iup >= 0 and a[iup][j] == '.':
iup -= 1
while ido < n and a[ido][j] == '.':
ido += 1
while jup >= 0 and a[i][jup] == '.':
jup -= 1
while jdo < n and a[i][jdo] == '.':
jdo += 1
iup = max(iup + 1, i - k + 1)
ido = min(ido - 1, i + k - 1)
jup = max(jup + 1, j - k + 1)
jdo = min(jdo - 1, j + k - 1)
tmp = max((ido - iup + 1)-(k-1), 0) + max(0, (jdo - jup + 1) - (k-1))
if tmp > mx:
mx = tmp
I, J = i, j
print(I + 1, end=" ")
print(J + 1)
```
| 3
|
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,643,261,049
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 92
| 0
|
s = input()
ans = sorted(s)
ans = ans[::-1]
res = ""
if (ans.count(ans[0]) == 1):
print(ans[0])
else:
print(ans[0]*ans.count(ans[0]))
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
s = input()
ans = sorted(s)
ans = ans[::-1]
res = ""
if (ans.count(ans[0]) == 1):
print(ans[0])
else:
print(ans[0]*ans.count(ans[0]))
```
| 3
|
|
777
|
A
|
Shell Game
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball.
Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.).
Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator.
The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
|
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
|
[
"4\n2\n",
"1\n1\n"
] |
[
"1\n",
"0\n"
] |
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements.
1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
| 500
|
[
{
"input": "4\n2",
"output": "1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "2\n2",
"output": "0"
},
{
"input": "3\n1",
"output": "1"
},
{
"input": "3\n2",
"output": "0"
},
{
"input": "3\n0",
"output": "2"
},
{
"input": "2000000000\n0",
"output": "1"
},
{
"input": "2\n0",
"output": "1"
},
{
"input": "2\n1",
"output": "2"
},
{
"input": "4\n0",
"output": "2"
},
{
"input": "4\n1",
"output": "0"
},
{
"input": "5\n0",
"output": "0"
},
{
"input": "5\n1",
"output": "2"
},
{
"input": "5\n2",
"output": "1"
},
{
"input": "6\n0",
"output": "0"
},
{
"input": "6\n1",
"output": "1"
},
{
"input": "6\n2",
"output": "2"
},
{
"input": "7\n0",
"output": "1"
},
{
"input": "7\n1",
"output": "0"
},
{
"input": "7\n2",
"output": "2"
},
{
"input": "100000\n0",
"output": "2"
},
{
"input": "100000\n1",
"output": "0"
},
{
"input": "100000\n2",
"output": "1"
},
{
"input": "99999\n1",
"output": "1"
},
{
"input": "99998\n1",
"output": "2"
},
{
"input": "99997\n1",
"output": "0"
},
{
"input": "99996\n1",
"output": "1"
},
{
"input": "99995\n1",
"output": "2"
},
{
"input": "1999999995\n0",
"output": "2"
},
{
"input": "1999999995\n1",
"output": "1"
},
{
"input": "1999999995\n2",
"output": "0"
},
{
"input": "1999999996\n0",
"output": "2"
},
{
"input": "1999999996\n1",
"output": "0"
},
{
"input": "1999999996\n2",
"output": "1"
},
{
"input": "1999999997\n0",
"output": "0"
},
{
"input": "1999999997\n1",
"output": "2"
},
{
"input": "1999999997\n2",
"output": "1"
},
{
"input": "1999999998\n0",
"output": "0"
},
{
"input": "1999999998\n1",
"output": "1"
},
{
"input": "1999999998\n2",
"output": "2"
},
{
"input": "1999999999\n0",
"output": "1"
},
{
"input": "1999999999\n1",
"output": "0"
},
{
"input": "1999999999\n2",
"output": "2"
},
{
"input": "2000000000\n1",
"output": "2"
},
{
"input": "2000000000\n2",
"output": "0"
},
{
"input": "1234567890\n0",
"output": "0"
},
{
"input": "1234567890\n1",
"output": "1"
},
{
"input": "1234567890\n2",
"output": "2"
},
{
"input": "123456789\n0",
"output": "2"
},
{
"input": "123456789\n1",
"output": "1"
},
{
"input": "123456789\n2",
"output": "0"
},
{
"input": "123456790\n0",
"output": "2"
},
{
"input": "12\n2",
"output": "2"
},
{
"input": "32\n1",
"output": "2"
},
{
"input": "20\n2",
"output": "0"
},
{
"input": "10\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "76994383\n1",
"output": "0"
},
{
"input": "25\n2",
"output": "2"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "12\n0",
"output": "0"
},
{
"input": "150\n2",
"output": "2"
},
{
"input": "15\n0",
"output": "2"
},
{
"input": "21\n2",
"output": "0"
},
{
"input": "18\n2",
"output": "2"
},
{
"input": "8\n2",
"output": "0"
},
{
"input": "10\n0",
"output": "2"
},
{
"input": "16\n0",
"output": "2"
}
] | 1,603,552,171
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 68
| 187
| 0
|
l = '122100'
m = '001221'
r = '210012'
n = int(input())
b = input()
n = n%6-1
if l[n]==b:
print(0)
elif m[n]==b:
print(1)
elif r[n]==b:
print(2)
|
Title: Shell Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball.
Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.).
Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator.
The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
Output Specification:
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
Demo Input:
['4\n2\n', '1\n1\n']
Demo Output:
['1\n', '0\n']
Note:
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements.
1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
|
```python
l = '122100'
m = '001221'
r = '210012'
n = int(input())
b = input()
n = n%6-1
if l[n]==b:
print(0)
elif m[n]==b:
print(1)
elif r[n]==b:
print(2)
```
| 3
|
|
559
|
A
|
Gerald's Hexagon
|
PROGRAMMING
| 1,600
|
[
"brute force",
"geometry",
"math"
] | null | null |
Gerald got a very curious hexagon for his birthday. The boy found out that all the angles of the hexagon are equal to . Then he measured the length of its sides, and found that each of them is equal to an integer number of centimeters. There the properties of the hexagon ended and Gerald decided to draw on it.
He painted a few lines, parallel to the sides of the hexagon. The lines split the hexagon into regular triangles with sides of 1 centimeter. Now Gerald wonders how many triangles he has got. But there were so many of them that Gerald lost the track of his counting. Help the boy count the triangles.
|
The first and the single line of the input contains 6 space-separated integers *a*1,<=*a*2,<=*a*3,<=*a*4,<=*a*5 and *a*6 (1<=≤<=*a**i*<=≤<=1000) — the lengths of the sides of the hexagons in centimeters in the clockwise order. It is guaranteed that the hexagon with the indicated properties and the exactly such sides exists.
|
Print a single integer — the number of triangles with the sides of one 1 centimeter, into which the hexagon is split.
|
[
"1 1 1 1 1 1\n",
"1 2 1 2 1 2\n"
] |
[
"6\n",
"13\n"
] |
This is what Gerald's hexagon looks like in the first sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/84d193e27b02c38eb1eadc536602a2ec0b9f9519.png" style="max-width: 100.0%;max-height: 100.0%;"/>
And that's what it looks like in the second sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/e29076a96da8ca864654cc6195654d9bf07d31ce.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 500
|
[
{
"input": "1 1 1 1 1 1",
"output": "6"
},
{
"input": "1 2 1 2 1 2",
"output": "13"
},
{
"input": "2 4 5 3 3 6",
"output": "83"
},
{
"input": "45 19 48 18 46 21",
"output": "6099"
},
{
"input": "66 6 65 6 66 5",
"output": "5832"
},
{
"input": "7 5 4 8 4 5",
"output": "175"
},
{
"input": "3 2 1 4 1 2",
"output": "25"
},
{
"input": "7 1 7 3 5 3",
"output": "102"
},
{
"input": "9 2 9 3 8 3",
"output": "174"
},
{
"input": "1 6 1 5 2 5",
"output": "58"
},
{
"input": "41 64 48 61 44 68",
"output": "17488"
},
{
"input": "1 59 2 59 1 60",
"output": "3838"
},
{
"input": "30 36 36 32 34 38",
"output": "7052"
},
{
"input": "50 40 46 38 52 34",
"output": "11176"
},
{
"input": "4 60 4 60 4 60",
"output": "4576"
},
{
"input": "718 466 729 470 714 481",
"output": "2102808"
},
{
"input": "131 425 143 461 95 473",
"output": "441966"
},
{
"input": "125 7 128 8 124 11",
"output": "20215"
},
{
"input": "677 303 685 288 692 296",
"output": "1365807"
},
{
"input": "1 577 7 576 2 582",
"output": "342171"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "6000000"
},
{
"input": "1 1 1000 1 1 1000",
"output": "4002"
},
{
"input": "1000 1000 1 1000 1000 1",
"output": "2004000"
},
{
"input": "1000 1 1000 999 2 999",
"output": "2003997"
},
{
"input": "1 1000 1 1 1000 1",
"output": "4002"
},
{
"input": "888 888 888 887 889 887",
"output": "4729487"
}
] | 1,650,174,786
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 62
| 0
|
a = list(map(int, input().split(' ')))
x = (a[0] + a[1] + a[2])**2
y = a[0]**2 + a[2]**2 + a[4]**2
print(x - y)
|
Title: Gerald's Hexagon
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald got a very curious hexagon for his birthday. The boy found out that all the angles of the hexagon are equal to . Then he measured the length of its sides, and found that each of them is equal to an integer number of centimeters. There the properties of the hexagon ended and Gerald decided to draw on it.
He painted a few lines, parallel to the sides of the hexagon. The lines split the hexagon into regular triangles with sides of 1 centimeter. Now Gerald wonders how many triangles he has got. But there were so many of them that Gerald lost the track of his counting. Help the boy count the triangles.
Input Specification:
The first and the single line of the input contains 6 space-separated integers *a*1,<=*a*2,<=*a*3,<=*a*4,<=*a*5 and *a*6 (1<=≤<=*a**i*<=≤<=1000) — the lengths of the sides of the hexagons in centimeters in the clockwise order. It is guaranteed that the hexagon with the indicated properties and the exactly such sides exists.
Output Specification:
Print a single integer — the number of triangles with the sides of one 1 centimeter, into which the hexagon is split.
Demo Input:
['1 1 1 1 1 1\n', '1 2 1 2 1 2\n']
Demo Output:
['6\n', '13\n']
Note:
This is what Gerald's hexagon looks like in the first sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/84d193e27b02c38eb1eadc536602a2ec0b9f9519.png" style="max-width: 100.0%;max-height: 100.0%;"/>
And that's what it looks like in the second sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/e29076a96da8ca864654cc6195654d9bf07d31ce.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
a = list(map(int, input().split(' ')))
x = (a[0] + a[1] + a[2])**2
y = a[0]**2 + a[2]**2 + a[4]**2
print(x - y)
```
| 3
|
|
483
|
A
|
Counterexample
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math",
"number theory"
] | null | null |
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
|
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
|
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
|
[
"2 4\n",
"10 11\n",
"900000000000000009 900000000000000029\n"
] |
[
"2 3 4\n",
"-1\n",
"900000000000000009 900000000000000010 900000000000000021\n"
] |
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
| 500
|
[
{
"input": "2 4",
"output": "2 3 4"
},
{
"input": "10 11",
"output": "-1"
},
{
"input": "900000000000000009 900000000000000029",
"output": "900000000000000009 900000000000000010 900000000000000021"
},
{
"input": "640097987171091791 640097987171091835",
"output": "640097987171091792 640097987171091793 640097987171091794"
},
{
"input": "19534350415104721 19534350415104725",
"output": "19534350415104722 19534350415104723 19534350415104724"
},
{
"input": "933700505788726243 933700505788726280",
"output": "933700505788726244 933700505788726245 933700505788726246"
},
{
"input": "1 3",
"output": "-1"
},
{
"input": "1 4",
"output": "2 3 4"
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "266540997167959130 266540997167959164",
"output": "266540997167959130 266540997167959131 266540997167959132"
},
{
"input": "267367244641009850 267367244641009899",
"output": "267367244641009850 267367244641009851 267367244641009852"
},
{
"input": "268193483524125978 268193483524125993",
"output": "268193483524125978 268193483524125979 268193483524125980"
},
{
"input": "269019726702209402 269019726702209432",
"output": "269019726702209402 269019726702209403 269019726702209404"
},
{
"input": "269845965585325530 269845965585325576",
"output": "269845965585325530 269845965585325531 269845965585325532"
},
{
"input": "270672213058376250 270672213058376260",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492378",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608523",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691962",
"output": "273150934002691930 273150934002691931 273150934002691932"
},
{
"input": "996517375802030516 996517375802030524",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146694",
"output": "997343614685146644 997343614685146645 997343614685146646"
},
{
"input": "998169857863230068 998169857863230083",
"output": "998169857863230068 998169857863230069 998169857863230070"
},
{
"input": "998996101041313492 998996101041313522",
"output": "998996101041313492 998996101041313493 998996101041313494"
},
{
"input": "999822344219396916 999822344219396961",
"output": "999822344219396916 999822344219396917 999822344219396918"
},
{
"input": "648583102513043 648583102513053",
"output": "648583102513044 648583102513045 648583102513046"
},
{
"input": "266540997167959130 266540997167959131",
"output": "-1"
},
{
"input": "267367244641009850 267367244641009850",
"output": "-1"
},
{
"input": "268193483524125978 268193483524125979",
"output": "-1"
},
{
"input": "269019726702209402 269019726702209402",
"output": "-1"
},
{
"input": "269845965585325530 269845965585325530",
"output": "-1"
},
{
"input": "270672213058376250 270672213058376254",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492379",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608508",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691931",
"output": "-1"
},
{
"input": "996517375802030516 996517375802030518",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146644",
"output": "-1"
},
{
"input": "2147483647 2147483649",
"output": "-1"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "1 7",
"output": "2 3 4"
},
{
"input": "9 12",
"output": "9 11 12"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "11 13",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
}
] | 1,601,486,356
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 140
| 0
|
def main():
n, m = map(int, input().split())
if n % 2 == 1:
n += 1
if m - n < 2:
print(-1)
else:
print(n, n + 1, n + 2)
if __name__ == '__main__':
main()
|
Title: Counterexample
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
Input Specification:
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
Output Specification:
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
Demo Input:
['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n']
Demo Output:
['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n']
Note:
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
|
```python
def main():
n, m = map(int, input().split())
if n % 2 == 1:
n += 1
if m - n < 2:
print(-1)
else:
print(n, n + 1, n + 2)
if __name__ == '__main__':
main()
```
| 3
|
|
919
|
A
|
Supermarket
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
We often go to supermarkets to buy some fruits or vegetables, and on the tag there prints the price for a kilo. But in some supermarkets, when asked how much the items are, the clerk will say that $a$ yuan for $b$ kilos (You don't need to care about what "yuan" is), the same as $a/b$ yuan for a kilo.
Now imagine you'd like to buy $m$ kilos of apples. You've asked $n$ supermarkets and got the prices. Find the minimum cost for those apples.
You can assume that there are enough apples in all supermarkets.
|
The first line contains two positive integers $n$ and $m$ ($1 \leq n \leq 5\,000$, $1 \leq m \leq 100$), denoting that there are $n$ supermarkets and you want to buy $m$ kilos of apples.
The following $n$ lines describe the information of the supermarkets. Each line contains two positive integers $a, b$ ($1 \leq a, b \leq 100$), denoting that in this supermarket, you are supposed to pay $a$ yuan for $b$ kilos of apples.
|
The only line, denoting the minimum cost for $m$ kilos of apples. Please make sure that the absolute or relative error between your answer and the correct answer won't exceed $10^{-6}$.
Formally, let your answer be $x$, and the jury's answer be $y$. Your answer is considered correct if $\frac{|x - y|}{\max{(1, |y|)}} \le 10^{-6}$.
|
[
"3 5\n1 2\n3 4\n1 3\n",
"2 1\n99 100\n98 99\n"
] |
[
"1.66666667\n",
"0.98989899\n"
] |
In the first sample, you are supposed to buy $5$ kilos of apples in supermarket $3$. The cost is $5/3$ yuan.
In the second sample, you are supposed to buy $1$ kilo of apples in supermarket $2$. The cost is $98/99$ yuan.
| 500
|
[
{
"input": "3 5\n1 2\n3 4\n1 3",
"output": "1.66666667"
},
{
"input": "2 1\n99 100\n98 99",
"output": "0.98989899"
},
{
"input": "50 37\n78 49\n96 4\n86 62\n28 4\n19 2\n79 43\n79 92\n95 35\n33 60\n54 84\n90 25\n2 25\n53 21\n86 52\n72 25\n6 78\n41 46\n3 68\n42 89\n33 35\n57 43\n99 45\n1 82\n38 62\n11 50\n55 84\n1 97\n12 67\n51 96\n51 7\n1 100\n79 61\n66 54\n97 93\n52 75\n80 54\n98 73\n29 28\n73 96\n24 73\n3 25\n1 29\n43 50\n97 95\n54 64\n38 97\n68 16\n22 68\n25 91\n77 13",
"output": "0.37000000"
},
{
"input": "5 1\n5 100\n55 6\n53 27\n57 53\n62 24",
"output": "0.05000000"
},
{
"input": "10 7\n83 93\n90 2\n63 51\n51 97\n7 97\n25 78\n17 68\n30 10\n46 14\n22 28",
"output": "0.50515464"
},
{
"input": "1 100\n100 1",
"output": "10000.00000000"
},
{
"input": "1 1\n59 1",
"output": "59.00000000"
},
{
"input": "1 100\n1 100",
"output": "1.00000000"
},
{
"input": "1 100\n1 99",
"output": "1.01010101"
},
{
"input": "1 1\n100 1",
"output": "100.00000000"
},
{
"input": "15 100\n1 2\n3 4\n10 11\n12 13\n20 21\n28 29\n34 35\n42 43\n59 60\n61 62\n74 75\n89 90\n96 97\n98 99\n99 100",
"output": "50.00000000"
},
{
"input": "15 100\n3 2\n5 4\n12 11\n14 13\n22 21\n30 29\n36 35\n44 43\n61 60\n63 62\n76 75\n91 90\n98 97\n99 98\n100 99",
"output": "101.01010101"
},
{
"input": "1 1\n100 10",
"output": "10.00000000"
},
{
"input": "1 1\n100 3",
"output": "33.33333333"
},
{
"input": "1 100\n100 3",
"output": "3333.33333333"
},
{
"input": "1 100\n100 1",
"output": "10000.00000000"
},
{
"input": "7 8\n9 8\n5 1\n3 1\n6 2\n7 3\n2 1\n3 1",
"output": "9.00000000"
},
{
"input": "5 8\n9 8\n3 1\n2 1\n4 2\n13 5",
"output": "9.00000000"
},
{
"input": "2 1\n1 2\n2 10",
"output": "0.20000000"
},
{
"input": "2 1\n99 100\n95 95",
"output": "0.99000000"
},
{
"input": "1 5\n10 1",
"output": "50.00000000"
},
{
"input": "5 10\n9 1\n10 1\n11 1\n12 1\n13 1",
"output": "90.00000000"
},
{
"input": "1 100\n3 1",
"output": "300.00000000"
}
] | 1,630,835,876
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 77
| 6,758,400
|
N, M = map(int,input().split())
minCost = float('inf')
for i in range(N):
A, B = map(int,input().split())
minCost = min(M*A/B, minCost)
print(minCost)
|
Title: Supermarket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We often go to supermarkets to buy some fruits or vegetables, and on the tag there prints the price for a kilo. But in some supermarkets, when asked how much the items are, the clerk will say that $a$ yuan for $b$ kilos (You don't need to care about what "yuan" is), the same as $a/b$ yuan for a kilo.
Now imagine you'd like to buy $m$ kilos of apples. You've asked $n$ supermarkets and got the prices. Find the minimum cost for those apples.
You can assume that there are enough apples in all supermarkets.
Input Specification:
The first line contains two positive integers $n$ and $m$ ($1 \leq n \leq 5\,000$, $1 \leq m \leq 100$), denoting that there are $n$ supermarkets and you want to buy $m$ kilos of apples.
The following $n$ lines describe the information of the supermarkets. Each line contains two positive integers $a, b$ ($1 \leq a, b \leq 100$), denoting that in this supermarket, you are supposed to pay $a$ yuan for $b$ kilos of apples.
Output Specification:
The only line, denoting the minimum cost for $m$ kilos of apples. Please make sure that the absolute or relative error between your answer and the correct answer won't exceed $10^{-6}$.
Formally, let your answer be $x$, and the jury's answer be $y$. Your answer is considered correct if $\frac{|x - y|}{\max{(1, |y|)}} \le 10^{-6}$.
Demo Input:
['3 5\n1 2\n3 4\n1 3\n', '2 1\n99 100\n98 99\n']
Demo Output:
['1.66666667\n', '0.98989899\n']
Note:
In the first sample, you are supposed to buy $5$ kilos of apples in supermarket $3$. The cost is $5/3$ yuan.
In the second sample, you are supposed to buy $1$ kilo of apples in supermarket $2$. The cost is $98/99$ yuan.
|
```python
N, M = map(int,input().split())
minCost = float('inf')
for i in range(N):
A, B = map(int,input().split())
minCost = min(M*A/B, minCost)
print(minCost)
```
| 3
|
|
510
|
A
|
Fox And Snake
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead.
A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on.
Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#').
Consider sample tests in order to understand the snake pattern.
|
The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50).
*n* is an odd number.
|
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
|
[
"3 3\n",
"3 4\n",
"5 3\n",
"9 9\n"
] |
[
"###\n..#\n###\n",
"####\n...#\n####\n",
"###\n..#\n###\n#..\n###\n",
"#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n"
] |
none
| 500
|
[
{
"input": "3 3",
"output": "###\n..#\n###"
},
{
"input": "3 4",
"output": "####\n...#\n####"
},
{
"input": "5 3",
"output": "###\n..#\n###\n#..\n###"
},
{
"input": "9 9",
"output": "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########"
},
{
"input": "3 5",
"output": "#####\n....#\n#####"
},
{
"input": "3 6",
"output": "######\n.....#\n######"
},
{
"input": "7 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "7 4",
"output": "####\n...#\n####\n#...\n####\n...#\n####"
},
{
"input": "49 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "43 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "43 27",
"output": "###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n....................."
},
{
"input": "11 15",
"output": "###############\n..............#\n###############\n#..............\n###############\n..............#\n###############\n#..............\n###############\n..............#\n###############"
},
{
"input": "11 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "19 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "23 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "49 49",
"output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..."
},
{
"input": "33 43",
"output": "###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#.................."
},
{
"input": "33 44",
"output": "############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#......."
},
{
"input": "45 45",
"output": "#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#########################################..."
},
{
"input": "45 49",
"output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..."
},
{
"input": "45 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###"
},
{
"input": "45 4",
"output": "####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####"
},
{
"input": "5 4",
"output": "####\n...#\n####\n#...\n####"
},
{
"input": "5 5",
"output": "#####\n....#\n#####\n#....\n#####"
},
{
"input": "5 6",
"output": "######\n.....#\n######\n#.....\n######"
},
{
"input": "7 5",
"output": "#####\n....#\n#####\n#....\n#####\n....#\n#####"
},
{
"input": "7 6",
"output": "######\n.....#\n######\n#.....\n######\n.....#\n######"
},
{
"input": "7 7",
"output": "#######\n......#\n#######\n#......\n#######\n......#\n#######"
}
] | 1,695,555,957
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 46
| 0
|
height,length=map(int,input().split())
side=1
for i in range(height):
if i%2==0:
print('#'*length)
elif side:
print('.'*(length-1),'#',sep='')
side=0
else:
print('#','.'*(length-1),sep='')
side=1
|
Title: Fox And Snake
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead.
A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on.
Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#').
Consider sample tests in order to understand the snake pattern.
Input Specification:
The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50).
*n* is an odd number.
Output Specification:
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
Demo Input:
['3 3\n', '3 4\n', '5 3\n', '9 9\n']
Demo Output:
['###\n..#\n###\n', '####\n...#\n####\n', '###\n..#\n###\n#..\n###\n', '#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n']
Note:
none
|
```python
height,length=map(int,input().split())
side=1
for i in range(height):
if i%2==0:
print('#'*length)
elif side:
print('.'*(length-1),'#',sep='')
side=0
else:
print('#','.'*(length-1),sep='')
side=1
```
| 3
|
|
447
|
A
|
DZY Loves Hash
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*.
However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1.
|
The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109).
|
Output a single integer — the answer to the problem.
|
[
"10 5\n0\n21\n53\n41\n53\n",
"5 5\n0\n1\n2\n3\n4\n"
] |
[
"4\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "10 5\n0\n21\n53\n41\n53",
"output": "4"
},
{
"input": "5 5\n0\n1\n2\n3\n4",
"output": "-1"
},
{
"input": "10 6\n811966798\n734823552\n790326404\n929189974\n414343256\n560346537",
"output": "4"
},
{
"input": "2 2\n788371161\n801743052",
"output": "-1"
},
{
"input": "10 6\n812796223\n122860157\n199259103\n597650585\n447742024\n521549402",
"output": "3"
},
{
"input": "300 2\n822454942\n119374431",
"output": "-1"
},
{
"input": "300 2\n823284367\n507345500",
"output": "-1"
},
{
"input": "2 5\n791579811\n35613889\n997079893\n878677665\n693717467",
"output": "2"
},
{
"input": "20 5\n793926268\n28931770\n842870287\n974950617\n859404206",
"output": "-1"
},
{
"input": "100 15\n805069249\n778178198\n633897389\n844316223\n146759898\n870527016\n82668754\n42060733\n943602929\n979451110\n746979598\n47406033\n607284062\n850870259\n229415316",
"output": "5"
},
{
"input": "100 15\n806204335\n189490323\n718805086\n716787474\n262315718\n822030596\n894644222\n724054623\n141384399\n579354205\n192622443\n672556242\n97417563\n243354557\n208957882",
"output": "8"
},
{
"input": "100 15\n807033760\n577461392\n275221433\n532633429\n295714486\n783298996\n255799943\n99107143\n729119412\n59302896\n37640015\n313610861\n630550567\n534283052\n681062462",
"output": "8"
},
{
"input": "100 15\n808103310\n136224397\n360129131\n405104681\n263786657\n734802577\n67808179\n928584682\n926900882\n511722343\n483348395\n938695534\n120684068\n74152694\n808088675",
"output": "9"
},
{
"input": "2 2\n2\n2",
"output": "2"
},
{
"input": "300 2\n0\n300",
"output": "2"
},
{
"input": "2 2\n0\n0",
"output": "2"
}
] | 1,685,466,131
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 29
| 46
| 0
|
s = set()
p, n = map(int, input().split())
for k in range(n):
buc = int(input()) % p
if buc in s:
print(k+1)
break
else:
s.add(buc)
else:
print(-1)
|
Title: DZY Loves Hash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*.
However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1.
Input Specification:
The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109).
Output Specification:
Output a single integer — the answer to the problem.
Demo Input:
['10 5\n0\n21\n53\n41\n53\n', '5 5\n0\n1\n2\n3\n4\n']
Demo Output:
['4\n', '-1\n']
Note:
none
|
```python
s = set()
p, n = map(int, input().split())
for k in range(n):
buc = int(input()) % p
if buc in s:
print(k+1)
break
else:
s.add(buc)
else:
print(-1)
```
| 3
|
|
134
|
A
|
Average Numbers
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
You are given a sequence of positive integers *a*1,<=*a*2,<=...,<=*a**n*. Find all such indices *i*, that the *i*-th element equals the arithmetic mean of all other elements (that is all elements except for this one).
|
The first line contains the integer *n* (2<=≤<=*n*<=≤<=2·105). The second line contains elements of the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). All the elements are positive integers.
|
Print on the first line the number of the sought indices. Print on the second line the sought indices in the increasing order. All indices are integers from 1 to *n*.
If the sought elements do not exist, then the first output line should contain number 0. In this case you may either not print the second line or print an empty line.
|
[
"5\n1 2 3 4 5\n",
"4\n50 50 50 50\n"
] |
[
"1\n3 ",
"4\n1 2 3 4 "
] |
none
| 500
|
[
{
"input": "5\n1 2 3 4 5",
"output": "1\n3 "
},
{
"input": "4\n50 50 50 50",
"output": "4\n1 2 3 4 "
},
{
"input": "3\n2 3 1",
"output": "1\n1 "
},
{
"input": "2\n4 2",
"output": "0"
},
{
"input": "2\n1 1",
"output": "2\n1 2 "
},
{
"input": "10\n3 3 3 3 3 4 3 3 3 2",
"output": "8\n1 2 3 4 5 7 8 9 "
},
{
"input": "10\n15 7 10 7 7 7 4 4 7 2",
"output": "5\n2 4 5 6 9 "
},
{
"input": "6\n2 2 2 2 2 2",
"output": "6\n1 2 3 4 5 6 "
},
{
"input": "6\n3 3 3 3 3 3",
"output": "6\n1 2 3 4 5 6 "
},
{
"input": "4\n6 6 6 7",
"output": "0"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "3\n3 3 4",
"output": "0"
},
{
"input": "5\n7 6 6 6 6",
"output": "0"
},
{
"input": "4\n3 5 5 9",
"output": "0"
},
{
"input": "3\n99 100 99",
"output": "0"
},
{
"input": "4\n5 6 5 5",
"output": "0"
},
{
"input": "6\n1 1 2 1 1 1",
"output": "0"
},
{
"input": "2\n4 5",
"output": "0"
},
{
"input": "4\n1 1 1 2",
"output": "0"
},
{
"input": "3\n1 2 4",
"output": "0"
},
{
"input": "6\n1 1 2 3 3 3",
"output": "0"
},
{
"input": "4\n4 5 5 4",
"output": "0"
},
{
"input": "3\n2 3 5",
"output": "0"
},
{
"input": "3\n2 1 1",
"output": "0"
},
{
"input": "3\n1 1 2",
"output": "0"
},
{
"input": "4\n1 2 3 4",
"output": "0"
},
{
"input": "5\n1 2 3 4 6",
"output": "0"
},
{
"input": "3\n2 2 3",
"output": "0"
},
{
"input": "4\n3 4 5 1",
"output": "0"
},
{
"input": "3\n2 3 2",
"output": "0"
},
{
"input": "3\n3 4 4",
"output": "0"
},
{
"input": "3\n10 5 7",
"output": "0"
},
{
"input": "3\n5 6 5",
"output": "0"
},
{
"input": "4\n1 2 3 7",
"output": "0"
},
{
"input": "5\n2 2 3 3 3",
"output": "0"
},
{
"input": "3\n4 3 6",
"output": "0"
},
{
"input": "3\n1 1 3",
"output": "0"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 "
}
] | 1,459,305,575
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 233
| 24,268,800
|
n, t = int(input()), list(map(int, input().split()))
s = sum(t)
temp = [i + 1 for i in range(n) if t[i] * n == s]
print(len(temp))
print(' '.join(map(str, temp)))
|
Title: Average Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence of positive integers *a*1,<=*a*2,<=...,<=*a**n*. Find all such indices *i*, that the *i*-th element equals the arithmetic mean of all other elements (that is all elements except for this one).
Input Specification:
The first line contains the integer *n* (2<=≤<=*n*<=≤<=2·105). The second line contains elements of the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). All the elements are positive integers.
Output Specification:
Print on the first line the number of the sought indices. Print on the second line the sought indices in the increasing order. All indices are integers from 1 to *n*.
If the sought elements do not exist, then the first output line should contain number 0. In this case you may either not print the second line or print an empty line.
Demo Input:
['5\n1 2 3 4 5\n', '4\n50 50 50 50\n']
Demo Output:
['1\n3 ', '4\n1 2 3 4 ']
Note:
none
|
```python
n, t = int(input()), list(map(int, input().split()))
s = sum(t)
temp = [i + 1 for i in range(n) if t[i] * n == s]
print(len(temp))
print(' '.join(map(str, temp)))
```
| 3
|
|
78
|
A
|
Haiku
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Haiku
|
2
|
256
|
Haiku is a genre of Japanese traditional poetry.
A haiku poem consists of 17 syllables split into three phrases, containing 5, 7 and 5 syllables correspondingly (the first phrase should contain exactly 5 syllables, the second phrase should contain exactly 7 syllables, and the third phrase should contain exactly 5 syllables). A haiku masterpiece contains a description of a moment in those three phrases. Every word is important in a small poem, which is why haiku are rich with symbols. Each word has a special meaning, a special role. The main principle of haiku is to say much using a few words.
To simplify the matter, in the given problem we will consider that the number of syllable in the phrase is equal to the number of vowel letters there. Only the following letters are regarded as vowel letters: "a", "e", "i", "o" and "u".
Three phases from a certain poem are given. Determine whether it is haiku or not.
|
The input data consists of three lines. The length of each line is between 1 and 100, inclusive. The *i*-th line contains the *i*-th phrase of the poem. Each phrase consists of one or more words, which are separated by one or more spaces. A word is a non-empty sequence of lowercase Latin letters. Leading and/or trailing spaces in phrases are allowed. Every phrase has at least one non-space character. See the example for clarification.
|
Print "YES" (without the quotes) if the poem is a haiku. Otherwise, print "NO" (also without the quotes).
|
[
"on codeforces \nbeta round is running\n a rustling of keys \n",
"how many gallons\nof edo s rain did you drink\n cuckoo\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "on codeforces \nbeta round is running\n a rustling of keys ",
"output": "YES"
},
{
"input": "how many gallons\nof edo s rain did you drink\n cuckoo",
"output": "NO"
},
{
"input": " hatsu shigure\n saru mo komino wo\nhoshige nari",
"output": "YES"
},
{
"input": "o vetus stagnum\n rana de ripa salit\n ac sonant aquae",
"output": "NO"
},
{
"input": " furuike ya\nkawazu tobikomu\nmizu no oto ",
"output": "YES"
},
{
"input": " noch da leich\na stamperl zum aufwaerma\n da pfarrer kimmt a ",
"output": "NO"
},
{
"input": " sommerfuglene \n hvorfor bruge mange ord\n et kan gore det",
"output": "YES"
},
{
"input": " ab der mittagszeit\n ist es etwas schattiger\n ein wolkenhimmel",
"output": "NO"
},
{
"input": "tornando a vederli\ni fiori di ciliegio la sera\nson divenuti frutti",
"output": "NO"
},
{
"input": "kutaburete\nyado karu koro ya\nfuji no hana",
"output": "YES"
},
{
"input": " beginnings of poetry\n the rice planting songs \n of the interior",
"output": "NO"
},
{
"input": " door zomerregens\n zijn de kraanvogelpoten\n korter geworden",
"output": "NO"
},
{
"input": " derevo na srub\na ptitsi bezzabotno\n gnezdishko tam vyut",
"output": "YES"
},
{
"input": "writing in the dark\nunaware that my pen\nhas run out of ink",
"output": "NO"
},
{
"input": "kusaaiu\nuieueua\nuo efaa",
"output": "YES"
},
{
"input": "v\nh\np",
"output": "NO"
},
{
"input": "i\ni\nu",
"output": "NO"
},
{
"input": "awmio eoj\nabdoolceegood\nwaadeuoy",
"output": "YES"
},
{
"input": "xzpnhhnqsjpxdboqojixmofawhdjcfbscq\nfoparnxnbzbveycoltwdrfbwwsuobyoz hfbrszy\nimtqryscsahrxpic agfjh wvpmczjjdrnwj mcggxcdo",
"output": "YES"
},
{
"input": "wxjcvccp cppwsjpzbd dhizbcnnllckybrnfyamhgkvkjtxxfzzzuyczmhedhztugpbgpvgh\nmdewztdoycbpxtp bsiw hknggnggykdkrlihvsaykzfiiw\ndewdztnngpsnn lfwfbvnwwmxoojknygqb hfe ibsrxsxr",
"output": "YES"
},
{
"input": "nbmtgyyfuxdvrhuhuhpcfywzrbclp znvxw synxmzymyxcntmhrjriqgdjh xkjckydbzjbvtjurnf\nhhnhxdknvamywhsrkprofnyzlcgtdyzzjdsfxyddvilnzjziz qmwfdvzckgcbrrxplxnxf mpxwxyrpesnewjrx ajxlfj\nvcczq hddzd cvefmhxwxxyqcwkr fdsndckmesqeq zyjbwbnbyhybd cta nsxzidl jpcvtzkldwd",
"output": "YES"
},
{
"input": "rvwdsgdsrutgjwscxz pkd qtpmfbqsmctuevxdj kjzknzghdvxzlaljcntg jxhvzn yciktbsbyscfypx x xhkxnfpdp\nwdfhvqgxbcts mnrwbr iqttsvigwdgvlxwhsmnyxnttedonxcfrtmdjjmacvqtkbmsnwwvvrlxwvtggeowtgsqld qj\nvsxcdhbzktrxbywpdvstr meykarwtkbm pkkbhvwvelclfmpngzxdmblhcvf qmabmweldplmczgbqgzbqnhvcdpnpjtch ",
"output": "YES"
},
{
"input": "brydyfsmtzzkpdsqvvztmprhqzbzqvgsblnz naait tdtiprjsttwusdykndwcccxfmzmrmfmzjywkpgbfnjpypgcbcfpsyfj k\nucwdfkfyxxxht lxvnovqnnsqutjsyagrplb jhvtwdptrwcqrovncdvqljjlrpxcfbxqgsfylbgmcjpvpl ccbcybmigpmjrxpu\nfgwtpcjeywgnxgbttgx htntpbk tkkpwbgxwtbxvcpkqbzetjdkcwad tftnjdxxjdvbpfibvxuglvx llyhgjvggtw jtjyphs",
"output": "YES"
},
{
"input": "nyc aqgqzjjlj mswgmjfcxlqdscheskchlzljlsbhyn iobxymwzykrsnljj\nnnebeaoiraga\nqpjximoqzswhyyszhzzrhfwhf iyxysdtcpmikkwpugwlxlhqfkn",
"output": "NO"
},
{
"input": "lzrkztgfe mlcnq ay ydmdzxh cdgcghxnkdgmgfzgahdjjmqkpdbskreswpnblnrc fmkwziiqrbskp\np oukeaz gvvy kghtrjlczyl qeqhgfgfej\nwfolhkmktvsjnrpzfxcxzqmfidtlzmuhxac wsncjgmkckrywvxmnjdpjpfydhk qlmdwphcvyngansqhl",
"output": "NO"
},
{
"input": "yxcboqmpwoevrdhvpxfzqmammak\njmhphkxppkqkszhqqtkvflarsxzla pbxlnnnafqbsnmznfj qmhoktgzix qpmrgzxqvmjxhskkksrtryehfnmrt dtzcvnvwp\nscwymuecjxhw rdgsffqywwhjpjbfcvcrnisfqllnbplpadfklayjguyvtrzhwblftclfmsr",
"output": "NO"
},
{
"input": "qfdwsr jsbrpfmn znplcx nhlselflytndzmgxqpgwhpi ghvbbxrkjdirfghcybhkkqdzmyacvrrcgsneyjlgzfvdmxyjmph\nylxlyrzs drbktzsniwcbahjkgohcghoaczsmtzhuwdryjwdijmxkmbmxv yyfrokdnsx\nyw xtwyzqlfxwxghugoyscqlx pljtz aldfskvxlsxqgbihzndhxkswkxqpwnfcxzfyvncstfpqf",
"output": "NO"
},
{
"input": "g rguhqhcrzmuqthtmwzhfyhpmqzzosa\nmhjimzvchkhejh irvzejhtjgaujkqfxhpdqjnxr dvqallgssktqvsxi\npcwbliftjcvuzrsqiswohi",
"output": "NO"
},
{
"input": " ngxtlq iehiise vgffqcpnmsoqzyseuqqtggokymol zn\nvjdjljazeujwoubkcvtsbepooxqzrueaauokhepiquuopfild\ngoabauauaeotoieufueeknudiilupouaiaexcoapapu",
"output": "NO"
},
{
"input": "ycnvnnqk mhrmhctpkfbc qbyvtjznmndqjzgbcxmvrpkfcll zwspfptmbxgrdv dsgkk nfytsqjrnfbhh pzdldzymvkdxxwh\nvnhjfwgdnyjptsmblyxmpzylsbjlmtkkwjcbqwjctqvrlqqkdsrktxlnslspvnn mdgsmzblhbnvpczmqkcffwhwljqkzmk hxcm\nrghnjvzcpprrgmtgytpkzyc mrdnnhpkwypwqbtzjyfwvrdwyjltbzxtbstzs xdjzdmx yjsqtzlrnvyssvglsdjrmsrfrcdpqt",
"output": "NO"
},
{
"input": "ioeeaioeiuoeaeieuuieooaouiuouiioaueeaiaiuoaoiioeeaauooiuuieeuaeeoauieeaiuoieiaieuoauaaoioooieueueuai\nuooaoeeaoiuuoeioaoouaououoeioiaeueoioaiouaeaoioiuuaueeuaiuoiueoiuaoeeieeouaeeaeeieioeoiiieuuueuuieuo\naeeouieeieoueaioeoioooiouaeeeiaaioueauaueiouuuaieuuioiaeiueauueaoieauauoeueuaiueuuaueeoueauaeaoieeoo",
"output": "NO"
},
{
"input": "mkgycgmrqtmlwj vddlbsgdptyfrcj nmrddjchydvbsyhgzytfzvwbhqmmhkpsyrcnknpsqrr wcnf wfvgskrnsmnrcqgcnc q\npn cclcyjjdp rqkpgyrvyyd hhynrochfa pthyffqvskazfshvzcmvhmsrxvquzkdvivlbfypwbgltfbjmhzljvgzmxjlrjdjq\nauuouieuaaauoooeoiuoaueuueauiuuuiaeuwuoiaeoeaieauieouoaeiiieiioiuuuiuauioiiuoeauueieaueiaioeuaoaaau",
"output": "NO"
},
{
"input": "ab\na\na",
"output": "NO"
},
{
"input": "on codeforcs\nbeta round is runnineg\na rustling of keys",
"output": "NO"
},
{
"input": "coooooooooooooooood\nd\nd",
"output": "NO"
},
{
"input": "on codeforces \nbeta round is runninog\n a rustling of keys",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaa\na\na",
"output": "NO"
},
{
"input": "aaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\naaaaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\naaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc",
"output": "YES"
},
{
"input": "cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\ncccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\ncccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc",
"output": "NO"
},
{
"input": "aaaaaa\naaaaaa\naaaaa",
"output": "NO"
}
] | 1,636,364,049
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 4,505,600
|
def countVowel(s):
res=0
for i in s:
if i in ('a','e','i','o','u'):
res+=1
return res
s1=input()
s2=input()
s3=input()
if countVowel(s1)==5 and countVowel(s2)==7 and countVowel(s3)==5:
print('YES')
else:
print('NO')
|
Title: Haiku
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Haiku is a genre of Japanese traditional poetry.
A haiku poem consists of 17 syllables split into three phrases, containing 5, 7 and 5 syllables correspondingly (the first phrase should contain exactly 5 syllables, the second phrase should contain exactly 7 syllables, and the third phrase should contain exactly 5 syllables). A haiku masterpiece contains a description of a moment in those three phrases. Every word is important in a small poem, which is why haiku are rich with symbols. Each word has a special meaning, a special role. The main principle of haiku is to say much using a few words.
To simplify the matter, in the given problem we will consider that the number of syllable in the phrase is equal to the number of vowel letters there. Only the following letters are regarded as vowel letters: "a", "e", "i", "o" and "u".
Three phases from a certain poem are given. Determine whether it is haiku or not.
Input Specification:
The input data consists of three lines. The length of each line is between 1 and 100, inclusive. The *i*-th line contains the *i*-th phrase of the poem. Each phrase consists of one or more words, which are separated by one or more spaces. A word is a non-empty sequence of lowercase Latin letters. Leading and/or trailing spaces in phrases are allowed. Every phrase has at least one non-space character. See the example for clarification.
Output Specification:
Print "YES" (without the quotes) if the poem is a haiku. Otherwise, print "NO" (also without the quotes).
Demo Input:
['on codeforces \nbeta round is running\n a rustling of keys \n', 'how many gallons\nof edo s rain did you drink\n cuckoo\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
def countVowel(s):
res=0
for i in s:
if i in ('a','e','i','o','u'):
res+=1
return res
s1=input()
s2=input()
s3=input()
if countVowel(s1)==5 and countVowel(s2)==7 and countVowel(s3)==5:
print('YES')
else:
print('NO')
```
| 3.968608
|
337
|
A
|
Puzzles
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
|
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
|
Print a single integer — the least possible difference the teacher can obtain.
|
[
"4 6\n10 12 10 7 5 22\n"
] |
[
"5\n"
] |
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
| 500
|
[
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,669,833,719
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 92
| 0
|
def intmaker(list1):
for i in range(len(list1)):
list1[i]=int(list1[i])
return list1
nm=input().split(' ')
n,m=intmaker(nm)
list_puzzle=input().split(' ')
puzzle=intmaker(list_puzzle)
puzzle=sorted(puzzle)
min=puzzle[n-1]-puzzle[0]
for i in range(1,(m-n)+1,1):
if puzzle[i+n-1] - puzzle[i] < min:
min = puzzle[i+n-1] - puzzle[i]
print(min)
|
Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
|
```python
def intmaker(list1):
for i in range(len(list1)):
list1[i]=int(list1[i])
return list1
nm=input().split(' ')
n,m=intmaker(nm)
list_puzzle=input().split(' ')
puzzle=intmaker(list_puzzle)
puzzle=sorted(puzzle)
min=puzzle[n-1]-puzzle[0]
for i in range(1,(m-n)+1,1):
if puzzle[i+n-1] - puzzle[i] < min:
min = puzzle[i+n-1] - puzzle[i]
print(min)
```
| 3
|
|
841
|
A
|
Generous Kefa
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends.
Next line contains string *s* — colors of baloons.
|
Answer to the task — «YES» or «NO» in a single line.
You can choose the case (lower or upper) for each letter arbitrary.
|
[
"4 2\naabb\n",
"6 3\naacaab\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second.
In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
| 500
|
[
{
"input": "4 2\naabb",
"output": "YES"
},
{
"input": "6 3\naacaab",
"output": "NO"
},
{
"input": "2 2\nlu",
"output": "YES"
},
{
"input": "5 3\novvoo",
"output": "YES"
},
{
"input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf",
"output": "YES"
},
{
"input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv",
"output": "NO"
},
{
"input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "YES"
},
{
"input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod",
"output": "NO"
},
{
"input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl",
"output": "YES"
},
{
"input": "18 6\njzwtnkvmscqhmdlsxy",
"output": "YES"
},
{
"input": "21 2\nfscegcqgzesefghhwcexs",
"output": "NO"
},
{
"input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc",
"output": "YES"
},
{
"input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd",
"output": "YES"
},
{
"input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv",
"output": "YES"
},
{
"input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul",
"output": "YES"
},
{
"input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii",
"output": "NO"
},
{
"input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq",
"output": "YES"
},
{
"input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb",
"output": "YES"
},
{
"input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc",
"output": "YES"
},
{
"input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab",
"output": "YES"
},
{
"input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia",
"output": "NO"
},
{
"input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf",
"output": "YES"
},
{
"input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb",
"output": "YES"
},
{
"input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa",
"output": "NO"
},
{
"input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo",
"output": "YES"
},
{
"input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib",
"output": "YES"
},
{
"input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf",
"output": "YES"
},
{
"input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci",
"output": "YES"
},
{
"input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn",
"output": "YES"
},
{
"input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev",
"output": "YES"
},
{
"input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss",
"output": "YES"
},
{
"input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs",
"output": "NO"
},
{
"input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc",
"output": "NO"
},
{
"input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi",
"output": "NO"
},
{
"input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah",
"output": "NO"
},
{
"input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka",
"output": "YES"
},
{
"input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq",
"output": "YES"
},
{
"input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb",
"output": "YES"
},
{
"input": "14 5\nfssmmsfffmfmmm",
"output": "NO"
},
{
"input": "2 1\nff",
"output": "NO"
},
{
"input": "2 1\nhw",
"output": "YES"
},
{
"input": "2 2\nss",
"output": "YES"
},
{
"input": "1 1\nl",
"output": "YES"
},
{
"input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp",
"output": "YES"
},
{
"input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj",
"output": "YES"
},
{
"input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj",
"output": "YES"
},
{
"input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "YES"
},
{
"input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq",
"output": "YES"
},
{
"input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt",
"output": "YES"
},
{
"input": "1 2\na",
"output": "YES"
},
{
"input": "3 1\nabb",
"output": "NO"
},
{
"input": "2 1\naa",
"output": "NO"
},
{
"input": "2 1\nab",
"output": "YES"
},
{
"input": "6 2\naaaaaa",
"output": "NO"
},
{
"input": "8 4\naaaaaaaa",
"output": "NO"
},
{
"input": "4 2\naaaa",
"output": "NO"
},
{
"input": "4 3\naaaa",
"output": "NO"
},
{
"input": "1 3\na",
"output": "YES"
},
{
"input": "4 3\nzzzz",
"output": "NO"
},
{
"input": "4 1\naaaa",
"output": "NO"
},
{
"input": "3 4\nabc",
"output": "YES"
},
{
"input": "2 5\nab",
"output": "YES"
},
{
"input": "2 4\nab",
"output": "YES"
},
{
"input": "1 10\na",
"output": "YES"
},
{
"input": "5 2\nzzzzz",
"output": "NO"
},
{
"input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO"
},
{
"input": "4 1\nabab",
"output": "NO"
},
{
"input": "4 1\nabcb",
"output": "NO"
},
{
"input": "4 2\nabbb",
"output": "NO"
},
{
"input": "5 2\nabccc",
"output": "NO"
},
{
"input": "2 3\nab",
"output": "YES"
},
{
"input": "4 3\nbbbs",
"output": "YES"
},
{
"input": "10 2\nazzzzzzzzz",
"output": "NO"
},
{
"input": "1 2\nb",
"output": "YES"
},
{
"input": "1 3\nb",
"output": "YES"
},
{
"input": "4 5\nabcd",
"output": "YES"
},
{
"input": "4 6\naabb",
"output": "YES"
},
{
"input": "5 2\naaaab",
"output": "NO"
},
{
"input": "3 5\naaa",
"output": "YES"
},
{
"input": "5 3\nazzzz",
"output": "NO"
},
{
"input": "4 100\naabb",
"output": "YES"
},
{
"input": "3 10\naaa",
"output": "YES"
},
{
"input": "3 4\naaa",
"output": "YES"
},
{
"input": "12 5\naaaaabbbbbbb",
"output": "NO"
},
{
"input": "5 2\naabbb",
"output": "NO"
},
{
"input": "10 5\nzzzzzzzzzz",
"output": "NO"
},
{
"input": "2 4\naa",
"output": "YES"
},
{
"input": "1 5\na",
"output": "YES"
},
{
"input": "10 5\naaaaaaaaaa",
"output": "NO"
},
{
"input": "6 3\naaaaaa",
"output": "NO"
},
{
"input": "7 1\nabcdeee",
"output": "NO"
},
{
"input": "18 3\naaaaaabbbbbbcccccc",
"output": "NO"
},
{
"input": "8 2\naabbccdd",
"output": "YES"
},
{
"input": "4 2\nzzzz",
"output": "NO"
},
{
"input": "4 2\nabaa",
"output": "NO"
},
{
"input": "3 2\naaa",
"output": "NO"
},
{
"input": "3 1\nzzz",
"output": "NO"
},
{
"input": "5 4\nzzzzz",
"output": "NO"
},
{
"input": "6 2\naabbbc",
"output": "NO"
},
{
"input": "3 6\naaa",
"output": "YES"
},
{
"input": "2 1\nzz",
"output": "NO"
},
{
"input": "10 3\naaaeeeeeee",
"output": "NO"
},
{
"input": "4 5\naabb",
"output": "YES"
},
{
"input": "3 1\naaa",
"output": "NO"
},
{
"input": "5 2\naazzz",
"output": "NO"
},
{
"input": "6 2\nabbbbc",
"output": "NO"
},
{
"input": "4 2\nxxxx",
"output": "NO"
},
{
"input": "6 3\nzzzzzz",
"output": "NO"
},
{
"input": "3 2\nabb",
"output": "YES"
},
{
"input": "3 2\nzzz",
"output": "NO"
},
{
"input": "6 5\nzzzzzz",
"output": "NO"
},
{
"input": "6 3\nbcaaaa",
"output": "NO"
},
{
"input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "YES"
},
{
"input": "3 6\nabc",
"output": "YES"
}
] | 1,586,479,933
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 114
| 124
| 0
|
ballons, friends = map(int, input().split())
color = input()
lencolor = len(color)
x = 0
count = [0] * 26 # букв всего 26б значит и индекс не мсжет быть болше 26
# tkcb кол-во одного цвета больше чем друзейб кто-то получит два одного цвета
for i in color:
nomer = ord(i) - 97
count[nomer] += 1 # индексы плюсуются
for i in range(26):
if count[i] > friends:
# print(chr(i + 97), count[i])
# elif count[i] > friends:
x += 1
if x > 0:
print('NO')
else:
print('YES')
|
Title: Generous Kefa
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends.
Next line contains string *s* — colors of baloons.
Output Specification:
Answer to the task — «YES» or «NO» in a single line.
You can choose the case (lower or upper) for each letter arbitrary.
Demo Input:
['4 2\naabb\n', '6 3\naacaab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second.
In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
|
```python
ballons, friends = map(int, input().split())
color = input()
lencolor = len(color)
x = 0
count = [0] * 26 # букв всего 26б значит и индекс не мсжет быть болше 26
# tkcb кол-во одного цвета больше чем друзейб кто-то получит два одного цвета
for i in color:
nomer = ord(i) - 97
count[nomer] += 1 # индексы плюсуются
for i in range(26):
if count[i] > friends:
# print(chr(i + 97), count[i])
# elif count[i] > friends:
x += 1
if x > 0:
print('NO')
else:
print('YES')
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,620,226,393
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
s = input()
low = 0
up = 0
for i in range(0, len(s)):
if s[i].islower():
low += 1
elif s[i].isupper():
up += 1
if low < up:
s = s.upper()
elif low > up:
s = s.lower()
elif low == up:
s = s.lower()
print(s)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s = input()
low = 0
up = 0
for i in range(0, len(s)):
if s[i].islower():
low += 1
elif s[i].isupper():
up += 1
if low < up:
s = s.upper()
elif low > up:
s = s.lower()
elif low == up:
s = s.lower()
print(s)
```
| 3.969
|
777
|
A
|
Shell Game
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball.
Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.).
Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator.
The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
|
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
|
[
"4\n2\n",
"1\n1\n"
] |
[
"1\n",
"0\n"
] |
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements.
1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
| 500
|
[
{
"input": "4\n2",
"output": "1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "2\n2",
"output": "0"
},
{
"input": "3\n1",
"output": "1"
},
{
"input": "3\n2",
"output": "0"
},
{
"input": "3\n0",
"output": "2"
},
{
"input": "2000000000\n0",
"output": "1"
},
{
"input": "2\n0",
"output": "1"
},
{
"input": "2\n1",
"output": "2"
},
{
"input": "4\n0",
"output": "2"
},
{
"input": "4\n1",
"output": "0"
},
{
"input": "5\n0",
"output": "0"
},
{
"input": "5\n1",
"output": "2"
},
{
"input": "5\n2",
"output": "1"
},
{
"input": "6\n0",
"output": "0"
},
{
"input": "6\n1",
"output": "1"
},
{
"input": "6\n2",
"output": "2"
},
{
"input": "7\n0",
"output": "1"
},
{
"input": "7\n1",
"output": "0"
},
{
"input": "7\n2",
"output": "2"
},
{
"input": "100000\n0",
"output": "2"
},
{
"input": "100000\n1",
"output": "0"
},
{
"input": "100000\n2",
"output": "1"
},
{
"input": "99999\n1",
"output": "1"
},
{
"input": "99998\n1",
"output": "2"
},
{
"input": "99997\n1",
"output": "0"
},
{
"input": "99996\n1",
"output": "1"
},
{
"input": "99995\n1",
"output": "2"
},
{
"input": "1999999995\n0",
"output": "2"
},
{
"input": "1999999995\n1",
"output": "1"
},
{
"input": "1999999995\n2",
"output": "0"
},
{
"input": "1999999996\n0",
"output": "2"
},
{
"input": "1999999996\n1",
"output": "0"
},
{
"input": "1999999996\n2",
"output": "1"
},
{
"input": "1999999997\n0",
"output": "0"
},
{
"input": "1999999997\n1",
"output": "2"
},
{
"input": "1999999997\n2",
"output": "1"
},
{
"input": "1999999998\n0",
"output": "0"
},
{
"input": "1999999998\n1",
"output": "1"
},
{
"input": "1999999998\n2",
"output": "2"
},
{
"input": "1999999999\n0",
"output": "1"
},
{
"input": "1999999999\n1",
"output": "0"
},
{
"input": "1999999999\n2",
"output": "2"
},
{
"input": "2000000000\n1",
"output": "2"
},
{
"input": "2000000000\n2",
"output": "0"
},
{
"input": "1234567890\n0",
"output": "0"
},
{
"input": "1234567890\n1",
"output": "1"
},
{
"input": "1234567890\n2",
"output": "2"
},
{
"input": "123456789\n0",
"output": "2"
},
{
"input": "123456789\n1",
"output": "1"
},
{
"input": "123456789\n2",
"output": "0"
},
{
"input": "123456790\n0",
"output": "2"
},
{
"input": "12\n2",
"output": "2"
},
{
"input": "32\n1",
"output": "2"
},
{
"input": "20\n2",
"output": "0"
},
{
"input": "10\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "76994383\n1",
"output": "0"
},
{
"input": "25\n2",
"output": "2"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "12\n0",
"output": "0"
},
{
"input": "150\n2",
"output": "2"
},
{
"input": "15\n0",
"output": "2"
},
{
"input": "21\n2",
"output": "0"
},
{
"input": "18\n2",
"output": "2"
},
{
"input": "8\n2",
"output": "0"
},
{
"input": "10\n0",
"output": "2"
},
{
"input": "16\n0",
"output": "2"
}
] | 1,617,808,857
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 68
| 109
| 0
|
a = [1 , 2 , 2 , 1 , 0 , 0]
b = [0 , 0 , 1 , 2 , 2 , 1]
c = [2 , 1 , 0 , 0 , 1 , 2]
n = int(input())
n = n%6
if not n: n = 6
x = int(input())
if a[n-1] == x: print(0)
elif b[n-1] ==x: print(1)
else: print(2)
|
Title: Shell Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball.
Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.).
Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator.
The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
Output Specification:
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
Demo Input:
['4\n2\n', '1\n1\n']
Demo Output:
['1\n', '0\n']
Note:
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements.
1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
|
```python
a = [1 , 2 , 2 , 1 , 0 , 0]
b = [0 , 0 , 1 , 2 , 2 , 1]
c = [2 , 1 , 0 , 0 , 1 , 2]
n = int(input())
n = n%6
if not n: n = 6
x = int(input())
if a[n-1] == x: print(0)
elif b[n-1] ==x: print(1)
else: print(2)
```
| 3
|
|
263
|
A
|
Beautiful Matrix
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
|
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
|
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
|
[
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,696,590,791
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
arr=[]
for i in range(5):
temp=list(map(int,input().split()))
for j in range(len(temp)):
if temp[j]==1:
cell=[i,j]
tar=[2,2]
print(abs(cell[0]-tar[0])+abs(cell[1]-tar[1]))
|
Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
arr=[]
for i in range(5):
temp=list(map(int,input().split()))
for j in range(len(temp)):
if temp[j]==1:
cell=[i,j]
tar=[2,2]
print(abs(cell[0]-tar[0])+abs(cell[1]-tar[1]))
```
| 3
|
|
617
|
A
|
Elephant
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
|
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
|
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
|
[
"5\n",
"12\n"
] |
[
"1\n",
"3\n"
] |
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
| 500
|
[
{
"input": "5",
"output": "1"
},
{
"input": "12",
"output": "3"
},
{
"input": "999999",
"output": "200000"
},
{
"input": "41",
"output": "9"
},
{
"input": "1000000",
"output": "200000"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "534204",
"output": "106841"
},
{
"input": "469569",
"output": "93914"
},
{
"input": "502877",
"output": "100576"
},
{
"input": "942212",
"output": "188443"
},
{
"input": "97",
"output": "20"
},
{
"input": "53",
"output": "11"
},
{
"input": "89",
"output": "18"
},
{
"input": "574",
"output": "115"
},
{
"input": "716",
"output": "144"
},
{
"input": "729",
"output": "146"
},
{
"input": "8901",
"output": "1781"
},
{
"input": "3645",
"output": "729"
},
{
"input": "4426",
"output": "886"
},
{
"input": "46573",
"output": "9315"
},
{
"input": "86380",
"output": "17276"
},
{
"input": "94190",
"output": "18838"
},
{
"input": "999990",
"output": "199998"
},
{
"input": "999991",
"output": "199999"
},
{
"input": "999992",
"output": "199999"
},
{
"input": "999993",
"output": "199999"
},
{
"input": "999994",
"output": "199999"
},
{
"input": "999995",
"output": "199999"
},
{
"input": "999996",
"output": "200000"
},
{
"input": "999997",
"output": "200000"
},
{
"input": "999998",
"output": "200000"
}
] | 1,699,462,130
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
x=int(input(''))
if x%5==0:
steps=x//5
print(steps)
else:
steps=(int((x/5)))+1
print(steps)
|
Title: Elephant
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
Input Specification:
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
Output Specification:
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
Demo Input:
['5\n', '12\n']
Demo Output:
['1\n', '3\n']
Note:
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
|
```python
x=int(input(''))
if x%5==0:
steps=x//5
print(steps)
else:
steps=(int((x/5)))+1
print(steps)
```
| 3
|
|
262
|
A
|
Roma and Lucky Numbers
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers.
Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
|
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has.
The numbers in the lines are separated by single spaces.
|
In a single line print a single integer — the answer to the problem.
|
[
"3 4\n1 2 4\n",
"3 2\n447 44 77\n"
] |
[
"3\n",
"2\n"
] |
In the first sample all numbers contain at most four lucky digits, so the answer is 3.
In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
| 500
|
[
{
"input": "3 4\n1 2 4",
"output": "3"
},
{
"input": "3 2\n447 44 77",
"output": "2"
},
{
"input": "2 2\n507978501 180480073",
"output": "2"
},
{
"input": "9 6\n655243746 167613748 1470546 57644035 176077477 56984809 44677 215706823 369042089",
"output": "9"
},
{
"input": "6 100\n170427799 37215529 675016434 168544291 683447134 950090227",
"output": "6"
},
{
"input": "4 2\n194041605 706221269 69909135 257655784",
"output": "3"
},
{
"input": "4 2\n9581849 67346651 530497 272158241",
"output": "4"
},
{
"input": "3 47\n378261451 163985731 230342101",
"output": "3"
},
{
"input": "2 3\n247776868 480572137",
"output": "1"
},
{
"input": "7 77\n366496749 549646417 278840199 119255907 33557677 379268590 150378796",
"output": "7"
},
{
"input": "40 31\n32230963 709031779 144328646 513494529 36547831 416998222 84161665 318773941 170724397 553666286 368402971 48581613 31452501 368026285 47903381 939151438 204145360 189920160 288159400 133145006 314295423 450219949 160203213 358403181 478734385 29331901 31051111 110710191 567314089 139695685 111511396 87708701 317333277 103301481 110400517 634446253 481551313 39202255 105948 738066085",
"output": "40"
},
{
"input": "1 8\n55521105",
"output": "1"
},
{
"input": "49 3\n34644511 150953622 136135827 144208961 359490601 86708232 719413689 188605873 64330753 488776302 104482891 63360106 437791390 46521319 70778345 339141601 136198441 292941209 299339510 582531183 555958105 437904637 74219097 439816011 236010407 122674666 438442529 186501223 63932449 407678041 596993853 92223251 849265278 480265849 30983497 330283357 186901672 20271344 794252593 123774176 27851201 52717531 479907210 196833889 149331196 82147847 255966471 278600081 899317843",
"output": "44"
},
{
"input": "26 2\n330381357 185218042 850474297 483015466 296129476 1205865 538807493 103205601 160403321 694220263 416255901 7245756 507755361 88187633 91426751 1917161 58276681 59540376 576539745 595950717 390256887 105690055 607818885 28976353 488947089 50643601",
"output": "22"
},
{
"input": "38 1\n194481717 126247087 815196361 106258801 381703249 283859137 15290101 40086151 213688513 577996947 513899717 371428417 107799271 11136651 5615081 323386401 381128815 34217126 17709913 520702093 201694245 570931849 169037023 417019726 282437316 7417126 271667553 11375851 185087449 410130883 383045677 5764771 905017051 328584026 215330671 299553233 15838255 234532105",
"output": "20"
},
{
"input": "44 9\n683216389 250581469 130029957 467020047 188395565 206237982 63257361 68314981 732878407 563579660 199133851 53045209 665723851 16273169 10806790 556633156 350593410 474645249 478790761 708234243 71841230 18090541 19836685 146373571 17947452 534010506 46933264 377035021 311636557 75193963 54321761 12759959 71120181 548816939 23608621 31876417 107672995 72575155 369667956 20574379 210596751 532163173 75726739 853719629",
"output": "44"
},
{
"input": "8 6\n204157376 10514197 65483881 347219841 263304577 296402721 11739011 229776191",
"output": "8"
},
{
"input": "38 29\n333702889 680931737 61137217 203030505 68728281 11414209 642645708 590904616 3042901 607198177 189041074 700764043 813035201 198341461 126403544 401436841 420826465 45046581 20249976 46978855 46397957 706610773 24701041 57954481 51603266 593109701 385569073 178982291 582152863 287317968 1474090 34825141 432421977 130257781 151516903 540852403 548392 117246529",
"output": "38"
},
{
"input": "19 3\n562569697 549131571 50676718 84501863 74567295 702372009 365895280 451459937 40378543 167666701 158635641 53639293 442332661 825055617 100109161 326616021 862332843 533271196 4791547",
"output": "18"
},
{
"input": "1 1\n44",
"output": "0"
},
{
"input": "1 1\n4",
"output": "1"
},
{
"input": "10 3\n444 447 774 777 7777 4447 4 7 7 4",
"output": "8"
}
] | 1,623,517,677
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 124
| 0
|
n,k=map(int,input().split())
cnt=0
for a in input().split():
cnt+=a.count('4')+a.count('7')<=k
print(cnt)
|
Title: Roma and Lucky Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers.
Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
Input Specification:
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has.
The numbers in the lines are separated by single spaces.
Output Specification:
In a single line print a single integer — the answer to the problem.
Demo Input:
['3 4\n1 2 4\n', '3 2\n447 44 77\n']
Demo Output:
['3\n', '2\n']
Note:
In the first sample all numbers contain at most four lucky digits, so the answer is 3.
In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
|
```python
n,k=map(int,input().split())
cnt=0
for a in input().split():
cnt+=a.count('4')+a.count('7')<=k
print(cnt)
```
| 3
|
|
92
|
A
|
Chips
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] |
A. Chips
|
2
|
256
|
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
|
Print the number of chips the presenter ended up with.
|
[
"4 11\n",
"17 107\n",
"3 8\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
| 500
|
[
{
"input": "4 11",
"output": "0"
},
{
"input": "17 107",
"output": "2"
},
{
"input": "3 8",
"output": "1"
},
{
"input": "46 7262",
"output": "35"
},
{
"input": "32 6864",
"output": "0"
},
{
"input": "36 6218",
"output": "14"
},
{
"input": "25 9712",
"output": "11"
},
{
"input": "9 7601",
"output": "5"
},
{
"input": "1 9058",
"output": "0"
},
{
"input": "29 7772",
"output": "26"
},
{
"input": "45 9465",
"output": "14"
},
{
"input": "46 866",
"output": "5"
},
{
"input": "29 1241",
"output": "20"
},
{
"input": "17 4248",
"output": "12"
},
{
"input": "20 8082",
"output": "11"
},
{
"input": "50 9555",
"output": "0"
},
{
"input": "4 7455",
"output": "2"
},
{
"input": "36 880",
"output": "4"
},
{
"input": "24 7440",
"output": "9"
},
{
"input": "44 7888",
"output": "12"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "50 10000",
"output": "40"
},
{
"input": "1 10000",
"output": "0"
},
{
"input": "50 1",
"output": "0"
},
{
"input": "50 50",
"output": "5"
}
] | 1,637,749,610
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 124
| 0
|
N, M = map(int, input().split())
S = int(N * (N + 1) / 2)
Imax = int((-1.0 + (1 + 8 * (M % S)) ** 0.5) / 2.0)
result = int(M % S - Imax * (Imax + 1) / 2)
print(result)
|
Title: Chips
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
Output Specification:
Print the number of chips the presenter ended up with.
Demo Input:
['4 11\n', '17 107\n', '3 8\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
|
```python
N, M = map(int, input().split())
S = int(N * (N + 1) / 2)
Imax = int((-1.0 + (1 + 8 * (M % S)) ** 0.5) / 2.0)
result = int(M % S - Imax * (Imax + 1) / 2)
print(result)
```
| 3.969
|
897
|
B
|
Chtholly's request
|
PROGRAMMING
| 1,300
|
[
"brute force"
] | null | null |
— I experienced so many great things.
— You gave me memories like dreams... But I have to leave now...
— One last request, can you...
— Help me solve a Codeforces problem?
— ......
— What?
Chtholly has been thinking about a problem for days:
If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not.
Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*.
Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help!
|
The first line contains two integers *k* and *p* (1<=≤<=*k*<=≤<=105,<=1<=≤<=*p*<=≤<=109).
|
Output single integer — answer to the problem.
|
[
"2 100\n",
"5 30\n"
] |
[
"33\n",
"15\n"
] |
In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22.
In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 1,000
|
[
{
"input": "2 100",
"output": "33"
},
{
"input": "5 30",
"output": "15"
},
{
"input": "42147 412393322",
"output": "251637727"
},
{
"input": "77809 868097296",
"output": "440411873"
},
{
"input": "5105 443422097",
"output": "363192634"
},
{
"input": "75615 376679484",
"output": "373089399"
},
{
"input": "22951 23793302",
"output": "1898631"
},
{
"input": "12785 993582106",
"output": "286204743"
},
{
"input": "60276 428978808",
"output": "376477293"
},
{
"input": "84776 104860385",
"output": "10209596"
},
{
"input": "41984 653766991",
"output": "17823101"
},
{
"input": "100000 1000000000",
"output": "495495496"
},
{
"input": "41163 472310076",
"output": "207304047"
},
{
"input": "6983 765352180",
"output": "586866999"
},
{
"input": "33493 967727004",
"output": "305705165"
},
{
"input": "90898 94010922",
"output": "65928728"
},
{
"input": "67298 349286579",
"output": "156435206"
},
{
"input": "92452 296773064",
"output": "229486976"
},
{
"input": "58832 563860457",
"output": "16775206"
},
{
"input": "90234 156145441",
"output": "44023160"
},
{
"input": "91454 977186148",
"output": "681779748"
},
{
"input": "11108 444095250",
"output": "188075844"
},
{
"input": "46304 584475527",
"output": "275627129"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 1000000000",
"output": "11"
},
{
"input": "100000 1",
"output": "0"
}
] | 1,512,476,742
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 155
| 5,529,600
|
k,p=list(map(int,input().split()))
a=0
for i in range(1,k+1):
s=str(i)
a=(a+int(s+s[::-1]))%p
print(a)
|
Title: Chtholly's request
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
— I experienced so many great things.
— You gave me memories like dreams... But I have to leave now...
— One last request, can you...
— Help me solve a Codeforces problem?
— ......
— What?
Chtholly has been thinking about a problem for days:
If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not.
Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*.
Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help!
Input Specification:
The first line contains two integers *k* and *p* (1<=≤<=*k*<=≤<=105,<=1<=≤<=*p*<=≤<=109).
Output Specification:
Output single integer — answer to the problem.
Demo Input:
['2 100\n', '5 30\n']
Demo Output:
['33\n', '15\n']
Note:
In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22.
In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
k,p=list(map(int,input().split()))
a=0
for i in range(1,k+1):
s=str(i)
a=(a+int(s+s[::-1]))%p
print(a)
```
| 3
|
|
515
|
C
|
Drazil and Factorial
|
PROGRAMMING
| 1,400
|
[
"greedy",
"math",
"sortings"
] | null | null |
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
|
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
|
[
"4\n1234\n",
"3\n555\n"
] |
[
"33222\n",
"555\n"
] |
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "4\n1234",
"output": "33222"
},
{
"input": "3\n555",
"output": "555"
},
{
"input": "15\n012345781234578",
"output": "7777553333222222222222"
},
{
"input": "1\n8",
"output": "7222"
},
{
"input": "10\n1413472614",
"output": "75333332222222"
},
{
"input": "8\n68931246",
"output": "77553333332222222"
},
{
"input": "7\n4424368",
"output": "75333332222222222"
},
{
"input": "6\n576825",
"output": "7755532222"
},
{
"input": "5\n97715",
"output": "7775332"
},
{
"input": "3\n915",
"output": "75332"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "15\n028745260720699",
"output": "7777755533333332222222222"
},
{
"input": "13\n5761790121605",
"output": "7775555333322"
},
{
"input": "10\n3312667105",
"output": "755533332"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "15\n989898989898989",
"output": "777777777777777333333333333333322222222222222222222222222222"
},
{
"input": "15\n000000000000007",
"output": "7"
},
{
"input": "15\n999999999999990",
"output": "77777777777777333333333333333333333333333322222222222222"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n6",
"output": "53"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "1\n9",
"output": "7332"
},
{
"input": "2\n09",
"output": "7332"
},
{
"input": "13\n1337251172966",
"output": "777555333333222"
},
{
"input": "15\n987654329876543",
"output": "777777555533333333332222222222222"
},
{
"input": "9\n234567899",
"output": "777755333333322222222"
},
{
"input": "2\n99",
"output": "77333322"
},
{
"input": "2\n66",
"output": "5533"
},
{
"input": "3\n999",
"output": "777333333222"
},
{
"input": "5\n99999",
"output": "77777333333333322222"
},
{
"input": "9\n123456789",
"output": "77755333332222222"
},
{
"input": "9\n987654321",
"output": "77755333332222222"
},
{
"input": "3\n666",
"output": "555333"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "6\n555777",
"output": "777555"
},
{
"input": "10\n1234567899",
"output": "777755333333322222222"
},
{
"input": "4\n6666",
"output": "55553333"
},
{
"input": "4\n9754",
"output": "775333222"
},
{
"input": "2\n95",
"output": "75332"
},
{
"input": "14\n11122233344455",
"output": "55333333222222222"
},
{
"input": "12\n836544897832",
"output": "77777553333333222222222222222"
}
] | 1,620,844,890
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 45
| 108
| 20,172,800
|
import sys
import math
input = sys.stdin.readline
def primefactors(n):
l = []
while n % 2 == 0:
l.append(2)
n = n // 2
for i in range(3, int(math.sqrt(n)) + 1, 2):
while n % i == 0:
l.append(i)
n = n // i
if n > 2:
l.append(n)
return l
q = int(input())
n = int(input())
d = {}
s = str(n)
for i in s:
x = int(i)
r = 1
while x > 1:
r = r*x
x -= 1
l = primefactors(r)
for i in l:
if i in d:
d[i] +=1
else:
d[i] = 1
ans = []
e = []
# print(d)
for i in d:
e.append(i)
e.sort(reverse = True)
for i in e:
v = d[i]
for j in range(i-1,1,-1):
h = primefactors(j)
for k in h:
d[k] -= v
while v > 0:
ans.append(i)
v -= 1
w = []
for i in ans:
w.append(str(i))
print("".join(w))
|
Title: Drazil and Factorial
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
Output Specification:
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
Demo Input:
['4\n1234\n', '3\n555\n']
Demo Output:
['33222\n', '555\n']
Note:
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
import sys
import math
input = sys.stdin.readline
def primefactors(n):
l = []
while n % 2 == 0:
l.append(2)
n = n // 2
for i in range(3, int(math.sqrt(n)) + 1, 2):
while n % i == 0:
l.append(i)
n = n // i
if n > 2:
l.append(n)
return l
q = int(input())
n = int(input())
d = {}
s = str(n)
for i in s:
x = int(i)
r = 1
while x > 1:
r = r*x
x -= 1
l = primefactors(r)
for i in l:
if i in d:
d[i] +=1
else:
d[i] = 1
ans = []
e = []
# print(d)
for i in d:
e.append(i)
e.sort(reverse = True)
for i in e:
v = d[i]
for j in range(i-1,1,-1):
h = primefactors(j)
for k in h:
d[k] -= v
while v > 0:
ans.append(i)
v -= 1
w = []
for i in ans:
w.append(str(i))
print("".join(w))
```
| 3
|
|
199
|
A
|
Hexadecimal's theorem
|
PROGRAMMING
| 900
|
[
"brute force",
"constructive algorithms",
"implementation",
"number theory"
] | null | null |
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
|
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
|
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
|
[
"3\n",
"13\n"
] |
[
"1 1 1\n",
"2 3 8\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "1 1 1"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "3",
"output": "1 1 1"
},
{
"input": "5",
"output": "1 1 3"
},
{
"input": "8",
"output": "1 2 5"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "21",
"output": "3 5 13"
},
{
"input": "34",
"output": "5 8 21"
},
{
"input": "55",
"output": "8 13 34"
},
{
"input": "89",
"output": "13 21 55"
},
{
"input": "144",
"output": "21 34 89"
},
{
"input": "233",
"output": "34 55 144"
},
{
"input": "377",
"output": "55 89 233"
},
{
"input": "610",
"output": "89 144 377"
},
{
"input": "987",
"output": "144 233 610"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "2584",
"output": "377 610 1597"
},
{
"input": "4181",
"output": "610 987 2584"
},
{
"input": "6765",
"output": "987 1597 4181"
},
{
"input": "10946",
"output": "1597 2584 6765"
},
{
"input": "17711",
"output": "2584 4181 10946"
},
{
"input": "28657",
"output": "4181 6765 17711"
},
{
"input": "46368",
"output": "6765 10946 28657"
},
{
"input": "75025",
"output": "10946 17711 46368"
},
{
"input": "121393",
"output": "17711 28657 75025"
},
{
"input": "196418",
"output": "28657 46368 121393"
},
{
"input": "317811",
"output": "46368 75025 196418"
},
{
"input": "514229",
"output": "75025 121393 317811"
},
{
"input": "832040",
"output": "121393 196418 514229"
},
{
"input": "1346269",
"output": "196418 317811 832040"
},
{
"input": "2178309",
"output": "317811 514229 1346269"
},
{
"input": "3524578",
"output": "514229 832040 2178309"
},
{
"input": "5702887",
"output": "832040 1346269 3524578"
},
{
"input": "9227465",
"output": "1346269 2178309 5702887"
},
{
"input": "14930352",
"output": "2178309 3524578 9227465"
},
{
"input": "24157817",
"output": "3524578 5702887 14930352"
},
{
"input": "39088169",
"output": "5702887 9227465 24157817"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "165580141",
"output": "24157817 39088169 102334155"
},
{
"input": "267914296",
"output": "39088169 63245986 165580141"
},
{
"input": "433494437",
"output": "63245986 102334155 267914296"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
}
] | 1,613,328,322
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 124
| 0
|
print(0,0,int(input()))
|
Title: Hexadecimal's theorem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
Input Specification:
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
Output Specification:
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '13\n']
Demo Output:
['1 1 1\n', '2 3 8\n']
Note:
none
|
```python
print(0,0,int(input()))
```
| 3
|
|
371
|
A
|
K-Periodic Array
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation",
"math"
] | null | null |
This task will exclusively concentrate only on the arrays where all elements equal 1 and/or 2.
Array *a* is *k*-period if its length is divisible by *k* and there is such array *b* of length *k*, that *a* is represented by array *b* written exactly times consecutively. In other words, array *a* is *k*-periodic, if it has period of length *k*.
For example, any array is *n*-periodic, where *n* is the array length. Array [2,<=1,<=2,<=1,<=2,<=1] is at the same time 2-periodic and 6-periodic and array [1,<=2,<=1,<=1,<=2,<=1,<=1,<=2,<=1] is at the same time 3-periodic and 9-periodic.
For the given array *a*, consisting only of numbers one and two, find the minimum number of elements to change to make the array *k*-periodic. If the array already is *k*-periodic, then the required value equals 0.
|
The first line of the input contains a pair of integers *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100), where *n* is the length of the array and the value *n* is divisible by *k*. The second line contains the sequence of elements of the given array *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), *a**i* is the *i*-th element of the array.
|
Print the minimum number of array elements we need to change to make the array *k*-periodic. If the array already is *k*-periodic, then print 0.
|
[
"6 2\n2 1 2 2 2 1\n",
"8 4\n1 1 2 1 1 1 2 1\n",
"9 3\n2 1 1 1 2 1 1 1 2\n"
] |
[
"1\n",
"0\n",
"3\n"
] |
In the first sample it is enough to change the fourth element from 2 to 1, then the array changes to [2, 1, 2, 1, 2, 1].
In the second sample, the given array already is 4-periodic.
In the third sample it is enough to replace each occurrence of number two by number one. In this case the array will look as [1, 1, 1, 1, 1, 1, 1, 1, 1] — this array is simultaneously 1-, 3- and 9-periodic.
| 500
|
[
{
"input": "6 2\n2 1 2 2 2 1",
"output": "1"
},
{
"input": "8 4\n1 1 2 1 1 1 2 1",
"output": "0"
},
{
"input": "9 3\n2 1 1 1 2 1 1 1 2",
"output": "3"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "0"
},
{
"input": "100 1\n1 2 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "8"
},
{
"input": "2 1\n1 2",
"output": "1"
},
{
"input": "2 2\n2 1",
"output": "0"
},
{
"input": "3 1\n2 1 2",
"output": "1"
},
{
"input": "3 3\n1 2 1",
"output": "0"
},
{
"input": "4 2\n2 1 2 2",
"output": "1"
},
{
"input": "10 2\n2 2 2 1 1 2 2 2 2 1",
"output": "3"
},
{
"input": "10 5\n2 2 1 2 1 1 2 1 1 1",
"output": "2"
},
{
"input": "20 4\n2 2 1 2 2 2 1 2 2 2 1 2 2 2 1 2 2 2 1 2",
"output": "0"
},
{
"input": "20 5\n2 2 1 1 1 2 1 1 1 1 2 2 1 1 2 2 2 1 1 2",
"output": "3"
},
{
"input": "20 10\n1 2 2 2 2 1 1 1 2 1 1 2 2 2 2 1 2 2 2 1",
"output": "2"
},
{
"input": "100 2\n2 2 1 2 1 2 1 2 1 2 1 2 1 2 2 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 2 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 2 1 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100 4\n1 2 1 1 1 2 1 1 1 2 1 1 1 2 1 1 1 2 2 2 1 2 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 2 1 1 1 2 2 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 2 1 1 1 2 1 1 1 2 1 1 1 2 2 1 1 2 1 1 1 2 1 2 1 2 1 1 1 2 1 1 1 2 1 1",
"output": "8"
},
{
"input": "100 5\n2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 2 2 2 2 2 2 1 2 2 2",
"output": "16"
},
{
"input": "100 10\n2 1 1 1 1 2 2 2 1 1 2 1 1 2 1 2 1 2 1 1 2 1 1 1 1 2 1 2 1 1 2 1 1 1 1 2 2 2 1 1 2 1 1 1 1 2 1 2 1 1 2 1 1 1 1 2 1 2 2 1 2 1 1 1 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 2 1 1 2 1 1 1 2 2 1 2 1 1",
"output": "6"
},
{
"input": "100 20\n2 2 2 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 2 2 2 1 2 1 2 1 1 1 1 2 2 2 2 1 2 1 1 2 2 2 2 1 2 1 2 1 2 1 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 1 2 1 1 1 1 2 2 2 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 2 2 1 1 1",
"output": "13"
},
{
"input": "100 25\n2 2 1 2 2 2 2 2 1 2 2 1 2 1 1 2 1 2 1 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 2 2 1 2 1 1 2 2 2 1 2 2 1 2 2 2 2 1 1 2 1 2 2 1 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 1 2 1 1 2 2 2 2 2 1 2 2 1 1 2 1 2 2 2 1 2 2 2 2 2 2",
"output": "15"
},
{
"input": "100 10\n2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 1 2 1 2 1",
"output": "0"
}
] | 1,658,682,431
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 24
| 77
| 0
|
I=lambda:map(int,input().split())
n,k=I()
a=[0]*n
i=0
for v in I():a[i]+=v-1;i=(i+1)%k
print(sum(map(lambda x:min(x,n//k-x),a)))
|
Title: K-Periodic Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This task will exclusively concentrate only on the arrays where all elements equal 1 and/or 2.
Array *a* is *k*-period if its length is divisible by *k* and there is such array *b* of length *k*, that *a* is represented by array *b* written exactly times consecutively. In other words, array *a* is *k*-periodic, if it has period of length *k*.
For example, any array is *n*-periodic, where *n* is the array length. Array [2,<=1,<=2,<=1,<=2,<=1] is at the same time 2-periodic and 6-periodic and array [1,<=2,<=1,<=1,<=2,<=1,<=1,<=2,<=1] is at the same time 3-periodic and 9-periodic.
For the given array *a*, consisting only of numbers one and two, find the minimum number of elements to change to make the array *k*-periodic. If the array already is *k*-periodic, then the required value equals 0.
Input Specification:
The first line of the input contains a pair of integers *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100), where *n* is the length of the array and the value *n* is divisible by *k*. The second line contains the sequence of elements of the given array *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), *a**i* is the *i*-th element of the array.
Output Specification:
Print the minimum number of array elements we need to change to make the array *k*-periodic. If the array already is *k*-periodic, then print 0.
Demo Input:
['6 2\n2 1 2 2 2 1\n', '8 4\n1 1 2 1 1 1 2 1\n', '9 3\n2 1 1 1 2 1 1 1 2\n']
Demo Output:
['1\n', '0\n', '3\n']
Note:
In the first sample it is enough to change the fourth element from 2 to 1, then the array changes to [2, 1, 2, 1, 2, 1].
In the second sample, the given array already is 4-periodic.
In the third sample it is enough to replace each occurrence of number two by number one. In this case the array will look as [1, 1, 1, 1, 1, 1, 1, 1, 1] — this array is simultaneously 1-, 3- and 9-periodic.
|
```python
I=lambda:map(int,input().split())
n,k=I()
a=[0]*n
i=0
for v in I():a[i]+=v-1;i=(i+1)%k
print(sum(map(lambda x:min(x,n//k-x),a)))
```
| 3
|
|
903
|
A
|
Hungry Student Problem
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Ivan's classes at the university have just finished, and now he wants to go to the local CFK cafe and eat some fried chicken.
CFK sells chicken chunks in small and large portions. A small portion contains 3 chunks; a large one — 7 chunks. Ivan wants to eat exactly *x* chunks. Now he wonders whether he can buy exactly this amount of chicken.
Formally, Ivan wants to know if he can choose two non-negative integers *a* and *b* in such a way that *a* small portions and *b* large ones contain exactly *x* chunks.
Help Ivan to answer this question for several values of *x*!
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of testcases.
The *i*-th of the following *n* lines contains one integer *x**i* (1<=≤<=*x**i*<=≤<=100) — the number of chicken chunks Ivan wants to eat.
|
Print *n* lines, in *i*-th line output YES if Ivan can buy exactly *x**i* chunks. Otherwise, print NO.
|
[
"2\n6\n5\n"
] |
[
"YES\nNO\n"
] |
In the first example Ivan can buy two small portions.
In the second example Ivan cannot buy exactly 5 chunks, since one small portion is not enough, but two small portions or one large is too much.
| 0
|
[
{
"input": "2\n6\n5",
"output": "YES\nNO"
},
{
"input": "100\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n11\n12\n13\n14\n15\n16\n17\n18\n19\n20\n21\n22\n23\n24\n25\n26\n27\n28\n29\n30\n31\n32\n33\n34\n35\n36\n37\n38\n39\n40\n41\n42\n43\n44\n45\n46\n47\n48\n49\n50\n51\n52\n53\n54\n55\n56\n57\n58\n59\n60\n61\n62\n63\n64\n65\n66\n67\n68\n69\n70\n71\n72\n73\n74\n75\n76\n77\n78\n79\n80\n81\n82\n83\n84\n85\n86\n87\n88\n89\n90\n91\n92\n93\n94\n95\n96\n97\n98\n99\n100",
"output": "NO\nNO\nYES\nNO\nNO\nYES\nYES\nNO\nYES\nYES\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
},
{
"input": "3\n6\n6\n6",
"output": "YES\nYES\nYES"
},
{
"input": "47\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "3\n1\n52\n76",
"output": "NO\nYES\nYES"
},
{
"input": "87\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
},
{
"input": "3\n3\n2\n1",
"output": "YES\nNO\nNO"
},
{
"input": "100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,580,635,066
| 166
|
Python 3
|
OK
|
TESTS
| 8
| 109
| 307,200
|
for _ in " "*int(input()):print("NO" if int(input()) in [2,5,11,4,1,8] else "YES")
|
Title: Hungry Student Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan's classes at the university have just finished, and now he wants to go to the local CFK cafe and eat some fried chicken.
CFK sells chicken chunks in small and large portions. A small portion contains 3 chunks; a large one — 7 chunks. Ivan wants to eat exactly *x* chunks. Now he wonders whether he can buy exactly this amount of chicken.
Formally, Ivan wants to know if he can choose two non-negative integers *a* and *b* in such a way that *a* small portions and *b* large ones contain exactly *x* chunks.
Help Ivan to answer this question for several values of *x*!
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of testcases.
The *i*-th of the following *n* lines contains one integer *x**i* (1<=≤<=*x**i*<=≤<=100) — the number of chicken chunks Ivan wants to eat.
Output Specification:
Print *n* lines, in *i*-th line output YES if Ivan can buy exactly *x**i* chunks. Otherwise, print NO.
Demo Input:
['2\n6\n5\n']
Demo Output:
['YES\nNO\n']
Note:
In the first example Ivan can buy two small portions.
In the second example Ivan cannot buy exactly 5 chunks, since one small portion is not enough, but two small portions or one large is too much.
|
```python
for _ in " "*int(input()):print("NO" if int(input()) in [2,5,11,4,1,8] else "YES")
```
| 3
|
|
463
|
D
|
Gargari and Permutations
|
PROGRAMMING
| 1,900
|
[
"dfs and similar",
"dp",
"graphs",
"implementation"
] | null | null |
Gargari got bored to play with the bishops and now, after solving the problem about them, he is trying to do math homework. In a math book he have found *k* permutations. Each of them consists of numbers 1,<=2,<=...,<=*n* in some order. Now he should find the length of the longest common subsequence of these permutations. Can you help Gargari?
You can read about longest common subsequence there: https://en.wikipedia.org/wiki/Longest_common_subsequence_problem
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1000; 2<=≤<=*k*<=≤<=5). Each of the next *k* lines contains integers 1,<=2,<=...,<=*n* in some order — description of the current permutation.
|
Print the length of the longest common subsequence.
|
[
"4 3\n1 4 2 3\n4 1 2 3\n1 2 4 3\n"
] |
[
"3\n"
] |
The answer for the first test sample is subsequence [1, 2, 3].
| 2,000
|
[
{
"input": "4 3\n1 4 2 3\n4 1 2 3\n1 2 4 3",
"output": "3"
},
{
"input": "6 3\n2 5 1 4 6 3\n5 1 4 3 2 6\n5 4 2 6 3 1",
"output": "3"
},
{
"input": "41 4\n24 15 17 35 13 41 4 14 23 5 8 16 21 18 30 36 6 22 11 29 26 1 40 31 7 3 32 10 28 38 12 20 39 37 34 19 33 27 2 25 9\n22 13 25 24 38 35 29 12 15 8 11 37 3 19 4 23 18 32 30 40 36 21 16 34 27 9 5 41 39 2 14 17 31 33 26 7 1 10 20 6 28\n31 27 39 16 22 12 13 32 6 10 19 29 37 7 18 33 24 21 1 9 36 4 34 41 25 28 17 40 30 35 23 14 11 8 2 15 38 20 26 5 3\n8 18 39 38 7 34 16 31 15 1 40 20 37 4 25 11 17 19 33 26 6 14 13 41 12 32 2 21 10 35 27 9 28 5 30 24 22 23 29 3 36",
"output": "4"
},
{
"input": "1 2\n1\n1",
"output": "1"
},
{
"input": "28 5\n3 14 12 16 13 27 20 8 1 10 24 11 5 9 7 18 17 23 22 25 28 19 4 21 26 6 15 2\n7 12 23 27 22 26 16 18 19 5 6 9 11 28 25 4 10 3 1 14 8 17 15 2 20 13 24 21\n21 20 2 5 19 15 12 4 18 9 23 16 11 14 8 6 25 27 13 17 10 26 7 24 28 1 3 22\n12 2 23 11 20 18 25 21 13 27 14 8 4 6 9 16 7 3 10 1 22 15 26 19 5 17 28 24\n13 2 6 19 22 23 4 1 28 10 18 17 21 8 9 3 26 11 12 27 14 20 24 25 15 5 16 7",
"output": "3"
},
{
"input": "6 3\n2 5 1 4 6 3\n5 1 4 6 2 3\n5 4 2 6 3 1",
"output": "4"
},
{
"input": "41 4\n24 15 17 35 13 41 4 14 23 5 8 16 21 18 30 36 6 22 11 29 26 1 40 31 7 3 32 10 28 38 12 20 39 37 34 19 33 27 2 25 9\n22 13 25 24 38 35 29 12 15 8 11 37 3 19 4 23 18 32 30 40 36 21 16 34 27 9 5 41 39 2 14 17 31 33 26 7 1 10 20 6 28\n31 27 39 16 22 12 13 32 6 10 19 29 37 7 18 33 24 21 1 9 36 4 34 41 25 28 17 40 30 35 23 14 11 8 2 15 38 20 26 5 3\n8 18 39 38 7 34 16 31 15 1 40 20 37 4 25 11 17 19 33 26 6 14 13 41 12 32 2 21 10 35 27 9 28 5 30 24 22 23 29 3 36",
"output": "4"
},
{
"input": "37 3\n6 3 19 20 15 4 1 35 8 24 12 21 34 26 18 14 23 33 28 9 36 11 37 31 25 32 29 22 13 27 16 17 10 7 5 30 2\n10 3 35 17 34 21 14 8 26 28 11 19 27 7 4 23 24 22 12 13 16 1 25 29 5 31 30 20 32 18 15 9 2 36 37 33 6\n19 9 22 32 26 35 29 23 5 6 14 34 33 10 2 28 15 11 24 4 13 7 8 31 37 36 1 27 3 16 30 25 20 21 18 17 12",
"output": "7"
}
] | 1,699,101,867
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 40
| 93
| 4,403,200
|
n, k = map(int, input().split())
a = [[]]*6
b = []
for i in range(6):
b.append([0]*(n + 1))
for i in range(k):
a[i] = list(map(int, input().split()))
for j in range(n):
b[i][a[i][j]] = j
dp = [1] * n
for i in range(n):
for j in range(i):
key = 1
for t in range(1, k):
if b[t][a[0][j]] > b[t][a[0][i]]:
key = 0
break
if key:
dp[i] = max(dp[i], dp[j] + 1)
print(max(dp))
|
Title: Gargari and Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gargari got bored to play with the bishops and now, after solving the problem about them, he is trying to do math homework. In a math book he have found *k* permutations. Each of them consists of numbers 1,<=2,<=...,<=*n* in some order. Now he should find the length of the longest common subsequence of these permutations. Can you help Gargari?
You can read about longest common subsequence there: https://en.wikipedia.org/wiki/Longest_common_subsequence_problem
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1000; 2<=≤<=*k*<=≤<=5). Each of the next *k* lines contains integers 1,<=2,<=...,<=*n* in some order — description of the current permutation.
Output Specification:
Print the length of the longest common subsequence.
Demo Input:
['4 3\n1 4 2 3\n4 1 2 3\n1 2 4 3\n']
Demo Output:
['3\n']
Note:
The answer for the first test sample is subsequence [1, 2, 3].
|
```python
n, k = map(int, input().split())
a = [[]]*6
b = []
for i in range(6):
b.append([0]*(n + 1))
for i in range(k):
a[i] = list(map(int, input().split()))
for j in range(n):
b[i][a[i][j]] = j
dp = [1] * n
for i in range(n):
for j in range(i):
key = 1
for t in range(1, k):
if b[t][a[0][j]] > b[t][a[0][i]]:
key = 0
break
if key:
dp[i] = max(dp[i], dp[j] + 1)
print(max(dp))
```
| 3
|
|
998
|
B
|
Cutting
|
PROGRAMMING
| 1,200
|
[
"dp",
"greedy",
"sortings"
] | null | null |
There are a lot of things which could be cut — trees, paper, "the rope". In this problem you are going to cut a sequence of integers.
There is a sequence of integers, which contains the equal number of even and odd numbers. Given a limited budget, you need to make maximum possible number of cuts such that each resulting segment will have the same number of odd and even integers.
Cuts separate a sequence to continuous (contiguous) segments. You may think about each cut as a break between two adjacent elements in a sequence. So after cutting each element belongs to exactly one segment. Say, $[4, 1, 2, 3, 4, 5, 4, 4, 5, 5]$ $\to$ two cuts $\to$ $[4, 1 | 2, 3, 4, 5 | 4, 4, 5, 5]$. On each segment the number of even elements should be equal to the number of odd elements.
The cost of the cut between $x$ and $y$ numbers is $|x - y|$ bitcoins. Find the maximum possible number of cuts that can be made while spending no more than $B$ bitcoins.
|
First line of the input contains an integer $n$ ($2 \le n \le 100$) and an integer $B$ ($1 \le B \le 100$) — the number of elements in the sequence and the number of bitcoins you have.
Second line contains $n$ integers: $a_1$, $a_2$, ..., $a_n$ ($1 \le a_i \le 100$) — elements of the sequence, which contains the equal number of even and odd numbers
|
Print the maximum possible number of cuts which can be made while spending no more than $B$ bitcoins.
|
[
"6 4\n1 2 5 10 15 20\n",
"4 10\n1 3 2 4\n",
"6 100\n1 2 3 4 5 6\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample the optimal answer is to split sequence between $2$ and $5$. Price of this cut is equal to $3$ bitcoins.
In the second sample it is not possible to make even one cut even with unlimited number of bitcoins.
In the third sample the sequence should be cut between $2$ and $3$, and between $4$ and $5$. The total price of the cuts is $1 + 1 = 2$ bitcoins.
| 1,000
|
[
{
"input": "6 4\n1 2 5 10 15 20",
"output": "1"
},
{
"input": "4 10\n1 3 2 4",
"output": "0"
},
{
"input": "6 100\n1 2 3 4 5 6",
"output": "2"
},
{
"input": "2 100\n13 78",
"output": "0"
},
{
"input": "10 1\n56 56 98 2 11 64 97 41 95 53",
"output": "0"
},
{
"input": "10 100\n94 65 24 47 29 98 20 65 6 17",
"output": "2"
},
{
"input": "100 1\n35 6 19 84 49 64 36 91 50 65 21 86 20 89 10 52 50 24 98 74 11 48 58 98 51 85 1 29 44 83 9 97 68 41 83 57 1 57 46 42 87 2 32 50 3 57 17 77 22 100 36 27 3 34 55 8 90 61 34 20 15 39 43 46 60 60 14 23 4 22 75 51 98 23 69 22 99 57 63 30 79 7 16 8 34 84 13 47 93 40 48 25 93 1 80 6 82 93 6 21",
"output": "0"
},
{
"input": "100 10\n3 20 3 29 90 69 2 30 70 28 71 99 22 99 34 70 87 48 3 92 71 61 26 90 14 38 51 81 16 33 49 71 14 52 50 95 65 16 80 57 87 47 29 14 40 31 74 15 87 76 71 61 30 91 44 10 87 48 84 12 77 51 25 68 49 38 79 8 7 9 39 19 48 40 15 53 29 4 60 86 76 84 6 37 45 71 46 38 80 68 94 71 64 72 41 51 71 60 79 7",
"output": "2"
},
{
"input": "100 100\n60 83 82 16 17 7 89 6 83 100 85 41 72 44 23 28 64 84 3 23 33 52 93 30 81 38 67 25 26 97 94 78 41 74 74 17 53 51 54 17 20 81 95 76 42 16 16 56 74 69 30 9 82 91 32 13 47 45 97 40 56 57 27 28 84 98 91 5 61 20 3 43 42 26 83 40 34 100 5 63 62 61 72 5 32 58 93 79 7 18 50 43 17 24 77 73 87 74 98 2",
"output": "11"
},
{
"input": "100 100\n70 54 10 72 81 84 56 15 27 19 43 100 49 44 52 33 63 40 95 17 58 2 51 39 22 18 82 1 16 99 32 29 24 94 9 98 5 37 47 14 42 73 41 31 79 64 12 6 53 26 68 67 89 13 90 4 21 93 46 74 75 88 66 57 23 7 25 48 92 62 30 8 50 61 38 87 71 34 97 28 80 11 60 91 3 35 86 96 36 20 59 65 83 45 76 77 78 69 85 55",
"output": "3"
},
{
"input": "100 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "49"
},
{
"input": "10 10\n94 32 87 13 4 22 85 81 18 95",
"output": "1"
},
{
"input": "10 50\n40 40 9 3 64 96 67 19 21 30",
"output": "1"
},
{
"input": "100 50\n13 31 29 86 46 10 2 87 94 2 28 31 29 15 64 3 94 71 37 76 9 91 89 38 12 46 53 33 58 11 98 4 37 72 30 52 6 86 40 98 28 6 34 80 61 47 45 69 100 47 91 64 87 41 67 58 88 75 13 81 36 58 66 29 10 27 54 83 44 15 11 33 49 36 61 18 89 26 87 1 99 19 57 21 55 84 20 74 14 43 15 51 2 76 22 92 43 14 72 77",
"output": "3"
},
{
"input": "100 1\n78 52 95 76 96 49 53 59 77 100 64 11 9 48 15 17 44 46 21 54 39 68 43 4 32 28 73 6 16 62 72 84 65 86 98 75 33 45 25 3 91 82 2 92 63 88 7 50 97 93 14 22 20 42 60 55 80 85 29 34 56 71 83 38 26 47 90 70 51 41 40 31 37 12 35 99 67 94 1 87 57 8 61 19 23 79 36 18 66 74 5 27 81 69 24 58 13 10 89 30",
"output": "0"
},
{
"input": "100 10\n19 55 91 50 31 23 60 84 38 1 22 51 27 76 28 98 11 44 61 63 15 93 52 3 66 16 53 36 18 62 35 85 78 37 73 64 87 74 46 26 82 69 49 33 83 89 56 67 71 25 39 94 96 17 21 6 47 68 34 42 57 81 13 10 54 2 48 80 20 77 4 5 59 30 90 95 45 75 8 88 24 41 40 14 97 32 7 9 65 70 100 99 72 58 92 29 79 12 86 43",
"output": "0"
},
{
"input": "100 50\n2 4 82 12 47 63 52 91 87 45 53 1 17 25 64 50 9 13 22 54 21 30 43 24 38 33 68 11 41 78 99 23 28 18 58 67 79 10 71 56 49 61 26 29 59 20 90 74 5 75 89 8 39 95 72 42 66 98 44 32 88 35 92 3 97 55 65 51 77 27 81 76 84 69 73 85 19 46 62 100 60 37 7 36 57 6 14 83 40 48 16 70 96 15 31 93 80 86 94 34",
"output": "1"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "1"
},
{
"input": "100 10\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "10"
},
{
"input": "100 50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "49"
},
{
"input": "100 30\n2 1 2 2 2 2 1 1 1 2 1 1 2 2 1 2 1 2 2 2 2 1 2 1 2 1 1 2 1 1 2 2 2 1 1 2 1 2 2 2 1 1 1 1 1 2 1 1 1 1 1 2 2 2 2 1 2 1 1 1 2 2 2 2 1 2 2 1 1 1 1 2 2 2 1 2 2 1 2 1 1 2 2 2 1 2 2 1 2 1 1 2 1 1 1 1 2 1 1 2",
"output": "11"
},
{
"input": "100 80\n1 1 1 2 2 1 1 2 1 1 1 1 2 2 2 1 2 2 2 2 1 1 2 2 1 1 1 1 2 2 2 1 1 1 1 1 1 1 2 2 2 2 1 2 2 1 2 1 1 1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 2 1 1 1 2 1 1 2 1 2 1 2 2 1 1 2 1 1 1 1 2 2 2 1 2 2 1 2",
"output": "12"
},
{
"input": "100 30\n100 99 100 99 99 100 100 99 100 99 99 100 100 100 99 99 99 100 99 99 99 99 100 99 99 100 100 99 100 99 99 99 100 99 100 100 99 100 100 100 100 100 99 99 100 99 99 100 99 100 99 99 100 100 99 100 99 99 100 99 100 100 100 100 99 99 99 100 99 100 99 100 100 100 99 100 100 100 99 100 99 99 100 100 100 100 99 99 99 100 99 100 100 99 99 99 100 100 99 99",
"output": "14"
},
{
"input": "100 80\n99 100 100 100 99 99 99 99 100 99 99 99 99 99 99 99 99 100 100 99 99 99 99 99 100 99 100 99 100 100 100 100 100 99 100 100 99 99 100 100 100 100 100 99 100 99 100 99 99 99 100 99 99 99 99 99 99 99 99 100 99 100 100 99 99 99 99 100 100 100 99 100 100 100 100 100 99 100 100 100 100 100 100 100 100 99 99 99 99 100 99 100 100 100 100 100 99 100 99 100",
"output": "4"
},
{
"input": "100 30\n100 100 39 39 39 100 100 39 39 100 39 39 100 39 100 39 100 100 100 100 100 39 100 100 100 39 39 39 100 39 100 100 39 39 100 39 39 39 100 100 39 100 39 100 39 39 100 100 39 100 39 100 39 39 39 100 39 100 39 39 39 100 39 39 100 100 39 39 39 100 100 39 39 39 100 100 100 100 39 100 100 100 39 39 100 39 100 100 39 100 39 100 39 39 100 39 39 100 100 100",
"output": "5"
},
{
"input": "100 80\n39 100 39 100 100 100 100 39 39 100 100 39 39 100 39 39 39 39 100 39 39 39 39 100 100 100 100 39 100 39 39 100 100 39 39 100 39 100 39 100 100 39 39 100 39 39 39 100 39 100 39 100 100 100 100 100 100 100 39 100 39 100 100 100 39 39 39 39 39 100 100 100 39 100 100 100 100 39 100 100 39 39 100 39 39 39 100 39 100 39 39 100 100 39 100 39 39 39 100 39",
"output": "6"
},
{
"input": "4 1\n1 2 3 4",
"output": "1"
},
{
"input": "4 1\n1 2 1 2",
"output": "1"
},
{
"input": "4 4\n1 2 6 7",
"output": "1"
},
{
"input": "4 8\n1 2 10 11",
"output": "1"
},
{
"input": "6 2\n1 2 3 4 5 6",
"output": "2"
},
{
"input": "6 1\n1 2 1 2 1 2",
"output": "1"
},
{
"input": "6 4\n1 2 4 5 7 8",
"output": "2"
},
{
"input": "6 3\n1 2 5 10 15 20",
"output": "1"
}
] | 1,532,578,662
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 124
| 0
|
n, b = map(int,input().split())
v = list(map(int,input().split()))
costs = []
odds = 0
evens = 0
for i in range(n-1):
if v[i] % 2 == 0:
evens += 1
else:
odds += 1
if odds == evens and odds != 0 and i != (n-1):
costs.append(abs(v[i+1]-v[i]))
odds = 0
evens = 0
count = 0
acc = 0
for cost in sorted(costs):
if acc + cost <= b:
count += 1
acc = acc + cost
else:
break
print(count)
|
Title: Cutting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are a lot of things which could be cut — trees, paper, "the rope". In this problem you are going to cut a sequence of integers.
There is a sequence of integers, which contains the equal number of even and odd numbers. Given a limited budget, you need to make maximum possible number of cuts such that each resulting segment will have the same number of odd and even integers.
Cuts separate a sequence to continuous (contiguous) segments. You may think about each cut as a break between two adjacent elements in a sequence. So after cutting each element belongs to exactly one segment. Say, $[4, 1, 2, 3, 4, 5, 4, 4, 5, 5]$ $\to$ two cuts $\to$ $[4, 1 | 2, 3, 4, 5 | 4, 4, 5, 5]$. On each segment the number of even elements should be equal to the number of odd elements.
The cost of the cut between $x$ and $y$ numbers is $|x - y|$ bitcoins. Find the maximum possible number of cuts that can be made while spending no more than $B$ bitcoins.
Input Specification:
First line of the input contains an integer $n$ ($2 \le n \le 100$) and an integer $B$ ($1 \le B \le 100$) — the number of elements in the sequence and the number of bitcoins you have.
Second line contains $n$ integers: $a_1$, $a_2$, ..., $a_n$ ($1 \le a_i \le 100$) — elements of the sequence, which contains the equal number of even and odd numbers
Output Specification:
Print the maximum possible number of cuts which can be made while spending no more than $B$ bitcoins.
Demo Input:
['6 4\n1 2 5 10 15 20\n', '4 10\n1 3 2 4\n', '6 100\n1 2 3 4 5 6\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample the optimal answer is to split sequence between $2$ and $5$. Price of this cut is equal to $3$ bitcoins.
In the second sample it is not possible to make even one cut even with unlimited number of bitcoins.
In the third sample the sequence should be cut between $2$ and $3$, and between $4$ and $5$. The total price of the cuts is $1 + 1 = 2$ bitcoins.
|
```python
n, b = map(int,input().split())
v = list(map(int,input().split()))
costs = []
odds = 0
evens = 0
for i in range(n-1):
if v[i] % 2 == 0:
evens += 1
else:
odds += 1
if odds == evens and odds != 0 and i != (n-1):
costs.append(abs(v[i+1]-v[i]))
odds = 0
evens = 0
count = 0
acc = 0
for cost in sorted(costs):
if acc + cost <= b:
count += 1
acc = acc + cost
else:
break
print(count)
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,682,109,115
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 62
| 0
|
stri1 = input()
stri2 = input()
solut = []
for i in range(len(stri1)):
if stri1[i] == stri2[i]:
solut.append("0")
else:
solut.append("1")
print("".join(solut))
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
stri1 = input()
stri2 = input()
solut = []
for i in range(len(stri1)):
if stri1[i] == stri2[i]:
solut.append("0")
else:
solut.append("1")
print("".join(solut))
```
| 3.9845
|
538
|
A
|
Cutting Banner
|
PROGRAMMING
| 1,400
|
[
"brute force",
"implementation"
] | null | null |
A large banner with word CODEFORCES was ordered for the 1000-th onsite round of Codeforcesω that takes place on the Miami beach. Unfortunately, the company that made the banner mixed up two orders and delivered somebody else's banner that contains someone else's word. The word on the banner consists only of upper-case English letters.
There is very little time to correct the mistake. All that we can manage to do is to cut out some substring from the banner, i.e. several consecutive letters. After that all the resulting parts of the banner will be glued into a single piece (if the beginning or the end of the original banner was cut out, only one part remains); it is not allowed change the relative order of parts of the banner (i.e. after a substring is cut, several first and last letters are left, it is allowed only to glue the last letters to the right of the first letters). Thus, for example, for example, you can cut a substring out from string 'TEMPLATE' and get string 'TEMPLE' (if you cut out string AT), 'PLATE' (if you cut out TEM), 'T' (if you cut out EMPLATE), etc.
Help the organizers of the round determine whether it is possible to cut out of the banner some substring in such a way that the remaining parts formed word CODEFORCES.
|
The single line of the input contains the word written on the banner. The word only consists of upper-case English letters. The word is non-empty and its length doesn't exceed 100 characters. It is guaranteed that the word isn't word CODEFORCES.
|
Print 'YES', if there exists a way to cut out the substring, and 'NO' otherwise (without the quotes).
|
[
"CODEWAITFORITFORCES\n",
"BOTTOMCODER\n",
"DECODEFORCES\n",
"DOGEFORCES\n"
] |
[
"YES\n",
"NO\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "CODEWAITFORITFORCES",
"output": "YES"
},
{
"input": "BOTTOMCODER",
"output": "NO"
},
{
"input": "DECODEFORCES",
"output": "YES"
},
{
"input": "DOGEFORCES",
"output": "NO"
},
{
"input": "ABACABA",
"output": "NO"
},
{
"input": "CODEFORCE",
"output": "NO"
},
{
"input": "C",
"output": "NO"
},
{
"input": "NQTSMZEBLY",
"output": "NO"
},
{
"input": "CODEFZORCES",
"output": "YES"
},
{
"input": "EDYKHVZCNTLJUUOQGHPTIOETQNFLLWEKZOHIUAXELGECABVSBIBGQODQXVYFKBYJWTGBYHVSSNTINKWSINWSMALUSIWNJMTCOOVF",
"output": "NO"
},
{
"input": "OCECFDSRDE",
"output": "NO"
},
{
"input": "MDBUWCZFFZKFMJTTJFXRHTGRPREORKDVUXOEMFYSOMSQGHUKGYCRCVJTNDLFDEWFS",
"output": "NO"
},
{
"input": "CODEFYTORCHES",
"output": "NO"
},
{
"input": "BCODEFORCES",
"output": "YES"
},
{
"input": "CVODEFORCES",
"output": "YES"
},
{
"input": "COAKDEFORCES",
"output": "YES"
},
{
"input": "CODFMWEFORCES",
"output": "YES"
},
{
"input": "CODEVCSYRFORCES",
"output": "YES"
},
{
"input": "CODEFXHHPWCVQORCES",
"output": "YES"
},
{
"input": "CODEFORQWUFJLOFFXTXRCES",
"output": "YES"
},
{
"input": "CODEFORBWFURYIDURNRKRDLHCLXZCES",
"output": "YES"
},
{
"input": "CODEFORCQSYSLYKCDFFUPSAZCJIAENCKZUFJZEINQIES",
"output": "YES"
},
{
"input": "CODEFORCEVENMDBQLSVPQIIBGSHBVOPYZXNWVSTVWDRONUREYJJIJIPMEBPQDCPFS",
"output": "YES"
},
{
"input": "CODEFORCESCFNNPAHNHDIPPBAUSPKJYAQDBVZNLSTSDCREZACVLMRFGVKGVHHZLXOHCTJDBQKIDWBUXDUJARLWGFGFCTTXUCAZB",
"output": "YES"
},
{
"input": "CODJRDPDEFOROES",
"output": "NO"
},
{
"input": "CODEFOGSIUZMZCMWAVQHNYFEKIEZQMAZOVEMDRMOEDBHAXPLBLDYYXCVTOOSJZVSQAKFXTBTZFWAYRZEMDEMVDJTDRXXAQBURCES",
"output": "YES"
},
{
"input": "CODEMKUYHAZSGJBQLXTHUCZZRJJJXUSEBOCNZASOKDZHMSGWZSDFBGHXFLABVPDQBJYXSHHAZAKHSTRGOKJYHRVSSUGDCMFOGCES",
"output": "NO"
},
{
"input": "CODEFORCESCODEFORCESCODEFORCESCODEFORCESCODEFORCESCODEFORCESCODEFORCESCODEFORCESCODEFORCES",
"output": "YES"
},
{
"input": "CCODEFORCESODECODEFORCCODEFORCESODCODEFORCESEFCODEFORCESORCODEFORCESCESCESFORCODEFORCESCES",
"output": "NO"
},
{
"input": "CCODEFORCESC",
"output": "NO"
},
{
"input": "CODEAFORBCES",
"output": "NO"
},
{
"input": "CODERRRRRFORCRRRRES",
"output": "NO"
},
{
"input": "CODELFORCELS",
"output": "NO"
},
{
"input": "CPOPDPEPFPOPRPCPEPS",
"output": "NO"
},
{
"input": "COXDEXFORXCEXS",
"output": "NO"
},
{
"input": "CODAAAAAFORCES",
"output": "NO"
},
{
"input": "CAOADEFORCES",
"output": "NO"
},
{
"input": "FORCESXCODE",
"output": "NO"
},
{
"input": "FORCESACODE",
"output": "NO"
},
{
"input": "ACAOADAEFORCES",
"output": "NO"
},
{
"input": "CCODEFORCESS",
"output": "NO"
},
{
"input": "ZCODEFORCEZ",
"output": "NO"
},
{
"input": "CODXEFORXCES",
"output": "NO"
},
{
"input": "CODEFORCEZ",
"output": "NO"
},
{
"input": "CODEFORCEST",
"output": "YES"
},
{
"input": "AXODEFORCES",
"output": "NO"
},
{
"input": "RCODEFORCESR",
"output": "NO"
},
{
"input": "CODECODEFORCESFORCES",
"output": "YES"
},
{
"input": "TTTWWWCODEFORCES",
"output": "YES"
},
{
"input": "CODEFORRCEST",
"output": "NO"
},
{
"input": "UJYTYUCODEFORCES",
"output": "YES"
},
{
"input": "CODEXXXXXXXXXXXXXXXXXXCODEFORCESXXXXXXXXXXXXXXXXXXXXXFORCES",
"output": "YES"
},
{
"input": "COXEDYFORCES",
"output": "NO"
},
{
"input": "UJYTYCODEFORCES",
"output": "YES"
},
{
"input": "UJYTCODEFORCES",
"output": "YES"
}
] | 1,629,382,578
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 78
| 6,758,400
|
# Problem: A. Cutting Banner
# Contest: Codeforces - Codeforces Round #300
# URL: https://codeforces.com/contest/538/problem/A
# Memory Limit: 256 MB
# Time Limit: 2000 ms
# Powered by CP Editor (https://github.com/cpeditor/cpeditor)
from sys import stdin
def get_ints(): return list(map(int, stdin.readline().strip().split()))
t = "CODEFORCES"
s = input()
n = len(s)
for i in range(n):
for j in range(n+1):
if s[:i]+s[j:] == t:
print("YES")
exit()
print("NO")
|
Title: Cutting Banner
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A large banner with word CODEFORCES was ordered for the 1000-th onsite round of Codeforcesω that takes place on the Miami beach. Unfortunately, the company that made the banner mixed up two orders and delivered somebody else's banner that contains someone else's word. The word on the banner consists only of upper-case English letters.
There is very little time to correct the mistake. All that we can manage to do is to cut out some substring from the banner, i.e. several consecutive letters. After that all the resulting parts of the banner will be glued into a single piece (if the beginning or the end of the original banner was cut out, only one part remains); it is not allowed change the relative order of parts of the banner (i.e. after a substring is cut, several first and last letters are left, it is allowed only to glue the last letters to the right of the first letters). Thus, for example, for example, you can cut a substring out from string 'TEMPLATE' and get string 'TEMPLE' (if you cut out string AT), 'PLATE' (if you cut out TEM), 'T' (if you cut out EMPLATE), etc.
Help the organizers of the round determine whether it is possible to cut out of the banner some substring in such a way that the remaining parts formed word CODEFORCES.
Input Specification:
The single line of the input contains the word written on the banner. The word only consists of upper-case English letters. The word is non-empty and its length doesn't exceed 100 characters. It is guaranteed that the word isn't word CODEFORCES.
Output Specification:
Print 'YES', if there exists a way to cut out the substring, and 'NO' otherwise (without the quotes).
Demo Input:
['CODEWAITFORITFORCES\n', 'BOTTOMCODER\n', 'DECODEFORCES\n', 'DOGEFORCES\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'NO\n']
Note:
none
|
```python
# Problem: A. Cutting Banner
# Contest: Codeforces - Codeforces Round #300
# URL: https://codeforces.com/contest/538/problem/A
# Memory Limit: 256 MB
# Time Limit: 2000 ms
# Powered by CP Editor (https://github.com/cpeditor/cpeditor)
from sys import stdin
def get_ints(): return list(map(int, stdin.readline().strip().split()))
t = "CODEFORCES"
s = input()
n = len(s)
for i in range(n):
for j in range(n+1):
if s[:i]+s[j:] == t:
print("YES")
exit()
print("NO")
```
| 3
|
|
851
|
B
|
Arpa and an exam about geometry
|
PROGRAMMING
| 1,400
|
[
"geometry",
"math"
] | null | null |
Arpa is taking a geometry exam. Here is the last problem of the exam.
You are given three points *a*,<=*b*,<=*c*.
Find a point and an angle such that if we rotate the page around the point by the angle, the new position of *a* is the same as the old position of *b*, and the new position of *b* is the same as the old position of *c*.
Arpa is doubting if the problem has a solution or not (i.e. if there exists a point and an angle satisfying the condition). Help Arpa determine if the question has a solution or not.
|
The only line contains six integers *a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*c**x*,<=*c**y* (|*a**x*|,<=|*a**y*|,<=|*b**x*|,<=|*b**y*|,<=|*c**x*|,<=|*c**y*|<=≤<=109). It's guaranteed that the points are distinct.
|
Print "Yes" if the problem has a solution, "No" otherwise.
You can print each letter in any case (upper or lower).
|
[
"0 1 1 1 1 0\n",
"1 1 0 0 1000 1000\n"
] |
[
"Yes\n",
"No\n"
] |
In the first sample test, rotate the page around (0.5, 0.5) by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9d845923f4d356a48d8ede337db0303821311f0c.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test, you can't find any solution.
| 1,000
|
[
{
"input": "0 1 1 1 1 0",
"output": "Yes"
},
{
"input": "1 1 0 0 1000 1000",
"output": "No"
},
{
"input": "1 0 2 0 3 0",
"output": "No"
},
{
"input": "3 4 0 0 4 3",
"output": "Yes"
},
{
"input": "-1000000000 1 0 0 1000000000 1",
"output": "Yes"
},
{
"input": "49152 0 0 0 0 81920",
"output": "No"
},
{
"input": "1 -1 4 4 2 -3",
"output": "No"
},
{
"input": "-2 -2 1 4 -2 0",
"output": "No"
},
{
"input": "5 0 4 -2 0 1",
"output": "No"
},
{
"input": "-4 -3 2 -1 -3 4",
"output": "No"
},
{
"input": "-3 -3 5 2 3 -1",
"output": "No"
},
{
"input": "-1000000000 -1000000000 0 0 1000000000 999999999",
"output": "No"
},
{
"input": "-1000000000 -1000000000 0 0 1000000000 1000000000",
"output": "No"
},
{
"input": "-357531221 381512519 -761132895 -224448284 328888775 -237692564",
"output": "No"
},
{
"input": "264193194 -448876521 736684426 -633906160 -328597212 -47935734",
"output": "No"
},
{
"input": "419578772 -125025887 169314071 89851312 961404059 21419450",
"output": "No"
},
{
"input": "-607353321 -620687860 248029390 477864359 728255275 -264646027",
"output": "No"
},
{
"input": "299948862 -648908808 338174789 841279400 -850322448 350263551",
"output": "No"
},
{
"input": "48517753 416240699 7672672 272460100 -917845051 199790781",
"output": "No"
},
{
"input": "-947393823 -495674431 211535284 -877153626 -522763219 -778236665",
"output": "No"
},
{
"input": "-685673792 -488079395 909733355 385950193 -705890324 256550506",
"output": "No"
},
{
"input": "-326038504 547872194 49630307 713863100 303770000 -556852524",
"output": "No"
},
{
"input": "-706921242 -758563024 -588592101 -443440080 858751713 238854303",
"output": "No"
},
{
"input": "-1000000000 -1000000000 0 1000000000 1000000000 -1000000000",
"output": "Yes"
},
{
"input": "1000000000 1000000000 0 -1000000000 -1000000000 1000000000",
"output": "Yes"
},
{
"input": "-999999999 -1000000000 0 0 1000000000 999999999",
"output": "Yes"
},
{
"input": "-1000000000 -999999999 0 0 1000000000 999999999",
"output": "No"
},
{
"input": "-1 -1000000000 0 1000000000 1 -1000000000",
"output": "Yes"
},
{
"input": "0 1000000000 1 0 0 -1000000000",
"output": "Yes"
},
{
"input": "0 1000000000 0 0 0 -1000000000",
"output": "No"
},
{
"input": "0 1 1 2 2 3",
"output": "No"
},
{
"input": "999999999 1000000000 0 0 -1000000000 -999999999",
"output": "Yes"
},
{
"input": "0 0 1 1 2 0",
"output": "Yes"
},
{
"input": "0 0 1 1 2 2",
"output": "No"
},
{
"input": "1 1 2 2 3 3",
"output": "No"
},
{
"input": "0 2 0 3 0 4",
"output": "No"
},
{
"input": "1 1 1 2 1 3",
"output": "No"
},
{
"input": "0 0 3 4 3 9",
"output": "Yes"
},
{
"input": "589824 196608 262144 196608 0 0",
"output": "Yes"
},
{
"input": "0 0 1000000000 1 1000000000 -999999999",
"output": "No"
},
{
"input": "0 0 2 45 0 90",
"output": "Yes"
},
{
"input": "0 0 0 2 0 1",
"output": "No"
},
{
"input": "0 2 4 5 4 0",
"output": "Yes"
},
{
"input": "0 0 2 0 4 0",
"output": "No"
},
{
"input": "1 1 3 3 5 5",
"output": "No"
},
{
"input": "1 1 2 2 3 1",
"output": "Yes"
}
] | 1,508,530,392
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 61
| 5,529,600
|
def main():
ax, ay, bx, by, cx, cy = [int(i) for i in input().split()]
if ax*by + bx*cy + cx*ay - bx*ay - cx*by - ax*cy == 0:
print("No")
elif (bx - ax)**2 + (by - ay)**2 == (cx - bx)**2 + (cy - by)**2:
print("Yes")
else:
print("No")
main()
# 1508530390696
|
Title: Arpa and an exam about geometry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arpa is taking a geometry exam. Here is the last problem of the exam.
You are given three points *a*,<=*b*,<=*c*.
Find a point and an angle such that if we rotate the page around the point by the angle, the new position of *a* is the same as the old position of *b*, and the new position of *b* is the same as the old position of *c*.
Arpa is doubting if the problem has a solution or not (i.e. if there exists a point and an angle satisfying the condition). Help Arpa determine if the question has a solution or not.
Input Specification:
The only line contains six integers *a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*c**x*,<=*c**y* (|*a**x*|,<=|*a**y*|,<=|*b**x*|,<=|*b**y*|,<=|*c**x*|,<=|*c**y*|<=≤<=109). It's guaranteed that the points are distinct.
Output Specification:
Print "Yes" if the problem has a solution, "No" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['0 1 1 1 1 0\n', '1 1 0 0 1000 1000\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first sample test, rotate the page around (0.5, 0.5) by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9d845923f4d356a48d8ede337db0303821311f0c.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test, you can't find any solution.
|
```python
def main():
ax, ay, bx, by, cx, cy = [int(i) for i in input().split()]
if ax*by + bx*cy + cx*ay - bx*ay - cx*by - ax*cy == 0:
print("No")
elif (bx - ax)**2 + (by - ay)**2 == (cx - bx)**2 + (cy - by)**2:
print("Yes")
else:
print("No")
main()
# 1508530390696
```
| 3
|
|
774
|
D
|
Lie or Truth
|
PROGRAMMING
| 1,500
|
[
"*special",
"constructive algorithms",
"implementation",
"sortings"
] | null | null |
Vasya has a sequence of cubes and exactly one integer is written on each cube. Vasya exhibited all his cubes in a row. So the sequence of numbers written on the cubes in the order from the left to the right equals to *a*1,<=*a*2,<=...,<=*a**n*.
While Vasya was walking, his little brother Stepan played with Vasya's cubes and changed their order, so now the sequence of numbers written on the cubes became equal to *b*1,<=*b*2,<=...,<=*b**n*.
Stepan said that he swapped only cubes which where on the positions between *l* and *r*, inclusive, and did not remove or add any other cubes (i. e. he said that he reordered cubes between positions *l* and *r*, inclusive, in some way).
Your task is to determine if it is possible that Stepan said the truth, or it is guaranteed that Stepan deceived his brother.
|
The first line contains three integers *n*, *l*, *r* (1<=≤<=*n*<=≤<=105, 1<=≤<=*l*<=≤<=*r*<=≤<=*n*) — the number of Vasya's cubes and the positions told by Stepan.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of integers written on cubes in the Vasya's order.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of integers written on cubes after Stepan rearranged their order.
It is guaranteed that Stepan did not remove or add other cubes, he only rearranged Vasya's cubes.
|
Print "LIE" (without quotes) if it is guaranteed that Stepan deceived his brother. In the other case, print "TRUTH" (without quotes).
|
[
"5 2 4\n3 4 2 3 1\n3 2 3 4 1\n",
"3 1 2\n1 2 3\n3 1 2\n",
"4 2 4\n1 1 1 1\n1 1 1 1\n"
] |
[
"TRUTH\n",
"LIE\n",
"TRUTH\n"
] |
In the first example there is a situation when Stepan said the truth. Initially the sequence of integers on the cubes was equal to [3, 4, 2, 3, 1]. Stepan could at first swap cubes on positions 2 and 3 (after that the sequence of integers on cubes became equal to [3, 2, 4, 3, 1]), and then swap cubes in positions 3 and 4 (after that the sequence of integers on cubes became equal to [3, 2, 3, 4, 1]).
In the second example it is not possible that Stepan said truth because he said that he swapped cubes only between positions 1 and 2, but we can see that it is guaranteed that he changed the position of the cube which was on the position 3 at first. So it is guaranteed that Stepan deceived his brother.
In the third example for any values *l* and *r* there is a situation when Stepan said the truth.
| 0
|
[
{
"input": "5 2 4\n3 4 2 3 1\n3 2 3 4 1",
"output": "TRUTH"
},
{
"input": "3 1 2\n1 2 3\n3 1 2",
"output": "LIE"
},
{
"input": "4 2 4\n1 1 1 1\n1 1 1 1",
"output": "TRUTH"
},
{
"input": "5 1 3\n2 2 2 1 2\n2 2 2 1 2",
"output": "TRUTH"
},
{
"input": "7 1 4\n2 5 5 5 4 3 4\n2 5 5 5 4 3 4",
"output": "TRUTH"
},
{
"input": "10 1 10\n6 7 6 1 10 10 9 5 3 9\n7 10 9 6 1 5 9 3 10 6",
"output": "TRUTH"
},
{
"input": "1 1 1\n1\n1",
"output": "TRUTH"
},
{
"input": "4 3 4\n1 2 3 4\n2 1 3 4",
"output": "LIE"
},
{
"input": "7 2 4\n1 2 3 4 5 7 6\n1 2 3 4 5 6 7",
"output": "LIE"
},
{
"input": "5 1 2\n1 2 3 4 5\n1 2 3 5 4",
"output": "LIE"
},
{
"input": "8 3 6\n5 3 1 1 1 1 3 5\n3 3 1 1 1 1 5 5",
"output": "LIE"
},
{
"input": "4 2 2\n2 1 2 2\n1 2 2 2",
"output": "LIE"
}
] | 1,686,493,729
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 52
| 140
| 19,046,400
|
import sys
input = lambda: sys.stdin.readline().rstrip()
from collections import deque,defaultdict,Counter
from itertools import permutations,combinations
from bisect import *
from heapq import *
from math import ceil,gcd,lcm,floor,comb
N,L,R = map(int,input().split())
A = list(map(int,input().split()))
B = list(map(int,input().split()))
a,b = sorted(A[L-1:R]),sorted(B[L-1:R])
num = 0
for i in range(L-1,R):
A[i] = a[num]
B[i] = b[num]
num+=1
if A==B:
print("TRUTH")
else:
print("LIE")
|
Title: Lie or Truth
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has a sequence of cubes and exactly one integer is written on each cube. Vasya exhibited all his cubes in a row. So the sequence of numbers written on the cubes in the order from the left to the right equals to *a*1,<=*a*2,<=...,<=*a**n*.
While Vasya was walking, his little brother Stepan played with Vasya's cubes and changed their order, so now the sequence of numbers written on the cubes became equal to *b*1,<=*b*2,<=...,<=*b**n*.
Stepan said that he swapped only cubes which where on the positions between *l* and *r*, inclusive, and did not remove or add any other cubes (i. e. he said that he reordered cubes between positions *l* and *r*, inclusive, in some way).
Your task is to determine if it is possible that Stepan said the truth, or it is guaranteed that Stepan deceived his brother.
Input Specification:
The first line contains three integers *n*, *l*, *r* (1<=≤<=*n*<=≤<=105, 1<=≤<=*l*<=≤<=*r*<=≤<=*n*) — the number of Vasya's cubes and the positions told by Stepan.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of integers written on cubes in the Vasya's order.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of integers written on cubes after Stepan rearranged their order.
It is guaranteed that Stepan did not remove or add other cubes, he only rearranged Vasya's cubes.
Output Specification:
Print "LIE" (without quotes) if it is guaranteed that Stepan deceived his brother. In the other case, print "TRUTH" (without quotes).
Demo Input:
['5 2 4\n3 4 2 3 1\n3 2 3 4 1\n', '3 1 2\n1 2 3\n3 1 2\n', '4 2 4\n1 1 1 1\n1 1 1 1\n']
Demo Output:
['TRUTH\n', 'LIE\n', 'TRUTH\n']
Note:
In the first example there is a situation when Stepan said the truth. Initially the sequence of integers on the cubes was equal to [3, 4, 2, 3, 1]. Stepan could at first swap cubes on positions 2 and 3 (after that the sequence of integers on cubes became equal to [3, 2, 4, 3, 1]), and then swap cubes in positions 3 and 4 (after that the sequence of integers on cubes became equal to [3, 2, 3, 4, 1]).
In the second example it is not possible that Stepan said truth because he said that he swapped cubes only between positions 1 and 2, but we can see that it is guaranteed that he changed the position of the cube which was on the position 3 at first. So it is guaranteed that Stepan deceived his brother.
In the third example for any values *l* and *r* there is a situation when Stepan said the truth.
|
```python
import sys
input = lambda: sys.stdin.readline().rstrip()
from collections import deque,defaultdict,Counter
from itertools import permutations,combinations
from bisect import *
from heapq import *
from math import ceil,gcd,lcm,floor,comb
N,L,R = map(int,input().split())
A = list(map(int,input().split()))
B = list(map(int,input().split()))
a,b = sorted(A[L-1:R]),sorted(B[L-1:R])
num = 0
for i in range(L-1,R):
A[i] = a[num]
B[i] = b[num]
num+=1
if A==B:
print("TRUTH")
else:
print("LIE")
```
| 3
|
|
818
|
A
|
Diplomas and Certificates
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
There are *n* students who have taken part in an olympiad. Now it's time to award the students.
Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners.
You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
|
The first (and the only) line of input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
|
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible.
It's possible that there are no winners.
|
[
"18 2\n",
"9 10\n",
"1000000000000 5\n",
"1000000000000 499999999999\n"
] |
[
"3 6 9\n",
"0 0 9\n",
"83333333333 416666666665 500000000002\n",
"1 499999999999 500000000000\n"
] |
none
| 0
|
[
{
"input": "18 2",
"output": "3 6 9"
},
{
"input": "9 10",
"output": "0 0 9"
},
{
"input": "1000000000000 5",
"output": "83333333333 416666666665 500000000002"
},
{
"input": "1000000000000 499999999999",
"output": "1 499999999999 500000000000"
},
{
"input": "1 1",
"output": "0 0 1"
},
{
"input": "5 3",
"output": "0 0 5"
},
{
"input": "42 6",
"output": "3 18 21"
},
{
"input": "1000000000000 1000",
"output": "499500499 499500499000 500000000501"
},
{
"input": "999999999999 999999",
"output": "499999 499998500001 500000999999"
},
{
"input": "732577309725 132613",
"output": "2762066 366285858458 366288689201"
},
{
"input": "152326362626 15",
"output": "4760198832 71402982480 76163181314"
},
{
"input": "2 1",
"output": "0 0 2"
},
{
"input": "1000000000000 500000000000",
"output": "0 0 1000000000000"
},
{
"input": "100000000000 50000000011",
"output": "0 0 100000000000"
},
{
"input": "1000000000000 32416187567",
"output": "15 486242813505 513757186480"
},
{
"input": "1000000000000 7777777777",
"output": "64 497777777728 502222222208"
},
{
"input": "1000000000000 77777777777",
"output": "6 466666666662 533333333332"
},
{
"input": "100000000000 578485652",
"output": "86 49749766072 50250233842"
},
{
"input": "999999999999 10000000000",
"output": "49 490000000000 509999999950"
},
{
"input": "7 2",
"output": "1 2 4"
},
{
"input": "420506530901 752346673804",
"output": "0 0 420506530901"
},
{
"input": "960375521135 321688347872",
"output": "1 321688347872 638687173262"
},
{
"input": "1000000000000 1000000000000",
"output": "0 0 1000000000000"
},
{
"input": "99999999999 15253636363",
"output": "3 45760909089 54239090907"
},
{
"input": "19 2",
"output": "3 6 10"
},
{
"input": "999999999999 1000000000000",
"output": "0 0 999999999999"
},
{
"input": "1000000000000 5915587276",
"output": "84 496909331184 503090668732"
},
{
"input": "1000000000000 1000000006",
"output": "499 499000002994 500999996507"
},
{
"input": "549755813888 134217728",
"output": "2047 274743689216 275012122625"
},
{
"input": "99999999999 3333333",
"output": "14999 49996661667 50003323333"
},
{
"input": "9 1",
"output": "2 2 5"
},
{
"input": "1000000000000 250000000001",
"output": "1 250000000001 749999999998"
},
{
"input": "5 1",
"output": "1 1 3"
},
{
"input": "3107038133 596040207",
"output": "2 1192080414 1914957717"
},
{
"input": "1000000000000 73786977",
"output": "6776 499980556152 500019437072"
},
{
"input": "1000000000000 73786976",
"output": "6776 499980549376 500019443848"
},
{
"input": "1000000000000 25000000000",
"output": "19 475000000000 524999999981"
},
{
"input": "216929598879 768233755932",
"output": "0 0 216929598879"
},
{
"input": "1000000000000 250000000000",
"output": "1 250000000000 749999999999"
},
{
"input": "1000000000000 100000000001",
"output": "4 400000000004 599999999992"
},
{
"input": "100000000000 100000000001",
"output": "0 0 100000000000"
},
{
"input": "900000000000 100281800001",
"output": "4 401127200004 498872799992"
},
{
"input": "906028900004 109123020071",
"output": "4 436492080284 469536819716"
},
{
"input": "1000000000000 1",
"output": "250000000000 250000000000 500000000000"
}
] | 1,516,853,999
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 62
| 5,632,000
|
n, k = map(int,input().split())
d = 0
g = 0
nul = n
l = 0
r = n
while r-l!=1:
x = (l+r)//2
if x+x//k<=n//2:
if x%k==0:
d = x//k
g = d*k
nul = n - d - g
l = x
else:
r = x
d = l//k
g = d*k
nul = n - d - g
print(d,g,nul)
|
Title: Diplomas and Certificates
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* students who have taken part in an olympiad. Now it's time to award the students.
Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners.
You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
Input Specification:
The first (and the only) line of input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
Output Specification:
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible.
It's possible that there are no winners.
Demo Input:
['18 2\n', '9 10\n', '1000000000000 5\n', '1000000000000 499999999999\n']
Demo Output:
['3 6 9\n', '0 0 9\n', '83333333333 416666666665 500000000002\n', '1 499999999999 500000000000\n']
Note:
none
|
```python
n, k = map(int,input().split())
d = 0
g = 0
nul = n
l = 0
r = n
while r-l!=1:
x = (l+r)//2
if x+x//k<=n//2:
if x%k==0:
d = x//k
g = d*k
nul = n - d - g
l = x
else:
r = x
d = l//k
g = d*k
nul = n - d - g
print(d,g,nul)
```
| 3
|
|
918
|
A
|
Eleven
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
|
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
Print Eleven's new name on the first and only line of output.
|
[
"8\n",
"15\n"
] |
[
"OOOoOooO\n",
"OOOoOooOooooOoo\n"
] |
none
| 500
|
[
{
"input": "8",
"output": "OOOoOooO"
},
{
"input": "15",
"output": "OOOoOooOooooOoo"
},
{
"input": "85",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooo"
},
{
"input": "381",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooo"
},
{
"input": "805",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1000",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1",
"output": "O"
},
{
"input": "2",
"output": "OO"
},
{
"input": "3",
"output": "OOO"
},
{
"input": "5",
"output": "OOOoO"
},
{
"input": "17",
"output": "OOOoOooOooooOoooo"
},
{
"input": "49",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooo"
},
{
"input": "256",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooo"
},
{
"input": "512",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "933",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "61",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooo"
},
{
"input": "781",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "999",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
}
] | 1,592,548,012
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 18
| 155
| 1,433,600
|
n=int(input())
f=0
s=1
lst=[]
while f<=(n+1):
lst.append(f)
f,s=s,f+s
for i in range(1,n+1):
if i in lst:
print('O',end='')
else:
print('o',end='')
print()
|
Title: Eleven
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
Input Specification:
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
Print Eleven's new name on the first and only line of output.
Demo Input:
['8\n', '15\n']
Demo Output:
['OOOoOooO\n', 'OOOoOooOooooOoo\n']
Note:
none
|
```python
n=int(input())
f=0
s=1
lst=[]
while f<=(n+1):
lst.append(f)
f,s=s,f+s
for i in range(1,n+1):
if i in lst:
print('O',end='')
else:
print('o',end='')
print()
```
| 3
|
|
794
|
B
|
Cutting Carrot
|
PROGRAMMING
| 1,200
|
[
"geometry",
"math"
] | null | null |
Igor the analyst has adopted *n* little bunnies. As we all know, bunnies love carrots. Thus, Igor has bought a carrot to be shared between his bunnies. Igor wants to treat all the bunnies equally, and thus he wants to cut the carrot into *n* pieces of equal area.
Formally, the carrot can be viewed as an isosceles triangle with base length equal to 1 and height equal to *h*. Igor wants to make *n*<=-<=1 cuts parallel to the base to cut the carrot into *n* pieces. He wants to make sure that all *n* pieces have the same area. Can you help Igor determine where to cut the carrot so that each piece have equal area?
|
The first and only line of input contains two space-separated integers, *n* and *h* (2<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=105).
|
The output should contain *n*<=-<=1 real numbers *x*1,<=*x*2,<=...,<=*x**n*<=-<=1. The number *x**i* denotes that the *i*-th cut must be made *x**i* units away from the apex of the carrot. In addition, 0<=<<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=-<=1<=<<=*h* must hold.
Your output will be considered correct if absolute or relative error of every number in your output doesn't exceed 10<=-<=6.
Formally, let your answer be *a*, and the jury's answer be *b*. Your answer is considered correct if .
|
[
"3 2\n",
"2 100000\n"
] |
[
"1.154700538379 1.632993161855\n",
"70710.678118654752\n"
] |
Definition of isosceles triangle: [https://en.wikipedia.org/wiki/Isosceles_triangle](https://en.wikipedia.org/wiki/Isosceles_triangle).
| 1,000
|
[
{
"input": "3 2",
"output": "1.154700538379 1.632993161855"
},
{
"input": "2 100000",
"output": "70710.678118654752"
},
{
"input": "1000 100000",
"output": "3162.277660168379 4472.135954999579 5477.225575051661 6324.555320336759 7071.067811865475 7745.966692414834 8366.600265340755 8944.271909999159 9486.832980505138 10000.000000000000 10488.088481701515 10954.451150103322 11401.754250991380 11832.159566199232 12247.448713915890 12649.110640673517 13038.404810405297 13416.407864998738 13784.048752090222 14142.135623730950 14491.376746189439 14832.396974191326 15165.750888103101 15491.933384829668 15811.388300841897 16124.515496597099 16431.676725154983 16733.2..."
},
{
"input": "2 1",
"output": "0.707106781187"
},
{
"input": "1000 1",
"output": "0.031622776602 0.044721359550 0.054772255751 0.063245553203 0.070710678119 0.077459666924 0.083666002653 0.089442719100 0.094868329805 0.100000000000 0.104880884817 0.109544511501 0.114017542510 0.118321595662 0.122474487139 0.126491106407 0.130384048104 0.134164078650 0.137840487521 0.141421356237 0.144913767462 0.148323969742 0.151657508881 0.154919333848 0.158113883008 0.161245154966 0.164316767252 0.167332005307 0.170293863659 0.173205080757 0.176068168617 0.178885438200 0.181659021246 0.184390889146 0..."
},
{
"input": "20 17",
"output": "3.801315561750 5.375872022286 6.584071688553 7.602631123499 8.500000000000 9.311283477588 10.057335631269 10.751744044572 11.403946685249 12.020815280171 12.607537428063 13.168143377105 13.705838172108 14.223220451079 14.722431864335 15.205262246999 15.673225577398 16.127616066859 16.569550386175"
},
{
"input": "999 1",
"output": "0.031638599858 0.044743737014 0.054799662435 0.063277199717 0.070746059996 0.077498425829 0.083707867056 0.089487474029 0.094915799575 0.100050037531 0.104933364623 0.109599324870 0.114074594073 0.118380800867 0.122535770349 0.126554399434 0.130449289063 0.134231211043 0.137909459498 0.141492119993 0.144986278734 0.148398187395 0.151733394554 0.154996851658 0.158192999292 0.161325838061 0.164398987305 0.167415734111 0.170379074505 0.173291748303 0.176156268782 0.178974948057 0.181749918935 0.184483153795 0..."
},
{
"input": "998 99999",
"output": "3165.413034717700 4476.570044210349 5482.656203071844 6330.826069435401 7078.078722492680 7753.646760213179 8374.895686665300 8953.140088420697 9496.239104153101 10009.914924893578 10498.487342658843 10965.312406143687 11413.059004696742 11843.891063542002 12259.591967329534 12661.652138870802 13051.332290848021 13429.710132631046 13797.715532900862 14156.157444985360 14505.744837393740 14847.103184390411 15180.787616204127 15507.293520426358 15827.065173588502 16140.502832606510 16447.968609215531 16749.7..."
},
{
"input": "574 29184",
"output": "1218.116624752432 1722.677051277028 2109.839883615525 2436.233249504864 2723.791577469041 2983.764177844748 3222.833656968322 3445.354102554056 3654.349874257297 3852.022989934325 4040.035795197963 4219.679767231051 4391.981950040022 4557.775066957079 4717.745401404559 4872.466499009729 5022.423508175150 5168.031153831084 5309.647268742708 5447.583154938083 5582.111638212139 5713.473414041731 5841.882108059006 5967.528355689497 6090.583123762161 6211.200439444432 6329.519650846576 6445.667313936643 6559.75..."
},
{
"input": "2 5713",
"output": "4039.701040918746"
},
{
"input": "937 23565",
"output": "769.834993893392 1088.711089153444 1333.393322867831 1539.669987786784 1721.403377803760 1885.702921177414 2036.791944396843 2177.422178306887 2309.504981680176 2434.432003204934 2553.253825229922 2666.786645735663 2775.679544129132 2880.458791498282 2981.558110676796 3079.339975573568 3174.110994119182 3266.133267460331 3355.632941582547 3442.806755607520 3527.827132142336 3610.846187821139 3691.998931463184 3771.405842354828 3849.174969466960 3925.403656108988 4000.179968603494 4073.583888793686 4145.688..."
},
{
"input": "693 39706",
"output": "1508.306216302128 2133.067107306117 2612.463000007259 3016.612432604256 3372.675230537060 3694.580605808168 3990.603149268227 4266.134214612233 4524.918648906384 4769.683052505315 5002.485788434792 5224.926000014517 5438.275401978402 5643.565095743912 5841.644856719264 6033.224865208513 6218.905845589392 6399.201321918350 6574.554372775177 6745.350461074120 6911.927407376938 7074.583247583148 7233.582498950279 7389.161211616337 7541.531081510641 7690.882829397851 7837.389000021776 7981.206298536455 8122.47..."
},
{
"input": "449 88550",
"output": "4178.932872810542 5909.903544975429 7238.124057127628 8357.865745621084 9344.377977012855 10236.253207728862 11056.417127089408 11819.807089950858 12536.798618431626 13214.946067032045 13859.952363194553 14476.248114255256 15067.356749640443 15636.135052384012 16184.937421313947 16715.731491242168 17230.181636963718 17729.710634926286 18215.546084421264 18688.755954025709 19150.276213793575 19600.932605874766 20041.458005232581 20472.506415457724 20894.664364052710 21308.460264455309 21714.372171382883 221..."
},
{
"input": "642 37394",
"output": "1475.823459881026 2087.129552632132 2556.201215516026 2951.646919762052 3300.041579082908 3615.014427137354 3904.661853880105 4174.259105264265 4427.470379643078 4666.963557534173 4894.752673229489 5112.402431032051 5321.157158133711 5522.025750238117 5715.839682061424 5903.293839524104 6084.976009853978 6261.388657896397 6432.965320127946 6600.083158165816 6763.072717296425 6922.225614943105 7077.800671741869 7230.028854274709 7379.117299405130 7525.252620551370 7668.603646548077 7809.323707760210 7947.55..."
},
{
"input": "961 53535",
"output": "1726.935483870968 2442.255582633666 2991.139999458060 3453.870967741935 3861.545134691976 4230.110754190240 4569.041820575576 4884.511165267332 5180.806451612903 5461.049501197232 5727.597037150849 5982.279998916119 6226.554436514989 6461.600909707837 6688.392369006905 6907.741935483871 7120.337408627144 7326.766747900998 7527.537256208063 7723.090269383951 7913.812575143900 8100.045409746687 8282.091632275692 8460.221508380480 8634.677419354839 8805.677730973862 8973.419998374179 9138.083641151152 9299.83..."
},
{
"input": "4 31901",
"output": "15950.500000000000 22557.413426632053 27627.076406127377"
},
{
"input": "4 23850",
"output": "11925.000000000000 16864.496731299158 20654.705880258862"
},
{
"input": "4 72694",
"output": "36347.000000000000 51402.420351574886 62954.850702705983"
},
{
"input": "4 21538",
"output": "10769.000000000000 15229.665853195861 18652.455146709240"
},
{
"input": "4 70383",
"output": "35191.500000000000 49768.296580252774 60953.465994560145"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "5 1",
"output": "0.447213595500 0.632455532034 0.774596669241 0.894427191000"
},
{
"input": "20 1",
"output": "0.223606797750 0.316227766017 0.387298334621 0.447213595500 0.500000000000 0.547722557505 0.591607978310 0.632455532034 0.670820393250 0.707106781187 0.741619848710 0.774596669241 0.806225774830 0.836660026534 0.866025403784 0.894427191000 0.921954445729 0.948683298051 0.974679434481"
},
{
"input": "775 1",
"output": "0.035921060405 0.050800050800 0.062217101684 0.071842120811 0.080321932890 0.087988269013 0.095038192662 0.101600101600 0.107763181216 0.113592366849 0.119136679436 0.124434203368 0.129515225161 0.134404301006 0.139121668728 0.143684241621 0.148106326235 0.152400152400 0.156576272252 0.160643865780 0.164610978351 0.168484707835 0.172271353843 0.175976538026 0.179605302027 0.183162187956 0.186651305051 0.190076385325 0.193440830330 0.196747750735 0.200000000000 0.203200203200 0.206350781829 0.209453975235 0..."
},
{
"input": "531 1",
"output": "0.043396303660 0.061371641193 0.075164602800 0.086792607321 0.097037084957 0.106298800691 0.114815827305 0.122743282386 0.130188910981 0.137231161599 0.143929256529 0.150329205601 0.156467598013 0.162374100149 0.168073161363 0.173585214641 0.178927543753 0.184114923580 0.189160102178 0.194074169913 0.198866846404 0.203546706606 0.208121361089 0.212597601381 0.216981518301 0.221278599182 0.225493808401 0.229631654609 0.233696247231 0.237691344271 0.241620392998 0.245486564773 0.249292785005 0.253041759057 0..."
},
{
"input": "724 1",
"output": "0.037164707312 0.052558833123 0.064371161313 0.074329414625 0.083102811914 0.091034569355 0.098328573097 0.105117666246 0.111494121937 0.117525123681 0.123261389598 0.128742322627 0.133999257852 0.139057601643 0.143938292487 0.148658829249 0.153234013794 0.157676499368 0.161997203441 0.166205623829 0.170310084440 0.174317928887 0.178235674883 0.182069138710 0.185823536562 0.189503567803 0.193113483940 0.196657146194 0.200138073886 0.203559485381 0.206924332929 0.210235332491 0.213494989396 0.216705620524 0..."
},
{
"input": "917 1",
"output": "0.033022909334 0.046701446249 0.057197356781 0.066045818668 0.073841470086 0.080889277691 0.087370405666 0.093402892499 0.099068728003 0.104427608461 0.109524599747 0.114394713561 0.119065792869 0.123560412643 0.127897177895 0.132091637337 0.136156943250 0.140104338748 0.143943524609 0.147682940172 0.151329981692 0.154891174376 0.158372309576 0.161778555382 0.165114546671 0.168384459091 0.171592070342 0.174740811332 0.177833809176 0.180873923568 0.183863777748 0.186805784998 0.189702171441 0.192554995756 0..."
},
{
"input": "458 100",
"output": "4.672693135160 6.608186004551 8.093341918275 9.345386270320 10.448459488214 11.445713905748 12.362783988552 13.216372009102 14.018079405480 14.776353114139 15.497569889795 16.186683836551 16.847634693328 17.483616785299 18.097262694412 18.690772540640 19.266007352363 19.824558013653 20.367797170339 20.896918976429 21.412969991171 21.916873521973 22.409449036367 22.891427811495 23.363465675800 23.826153477212 24.280025754826 24.725567977104 25.163222626003 25.593394344267 26.016454316384 26.432744018204 26...."
}
] | 1,647,695,984
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 46
| 0
|
from math import sqrt
n, h = map(int, input().split())
for i in range(1, n):
print(h*sqrt(i/n), end=' ' if i +1 < n else '\n')
|
Title: Cutting Carrot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Igor the analyst has adopted *n* little bunnies. As we all know, bunnies love carrots. Thus, Igor has bought a carrot to be shared between his bunnies. Igor wants to treat all the bunnies equally, and thus he wants to cut the carrot into *n* pieces of equal area.
Formally, the carrot can be viewed as an isosceles triangle with base length equal to 1 and height equal to *h*. Igor wants to make *n*<=-<=1 cuts parallel to the base to cut the carrot into *n* pieces. He wants to make sure that all *n* pieces have the same area. Can you help Igor determine where to cut the carrot so that each piece have equal area?
Input Specification:
The first and only line of input contains two space-separated integers, *n* and *h* (2<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=105).
Output Specification:
The output should contain *n*<=-<=1 real numbers *x*1,<=*x*2,<=...,<=*x**n*<=-<=1. The number *x**i* denotes that the *i*-th cut must be made *x**i* units away from the apex of the carrot. In addition, 0<=<<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=-<=1<=<<=*h* must hold.
Your output will be considered correct if absolute or relative error of every number in your output doesn't exceed 10<=-<=6.
Formally, let your answer be *a*, and the jury's answer be *b*. Your answer is considered correct if .
Demo Input:
['3 2\n', '2 100000\n']
Demo Output:
['1.154700538379 1.632993161855\n', '70710.678118654752\n']
Note:
Definition of isosceles triangle: [https://en.wikipedia.org/wiki/Isosceles_triangle](https://en.wikipedia.org/wiki/Isosceles_triangle).
|
```python
from math import sqrt
n, h = map(int, input().split())
for i in range(1, n):
print(h*sqrt(i/n), end=' ' if i +1 < n else '\n')
```
| 3
|
|
864
|
B
|
Polycarp and Letters
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
|
Print maximum number of elements in pretty set of positions for string *s*.
|
[
"11\naaaaBaabAbA\n",
"12\nzACaAbbaazzC\n",
"3\nABC\n"
] |
[
"2\n",
"3\n",
"0\n"
] |
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
| 1,000
|
[
{
"input": "11\naaaaBaabAbA",
"output": "2"
},
{
"input": "12\nzACaAbbaazzC",
"output": "3"
},
{
"input": "3\nABC",
"output": "0"
},
{
"input": "1\na",
"output": "1"
},
{
"input": "2\naz",
"output": "2"
},
{
"input": "200\nXbTJZqcbpYuZQEoUrbxlPXAPCtVLrRExpQzxzqzcqsqzsiisswqitswzCtJQxOavicSdBIodideVRKHPojCNHmbnrLgwJlwOpyrJJIhrUePszxSjJGeUgTtOfewPQnPVWhZAtogRPrJLwyShNQaeNsvrJwjuuBOMPCeSckBMISQzGngfOmeyfDObncyeNsihYVtQbSEh",
"output": "8"
},
{
"input": "2\nAZ",
"output": "0"
},
{
"input": "28\nAabcBabcCBNMaaaaabbbbbcccccc",
"output": "3"
},
{
"input": "200\nrsgraosldglhdoorwhkrsehjpuxrjuwgeanjgezhekprzarelduuaxdnspzjuooguuwnzkowkuhzduakdrzpnslauejhrrkalwpurpuuswdgeadlhjwzjgegwpknepazwwleulppwrlgrgedlwdzuodzropsrrkxusjnuzshdkjrxxpgzanzdrpnggdwxarpwohxdepJ",
"output": "17"
},
{
"input": "1\nk",
"output": "1"
},
{
"input": "1\nH",
"output": "0"
},
{
"input": "2\nzG",
"output": "1"
},
{
"input": "2\ngg",
"output": "1"
},
{
"input": "2\nai",
"output": "2"
},
{
"input": "20\npEjVrKWLIFCZjIHgggVU",
"output": "1"
},
{
"input": "20\niFSiiigiYFSKmDnMGcgM",
"output": "2"
},
{
"input": "20\nedxedxxxCQiIVmYEUtLi",
"output": "3"
},
{
"input": "20\nprnchweyabjvzkoqiltm",
"output": "20"
},
{
"input": "35\nQLDZNKFXKVSVLUVHRTDPQYMSTDXBELXBOTS",
"output": "0"
},
{
"input": "35\nbvZWiitgxodztelnYUyljYGnCoWluXTvBLp",
"output": "10"
},
{
"input": "35\nBTexnaeplecllxwlanarpcollawHLVMHIIF",
"output": "10"
},
{
"input": "35\nhhwxqysolegsthsvfcqiryenbujbrrScobu",
"output": "20"
},
{
"input": "26\npbgfqosklxjuzmdheyvawrictn",
"output": "26"
},
{
"input": "100\nchMRWwymTDuZDZuSTvUmmuxvSscnTasyjlwwodhzcoifeahnbmcifyeobbydwparebduoLDCgHlOsPtVRbYGGQXfnkdvrWKIwCRl",
"output": "20"
},
{
"input": "100\nhXYLXKUMBrGkjqQJTGbGWAfmztqqapdbjbhcualhypgnaieKXmhzGMnqXVlcPesskfaEVgvWQTTShRRnEtFahWDyuBzySMpugxCM",
"output": "19"
},
{
"input": "100\nucOgELrgjMrFOgtHzqgvUgtHngKJxdMFKBjfcCppciqmGZXXoiSZibgpadshyljqrwxbomzeutvnhTLGVckZUmyiFPLlwuLBFito",
"output": "23"
},
{
"input": "200\nWTCKAKLVGXSYFVMVJDUYERXNMVNTGWXUGRFCGMYXJQGLODYZTUIDENHYEGFKXFIEUILAMESAXAWZXVCZPJPEYUXBITHMTZOTMKWITGRSFHODKVJHPAHVVWTCTHIVAWAREQXWMPUWQSTPPJFHKGKELBTPUYDAVIUMGASPUEDIODRYXIWCORHOSLIBLOZUNJPHHMXEXOAY",
"output": "0"
},
{
"input": "200\neLCCuYMPPwQoNlCpPOtKWJaQJmWfHeZCKiMSpILHSKjFOYGpRMzMCfMXdDuQdBGNsCNrHIVJzEFfBZcNMwNcFjOFVJvEtUQmLbFNKVHgNDyFkFVQhUTUQDgXhMjJZgFSSiHhMKuTgZQYJqAqKBpHoHddddddddddddddddXSSYNKNnRrKuOjAVKZlRLzCjExPdHaDHBT",
"output": "1"
},
{
"input": "200\nitSYxgOLlwOoAkkkkkzzzzzzzzkzkzkzkkkkkzkzzkzUDJSKybRPBvaIDsNuWImPJvrHkKiMeYukWmtHtgZSyQsgYanZvXNbKXBlFLSUcqRnGWSriAvKxsTkDJfROqaKdzXhvJsPEDATueCraWOGEvRDWjPwXuiNpWsEnCuhDcKWOQxjBkdBqmFatWFkgKsbZuLtRGtY",
"output": "2"
},
{
"input": "200\noggqoqqogoqoggggoggqgooqggogogooogqqgggoqgggqoqogogggogggqgooqgqggqqqoqgqgoooqgqogqoggoqqgqoqgoooqoogooqoogqoqoqqgoqgoqgggogqqqoqoggoqoqqoqggqoggooqqqoqggoggqqqqqqqqqgogqgggggooogogqgggqogqgoqoqogoooq",
"output": "3"
},
{
"input": "200\nCtclUtUnmqFniaLqGRmMoUMeLyFfAgWxIZxdrBarcRQprSOGcdUYsmDbooSuOvBLgrYlgaIjJtFgcxJKHGkCXpYfVKmUbouuIqGstFrrwJzYQqjjqqppqqqqqpqqqjpjjpjqjXRYkfPhGAatOigFuItkKxkjCBLdiNMVGjmdWNMgOOvmaJEdGsWNoaERrINNKqKeQajv",
"output": "3"
},
{
"input": "200\nmeZNrhqtSTSmktGQnnNOTcnyAMTKSixxKQKiagrMqRYBqgbRlsbJhvtNeHVUuMCyZLCnsIixRYrYEAkfQOxSVqXkrPqeCZQksInzRsRKBgvIqlGVPxPQnypknSXjgMjsjElcqGsaJRbegJVAKtWcHoOnzHqzhoKReqBBsOhZYLaYJhmqOMQsizdCsQfjUDHcTtHoeYwu",
"output": "4"
},
{
"input": "200\nvFAYTHJLZaivWzSYmiuDBDUFACDSVbkImnVaXBpCgrbgmTfXKJfoglIkZxWPSeVSFPnHZDNUAqLyhjLXSuAqGLskBlDxjxGPJyGdwzlPfIekwsblIrkxzfhJeNoHywdfAGlJzqXOfQaKceSqViVFTRJEGfACnsFeSFpOYisIHJciqTMNAmgeXeublTvfWoPnddtvKIyF",
"output": "6"
},
{
"input": "200\ngnDdkqJjYvduVYDSsswZDvoCouyaYZTfhmpSakERWLhufZtthWsfbQdTGwhKYjEcrqWBOyxBbiFhdLlIjChLOPiOpYmcrJgDtXsJfmHtLrabyGKOfHQRukEtTzwoqBHfmyVXPebfcpGQacLkGWFwerszjdHpTBXGssYXmGHlcCBgBXyGJqxbVhvDffLyCrZnxonABEXV",
"output": "7"
},
{
"input": "200\nBmggKNRZBXPtJqlJaXLdKKQLDJvXpDuQGupiRQfDwCJCJvAlDDGpPZNOvXkrdKOFOEFBVfrsZjWyHPoKGzXmTAyPJGEmxCyCXpeAdTwbrMtWLmlmGNqxvuxmqpmtpuhrmxxtrquSLFYVlnSYgRJDYHWgHBbziBLZRwCIJNvbtsEdLLxmTbnjkoqSPAuzEeTYLlmejOUH",
"output": "9"
},
{
"input": "200\nMkuxcDWdcnqsrlTsejehQKrTwoOBRCUAywqSnZkDLRmVBDVoOqdZHbrInQQyeRFAjiYYmHGrBbWgWstCPfLPRdNVDXBdqFJsGQfSXbufsiogybEhKDlWfPazIuhpONwGzZWaQNwVnmhTqWdewaklgjwaumXYDGwjSeEcYXjkVtLiYSWULEnTFukIlWQGWsXwWRMJGTcI",
"output": "10"
},
{
"input": "200\nOgMBgYeuMJdjPtLybvwmGDrQEOhliaabEtwulzNEjsfnaznXUMoBbbxkLEwSQzcLrlJdjJCLGVNBxorghPxTYCoqniySJMcilpsqpBAbqdzqRUDVaYOgqGhGrxlIJkyYgkOdTUgRZwpgIkeZFXojLXpDilzirHVVadiHaMrxhzodzpdvhvrzdzxbhmhdpxqqpoDegfFQ",
"output": "11"
},
{
"input": "200\nOLaJOtwultZLiZPSYAVGIbYvbIuZkqFZXwfsqpsavCDmBMStAuUFLBVknWDXNzmiuUYIsUMGxtoadWlPYPqvqSvpYdOiJRxFzGGnnmstniltvitnrmyrblnqyruylummmlsqtqitlbulvtuitiqimuintbimqyurviuntqnnvslynlNYMpYVKYwKVTbIUVdlNGrcFZON",
"output": "12"
},
{
"input": "200\nGAcmlaqfjSAQLvXlkhxujXgSbxdFAwnoxDuldDvYmpUhTWJdcEQSdARLrozJzIgFVCkzPUztWIpaGfiKeqzoXinEjVuoKqyBHmtFjBWcRdBmyjviNlGAIkpikjAimmBgayfphrstfbjexjbttzfzfzaysxfyrjazfhtpghnbbeffjhxrjxpttesgzrnrfbgzzsRsCgmz",
"output": "15"
},
{
"input": "200\nYRvIopNqSTYDhViTqCLMwEbTTIdHkoeuBmAJWhgtOgVxlcHSsavDNzMfpwTghkBvYEtCYQxicLUxdgAcaCzOOgbQYsfnaTXFlFxbeEiGwdNvxwHzkTdKtWlqzalwniDDBDipkxfflpaqkfkgfezbkxdvzemlfohwtgytzzywmwhvzUgPlPdeAVqTPAUZbogQheRXetvT",
"output": "20"
},
{
"input": "200\nNcYVomemswLCUqVRSDKHCknlBmqeSWhVyRzQrnZaOANnTGqsRFMjpczllcEVebqpxdavzppvztxsnfmtcharzqlginndyjkawzurqkxJLXiXKNZTIIxhSQghDpjwzatEqnLMTLxwoEKpHytvWkKFDUcZjLShCiVdocxRvvJtbXHCDGpJvMwRKWLhcTFtswdLUHkbhfau",
"output": "25"
},
{
"input": "200\nDxNZuvkTkQEqdWIkLzcKAwfqvZQiptnTazydSCTIfGjDhLMrlPZiKEsqIdDhgKPAlEvXyzNwWtYorotgkcwydpabjqnzubaksdchucxtkmjzfretdmvlxgklyvicrtftvztsbiUaQorfNIYUOdwQDRsKpxLUiLknbLbinilpPXPTTwLAnXVpMHBaAcKWgDBeOFabPtXU",
"output": "26"
},
{
"input": "4\nabbc",
"output": "3"
},
{
"input": "3\naaa",
"output": "1"
},
{
"input": "3\naba",
"output": "2"
},
{
"input": "3\nabb",
"output": "2"
},
{
"input": "3\nbba",
"output": "2"
},
{
"input": "3\nAaa",
"output": "1"
},
{
"input": "3\nAba",
"output": "2"
},
{
"input": "3\naBa",
"output": "1"
},
{
"input": "3\naAa",
"output": "1"
},
{
"input": "3\naAb",
"output": "1"
},
{
"input": "3\nAaA",
"output": "1"
},
{
"input": "5\naBacd",
"output": "3"
},
{
"input": "5\naAabc",
"output": "3"
}
] | 1,506,854,277
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 62
| 0
|
n=int(input())
s=input()+'ZZ'
j=0
m=0
past=set()
for x in range(n+1):
if s[x].islower() and s[x] not in past:
j+=1
past.add(s[x])
elif s[x].isupper():
m=max(m,j)
j=0
past.clear()
print(m)
|
Title: Polycarp and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
Output Specification:
Print maximum number of elements in pretty set of positions for string *s*.
Demo Input:
['11\naaaaBaabAbA\n', '12\nzACaAbbaazzC\n', '3\nABC\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
|
```python
n=int(input())
s=input()+'ZZ'
j=0
m=0
past=set()
for x in range(n+1):
if s[x].islower() and s[x] not in past:
j+=1
past.add(s[x])
elif s[x].isupper():
m=max(m,j)
j=0
past.clear()
print(m)
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,686,238,453
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
x1, x2, x3 = map(int, input().split())
coordinates = [x1, x2, x3]
coordinates.sort()
median = coordinates[1]
total_distance = abs(x1 - median) + abs(x2 - median) + abs(x3 - median)
print(total_distance)
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
x1, x2, x3 = map(int, input().split())
coordinates = [x1, x2, x3]
coordinates.sort()
median = coordinates[1]
total_distance = abs(x1 - median) + abs(x2 - median) + abs(x3 - median)
print(total_distance)
```
| 3
|
|
570
|
A
|
Elections
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate.
The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index.
At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index.
Determine who will win the elections.
|
The first line of the input contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of candidates and of cities, respectively.
Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*j*<=≤<=*n*, 1<=≤<=*i*<=≤<=*m*, 0<=≤<=*a**ij*<=≤<=109) denotes the number of votes for candidate *j* in city *i*.
It is guaranteed that the total number of people in all the cities does not exceed 109.
|
Print a single number — the index of the candidate who won the elections. The candidates are indexed starting from one.
|
[
"3 3\n1 2 3\n2 3 1\n1 2 1\n",
"3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n"
] |
[
"2",
"1"
] |
Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes.
Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
| 500
|
[
{
"input": "3 3\n1 2 3\n2 3 1\n1 2 1",
"output": "2"
},
{
"input": "3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7",
"output": "1"
},
{
"input": "1 3\n5\n3\n2",
"output": "1"
},
{
"input": "3 1\n1 2 3",
"output": "3"
},
{
"input": "3 1\n100 100 100",
"output": "1"
},
{
"input": "2 2\n1 2\n2 1",
"output": "1"
},
{
"input": "2 2\n2 1\n2 1",
"output": "1"
},
{
"input": "2 2\n1 2\n1 2",
"output": "2"
},
{
"input": "3 3\n0 0 0\n1 1 1\n2 2 2",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6\n3 4 5 6 7\n4 5 6 7 8\n5 6 7 8 9",
"output": "5"
},
{
"input": "4 4\n1 3 1 3\n3 1 3 1\n2 0 0 2\n0 1 1 0",
"output": "1"
},
{
"input": "4 4\n1 4 1 3\n3 1 2 1\n1 0 0 2\n0 1 10 0",
"output": "1"
},
{
"input": "4 4\n1 4 1 300\n3 1 2 1\n5 0 0 2\n0 1 10 100",
"output": "1"
},
{
"input": "5 5\n15 45 15 300 10\n53 15 25 51 10\n5 50 50 2 10\n1000 1 10 100 10\n10 10 10 10 10",
"output": "1"
},
{
"input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "1 100\n859\n441\n272\n47\n355\n345\n612\n569\n545\n599\n410\n31\n720\n303\n58\n537\n561\n730\n288\n275\n446\n955\n195\n282\n153\n455\n996\n121\n267\n702\n769\n560\n353\n89\n990\n282\n801\n335\n573\n258\n722\n768\n324\n41\n249\n125\n557\n303\n664\n945\n156\n884\n985\n816\n433\n65\n976\n963\n85\n647\n46\n877\n665\n523\n714\n182\n377\n549\n994\n385\n184\n724\n447\n99\n766\n353\n494\n747\n324\n436\n915\n472\n879\n582\n928\n84\n627\n156\n972\n651\n159\n372\n70\n903\n590\n480\n184\n540\n270\n892",
"output": "1"
},
{
"input": "100 1\n439 158 619 538 187 153 973 781 610 475 94 947 449 531 220 51 788 118 189 501 54 434 465 902 280 635 688 214 737 327 682 690 683 519 261 923 254 388 529 659 662 276 376 735 976 664 521 285 42 147 187 259 407 977 879 465 522 17 550 701 114 921 577 265 668 812 232 267 135 371 586 201 608 373 771 358 101 412 195 582 199 758 507 882 16 484 11 712 916 699 783 618 405 124 904 257 606 610 230 718",
"output": "54"
},
{
"input": "1 99\n511\n642\n251\n30\n494\n128\n189\n324\n884\n656\n120\n616\n959\n328\n411\n933\n895\n350\n1\n838\n996\n761\n619\n131\n824\n751\n707\n688\n915\n115\n244\n476\n293\n986\n29\n787\n607\n259\n756\n864\n394\n465\n303\n387\n521\n582\n485\n355\n299\n997\n683\n472\n424\n948\n339\n383\n285\n957\n591\n203\n866\n79\n835\n980\n344\n493\n361\n159\n160\n947\n46\n362\n63\n553\n793\n754\n429\n494\n523\n227\n805\n313\n409\n243\n927\n350\n479\n971\n825\n460\n544\n235\n660\n327\n216\n729\n147\n671\n738",
"output": "1"
},
{
"input": "99 1\n50 287 266 159 551 198 689 418 809 43 691 367 160 664 86 805 461 55 127 950 576 351 721 493 972 560 934 885 492 92 321 759 767 989 883 7 127 413 404 604 80 645 666 874 371 718 893 158 722 198 563 293 134 255 742 913 252 378 859 721 502 251 839 284 133 209 962 514 773 124 205 903 785 859 911 93 861 786 747 213 690 69 942 697 211 203 284 961 351 137 962 952 408 249 238 850 944 40 346",
"output": "34"
},
{
"input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "100"
},
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "2 1\n0 0",
"output": "1"
},
{
"input": "2 2\n0 0\n0 0",
"output": "1"
},
{
"input": "2 2\n1 2\n0 0",
"output": "1"
},
{
"input": "3 3\n0 0 0\n0 0 0\n0 0 0",
"output": "1"
},
{
"input": "2 3\n0 0\n0 0\n0 1",
"output": "1"
},
{
"input": "3 2\n1 1 3\n0 0 0",
"output": "1"
},
{
"input": "3 4\n1 10 3\n0 0 0\n0 0 0\n0 0 0",
"output": "1"
},
{
"input": "2 4\n2 1\n1 2\n0 0\n1 2",
"output": "1"
},
{
"input": "2 2\n0 1\n0 1",
"output": "2"
},
{
"input": "2 3\n1 2\n0 0\n2 1",
"output": "1"
},
{
"input": "2 2\n0 0\n4 5",
"output": "1"
},
{
"input": "3 2\n10 15 20\n0 0 0",
"output": "1"
},
{
"input": "3 4\n0 0 0\n0 0 0\n0 0 0\n1 2 3",
"output": "1"
},
{
"input": "3 3\n0 0 0\n0 0 0\n0 0 1",
"output": "1"
},
{
"input": "3 3\n0 0 0\n1 2 3\n1 3 2",
"output": "1"
},
{
"input": "3 1\n0 0 0",
"output": "1"
},
{
"input": "3 3\n0 0 1\n0 0 0\n0 0 0",
"output": "1"
}
] | 1,552,714,174
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 109
| 0
|
m, n = input().split()
cand = []
for i in range (int(m)):
cand.append(0)
for i in range (int(n)):
a = [int(x) for x in input().split()]
cand[a.index(max(a))] += 1
print(cand.index(max(cand)) + 1)
|
Title: Elections
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate.
The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index.
At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index.
Determine who will win the elections.
Input Specification:
The first line of the input contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of candidates and of cities, respectively.
Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*j*<=≤<=*n*, 1<=≤<=*i*<=≤<=*m*, 0<=≤<=*a**ij*<=≤<=109) denotes the number of votes for candidate *j* in city *i*.
It is guaranteed that the total number of people in all the cities does not exceed 109.
Output Specification:
Print a single number — the index of the candidate who won the elections. The candidates are indexed starting from one.
Demo Input:
['3 3\n1 2 3\n2 3 1\n1 2 1\n', '3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n']
Demo Output:
['2', '1']
Note:
Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes.
Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
|
```python
m, n = input().split()
cand = []
for i in range (int(m)):
cand.append(0)
for i in range (int(n)):
a = [int(x) for x in input().split()]
cand[a.index(max(a))] += 1
print(cand.index(max(cand)) + 1)
```
| 3
|
|
1,007
|
A
|
Reorder the Array
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"data structures",
"math",
"sortings",
"two pointers"
] | null | null |
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
|
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
|
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
|
[
"7\n10 1 1 1 5 5 3\n",
"5\n1 1 1 1 1\n"
] |
[
"4\n",
"0\n"
] |
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
| 500
|
[
{
"input": "7\n10 1 1 1 5 5 3",
"output": "4"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "6\n300000000 200000000 300000000 200000000 1000000000 300000000",
"output": "3"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "7\n3 5 2 2 5 2 4",
"output": "4"
},
{
"input": "5\n1 5 4 2 3",
"output": "4"
}
] | 1,664,990,151
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 93
| 20,070,400
|
# from heapq import *
# from collections import deque
def lets_do_it():
n = int(input())
count = {}
for a in input().split():
a = int(a)
count[a] = count.get(a, 0) + 1
max_val = 0
for value in count.values():
max_val = max(max_val, value)
print(n - max_val)
def main():
# test_cases = int(input())
test_cases = 1
while test_cases:
lets_do_it()
test_cases -= 1
main()
|
Title: Reorder the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
Input Specification:
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
Output Specification:
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
Demo Input:
['7\n10 1 1 1 5 5 3\n', '5\n1 1 1 1 1\n']
Demo Output:
['4\n', '0\n']
Note:
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
|
```python
# from heapq import *
# from collections import deque
def lets_do_it():
n = int(input())
count = {}
for a in input().split():
a = int(a)
count[a] = count.get(a, 0) + 1
max_val = 0
for value in count.values():
max_val = max(max_val, value)
print(n - max_val)
def main():
# test_cases = int(input())
test_cases = 1
while test_cases:
lets_do_it()
test_cases -= 1
main()
```
| 3
|
|
525
|
C
|
Ilya and Sticks
|
PROGRAMMING
| 1,600
|
[
"greedy",
"math",
"sortings"
] | null | null |
In the evening, after the contest Ilya was bored, and he really felt like maximizing. He remembered that he had a set of *n* sticks and an instrument. Each stick is characterized by its length *l**i*.
Ilya decided to make a rectangle from the sticks. And due to his whim, he decided to make rectangles in such a way that maximizes their total area. Each stick is used in making at most one rectangle, it is possible that some of sticks remain unused. Bending sticks is not allowed.
Sticks with lengths *a*1, *a*2, *a*3 and *a*4 can make a rectangle if the following properties are observed:
- *a*1<=≤<=*a*2<=≤<=*a*3<=≤<=*a*4 - *a*1<==<=*a*2 - *a*3<==<=*a*4
A rectangle can be made of sticks with lengths of, for example, 3 3 3 3 or 2 2 4 4. A rectangle cannot be made of, for example, sticks 5 5 5 7.
Ilya also has an instrument which can reduce the length of the sticks. The sticks are made of a special material, so the length of each stick can be reduced by at most one. For example, a stick with length 5 can either stay at this length or be transformed into a stick of length 4.
You have to answer the question — what maximum total area of the rectangles can Ilya get with a file if makes rectangles from the available sticks?
|
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of the available sticks.
The second line of the input contains *n* positive integers *l**i* (2<=≤<=*l**i*<=≤<=106) — the lengths of the sticks.
|
The first line of the output must contain a single non-negative integer — the maximum total area of the rectangles that Ilya can make from the available sticks.
|
[
"4\n2 4 4 2\n",
"4\n2 2 3 5\n",
"4\n100003 100004 100005 100006\n"
] |
[
"8\n",
"0\n",
"10000800015\n"
] |
none
| 1,000
|
[
{
"input": "4\n2 4 4 2",
"output": "8"
},
{
"input": "4\n2 2 3 5",
"output": "0"
},
{
"input": "4\n100003 100004 100005 100006",
"output": "10000800015"
},
{
"input": "8\n5 3 3 3 3 4 4 4",
"output": "25"
},
{
"input": "10\n123 124 123 124 2 2 2 2 9 9",
"output": "15270"
},
{
"input": "8\n10 10 10 10 11 10 11 10",
"output": "210"
},
{
"input": "1\n1000000",
"output": "0"
},
{
"input": "10\n10519 10519 10520 10520 10520 10521 10521 10521 10522 10523",
"output": "221372362"
},
{
"input": "100\n4116 4116 4117 4117 4117 4117 4118 4119 4119 4119 4119 4120 4120 4120 4120 4121 4122 4123 4123 4123 4123 4124 4124 4124 4124 4125 4126 4126 4126 4126 4127 4127 4127 4127 4128 4128 4128 4128 4129 4129 4130 4130 4131 4132 4133 4133 4134 4134 4135 4135 4136 4137 4137 4137 4138 4139 4140 4140 4141 4141 4142 4143 4143 4143 4144 4144 4144 4144 4145 4145 4145 4146 4146 4146 4147 4147 4147 4147 4148 4148 4148 4149 4149 4149 4150 4151 4151 4151 4152 4152 4153 4153 4154 4154 4155 4155 4155 4155 4156 4156",
"output": "427591742"
},
{
"input": "10\n402840 873316 567766 493234 711262 291654 683001 496971 64909 190173",
"output": "0"
},
{
"input": "45\n1800 4967 1094 551 871 3505 846 960 4868 4304 2112 496 2293 2128 2430 2119 4497 2159 774 4520 3535 1013 452 1458 1895 1191 958 1133 416 2613 4172 3926 1665 4237 539 101 2448 1212 2631 4530 3026 412 1006 2515 1922",
"output": "0"
},
{
"input": "69\n2367 2018 3511 1047 1789 2332 1082 4678 2036 4108 2357 339 536 2272 3638 2588 754 3795 375 506 3243 1033 4531 1216 4266 2547 3540 4642 1256 2248 4705 14 629 876 2304 1673 4186 2356 3172 2664 3896 552 4293 1507 3307 2661 3143 4565 58 1298 4380 2738 917 2054 2676 4464 1314 3752 3378 1823 4219 3142 4258 1833 886 4286 4040 1070 2206",
"output": "7402552"
},
{
"input": "93\n13 2633 3005 1516 2681 3262 1318 1935 665 2450 2601 1644 214 929 4873 955 1983 3945 3488 2927 1516 1026 2150 974 150 2442 2610 1664 636 3369 266 2536 3132 2515 2582 1169 4462 4961 200 2848 4793 2795 4657 474 2640 2488 378 544 1805 1390 1548 2683 1474 4027 1724 2078 183 3717 1727 1780 552 2905 4260 1444 2906 3779 400 1491 1467 4480 3680 2539 4681 2875 4021 2711 106 853 3094 4531 4066 372 2129 2577 3996 2350 943 4478 3058 3333 4592 232 2780",
"output": "4403980"
},
{
"input": "21\n580 3221 3987 2012 35 629 1554 654 756 2254 4307 2948 3457 4612 4620 4320 1777 556 3088 348 1250",
"output": "0"
},
{
"input": "45\n4685 272 3481 3942 952 3020 329 4371 2923 2057 4526 2791 1674 3269 829 2713 3006 2166 1228 2795 983 1065 3875 4028 3429 3720 697 734 4393 1176 2820 1173 4598 2281 2549 4341 1504 172 4230 1193 3022 3742 1232 3433 1871",
"output": "0"
},
{
"input": "69\n3766 2348 4437 4438 3305 386 2026 1629 1552 400 4770 4069 4916 1926 2037 1079 2801 854 803 216 2152 4622 1494 3786 775 3615 4766 2781 235 836 1892 2234 3563 1843 4314 3836 320 2776 4796 1378 380 2421 3057 964 4717 1122 620 530 3455 1639 1618 3109 3120 564 2382 1995 1173 4510 286 1088 218 734 2779 3738 456 1668 4476 2780 3555",
"output": "12334860"
},
{
"input": "4\n2 2 2 4",
"output": "0"
},
{
"input": "8\n10 10 10 11 14 14 14 16",
"output": "140"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "3\n2 3 5",
"output": "0"
},
{
"input": "8\n2 1000000 2 1000000 2 1000000 2 1000000",
"output": "1000000000004"
},
{
"input": "4\n2 4 6 8",
"output": "0"
},
{
"input": "4\n2 3 6 8",
"output": "0"
},
{
"input": "5\n2 2 3 4 5",
"output": "8"
},
{
"input": "5\n1000000 999999 999999 999999 999999",
"output": "999998000001"
},
{
"input": "6\n2 2 2 2 2 2",
"output": "4"
},
{
"input": "4\n2 4 5 5",
"output": "0"
},
{
"input": "20\n4 4 8 4 5 6 7 4 5 4 6 4 4 5 7 6 5 8 8 4",
"output": "149"
},
{
"input": "10\n8 4 6 6 8 5 7 7 6 8",
"output": "92"
},
{
"input": "11\n4 4 9 9 3 8 8 8 6 4 3",
"output": "84"
},
{
"input": "8\n2 3 3 4 4 5 5 5",
"output": "26"
},
{
"input": "4\n3 3 3 2",
"output": "6"
},
{
"input": "5\n3 3 10 100 100",
"output": "300"
},
{
"input": "8\n9 9 9 8 8 7 7 6",
"output": "114"
},
{
"input": "4\n5 6 6 7",
"output": "30"
},
{
"input": "5\n9 9 5 2 2",
"output": "18"
},
{
"input": "6\n3 4 100 200 1001 1002",
"output": "3003"
},
{
"input": "6\n3 4 5 100 101 102",
"output": "404"
},
{
"input": "5\n2 2 4 6 6",
"output": "12"
},
{
"input": "6\n2 3 8 10 13 14",
"output": "26"
},
{
"input": "7\n2 2 2 2 2 2 2",
"output": "4"
},
{
"input": "5\n5 2 2 2 2",
"output": "4"
},
{
"input": "6\n3 4 100 200 1000 1001",
"output": "3000"
},
{
"input": "5\n5 5 7 9 9",
"output": "45"
},
{
"input": "5\n8 8 7 4 4",
"output": "32"
},
{
"input": "5\n2 2 5 8 9",
"output": "16"
},
{
"input": "5\n4 4 4 2 2",
"output": "8"
},
{
"input": "5\n3 10 100 1000 10000",
"output": "0"
},
{
"input": "6\n10 10 7 4 2 2",
"output": "20"
},
{
"input": "6\n5 5 7 9 10 10",
"output": "50"
},
{
"input": "7\n10 10 7 5 3 2 2",
"output": "20"
},
{
"input": "7\n10 9 9 9 9 2 2",
"output": "81"
}
] | 1,427,432,849
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 96
| 171
| 7,680,000
|
def main():
n = int(input())
l = [int(i) for i in input().split()]
l.sort()
l.reverse()
candidate = []
i = 1
while (i < n):
if (l[i - 1] - l[i] <= 1):
candidate.append(min(l[i - 1], l[i]))
i += 2
else:
i += 1
area = 0
for i in range(1, len(candidate), 2):
area += candidate[i] * candidate[i - 1]
return area
if __name__ == '__main__':
print(main())
|
Title: Ilya and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the evening, after the contest Ilya was bored, and he really felt like maximizing. He remembered that he had a set of *n* sticks and an instrument. Each stick is characterized by its length *l**i*.
Ilya decided to make a rectangle from the sticks. And due to his whim, he decided to make rectangles in such a way that maximizes their total area. Each stick is used in making at most one rectangle, it is possible that some of sticks remain unused. Bending sticks is not allowed.
Sticks with lengths *a*1, *a*2, *a*3 and *a*4 can make a rectangle if the following properties are observed:
- *a*1<=≤<=*a*2<=≤<=*a*3<=≤<=*a*4 - *a*1<==<=*a*2 - *a*3<==<=*a*4
A rectangle can be made of sticks with lengths of, for example, 3 3 3 3 or 2 2 4 4. A rectangle cannot be made of, for example, sticks 5 5 5 7.
Ilya also has an instrument which can reduce the length of the sticks. The sticks are made of a special material, so the length of each stick can be reduced by at most one. For example, a stick with length 5 can either stay at this length or be transformed into a stick of length 4.
You have to answer the question — what maximum total area of the rectangles can Ilya get with a file if makes rectangles from the available sticks?
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of the available sticks.
The second line of the input contains *n* positive integers *l**i* (2<=≤<=*l**i*<=≤<=106) — the lengths of the sticks.
Output Specification:
The first line of the output must contain a single non-negative integer — the maximum total area of the rectangles that Ilya can make from the available sticks.
Demo Input:
['4\n2 4 4 2\n', '4\n2 2 3 5\n', '4\n100003 100004 100005 100006\n']
Demo Output:
['8\n', '0\n', '10000800015\n']
Note:
none
|
```python
def main():
n = int(input())
l = [int(i) for i in input().split()]
l.sort()
l.reverse()
candidate = []
i = 1
while (i < n):
if (l[i - 1] - l[i] <= 1):
candidate.append(min(l[i - 1], l[i]))
i += 2
else:
i += 1
area = 0
for i in range(1, len(candidate), 2):
area += candidate[i] * candidate[i - 1]
return area
if __name__ == '__main__':
print(main())
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,699,267,540
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
a=[int(i) for i in input().split()]
print(min(abs(a[0]-a[1])+abs(a[0]-a[2]),abs(a[1]-a[0])+abs(a[1]-a[2]),abs(a[2]-a[0])+abs(a[2]-a[1])))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
a=[int(i) for i in input().split()]
print(min(abs(a[0]-a[1])+abs(a[0]-a[2]),abs(a[1]-a[0])+abs(a[1]-a[2]),abs(a[2]-a[0])+abs(a[2]-a[1])))
```
| 3
|
|
47
|
A
|
Triangular numbers
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Triangular numbers
|
2
|
256
|
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number).
Your task is to find out if a given integer is a triangular number.
|
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
|
If the given integer is a triangular number output YES, otherwise output NO.
|
[
"1\n",
"2\n",
"3\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "YES"
},
{
"input": "2",
"output": "NO"
},
{
"input": "3",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "5",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "7",
"output": "NO"
},
{
"input": "8",
"output": "NO"
},
{
"input": "12",
"output": "NO"
},
{
"input": "10",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "9",
"output": "NO"
},
{
"input": "14",
"output": "NO"
},
{
"input": "15",
"output": "YES"
},
{
"input": "16",
"output": "NO"
},
{
"input": "20",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "22",
"output": "NO"
},
{
"input": "121",
"output": "NO"
},
{
"input": "135",
"output": "NO"
},
{
"input": "136",
"output": "YES"
},
{
"input": "137",
"output": "NO"
},
{
"input": "152",
"output": "NO"
},
{
"input": "153",
"output": "YES"
},
{
"input": "154",
"output": "NO"
},
{
"input": "171",
"output": "YES"
},
{
"input": "189",
"output": "NO"
},
{
"input": "190",
"output": "YES"
},
{
"input": "191",
"output": "NO"
},
{
"input": "210",
"output": "YES"
},
{
"input": "211",
"output": "NO"
},
{
"input": "231",
"output": "YES"
},
{
"input": "232",
"output": "NO"
},
{
"input": "252",
"output": "NO"
},
{
"input": "253",
"output": "YES"
},
{
"input": "254",
"output": "NO"
},
{
"input": "275",
"output": "NO"
},
{
"input": "276",
"output": "YES"
},
{
"input": "277",
"output": "NO"
},
{
"input": "299",
"output": "NO"
},
{
"input": "300",
"output": "YES"
},
{
"input": "301",
"output": "NO"
},
{
"input": "324",
"output": "NO"
},
{
"input": "325",
"output": "YES"
},
{
"input": "326",
"output": "NO"
},
{
"input": "350",
"output": "NO"
},
{
"input": "351",
"output": "YES"
},
{
"input": "352",
"output": "NO"
},
{
"input": "377",
"output": "NO"
},
{
"input": "378",
"output": "YES"
},
{
"input": "406",
"output": "YES"
},
{
"input": "434",
"output": "NO"
},
{
"input": "435",
"output": "YES"
},
{
"input": "464",
"output": "NO"
},
{
"input": "465",
"output": "YES"
},
{
"input": "495",
"output": "NO"
},
{
"input": "496",
"output": "YES"
},
{
"input": "497",
"output": "NO"
},
{
"input": "331",
"output": "NO"
},
{
"input": "413",
"output": "NO"
},
{
"input": "177",
"output": "NO"
},
{
"input": "122",
"output": "NO"
},
{
"input": "478",
"output": "NO"
},
{
"input": "188",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "474",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "48",
"output": "NO"
},
{
"input": "498",
"output": "NO"
},
{
"input": "499",
"output": "NO"
},
{
"input": "500",
"output": "NO"
}
] | 1,604,167,921
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 248
| 0
|
a=[]
for i in range(1,32):
a.append(i*(i+1)/2)
b=int(input())
print("YES" if b in a else "NO")
|
Title: Triangular numbers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number).
Your task is to find out if a given integer is a triangular number.
Input Specification:
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
Output Specification:
If the given integer is a triangular number output YES, otherwise output NO.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none
|
```python
a=[]
for i in range(1,32):
a.append(i*(i+1)/2)
b=int(input())
print("YES" if b in a else "NO")
```
| 3.938
|
1,009
|
A
|
Game Shopping
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
|
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
|
Print a single integer — the number of games Maxim will buy.
|
[
"5 4\n2 4 5 2 4\n5 3 4 6\n",
"5 2\n20 40 50 20 40\n19 20\n",
"6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n"
] |
[
"3\n",
"0\n",
"4\n"
] |
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
| 0
|
[
{
"input": "5 4\n2 4 5 2 4\n5 3 4 6",
"output": "3"
},
{
"input": "5 2\n20 40 50 20 40\n19 20",
"output": "0"
},
{
"input": "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000",
"output": "4"
},
{
"input": "5 1\n1 1 1 1 1\n5",
"output": "1"
},
{
"input": "5 1\n10 1 1 1 1\n1000",
"output": "1"
},
{
"input": "5 1\n100 100 100 100 100\n100",
"output": "1"
},
{
"input": "2 1\n2 1\n1",
"output": "1"
},
{
"input": "2 3\n3 1\n2 4 2",
"output": "1"
},
{
"input": "1 5\n4\n1 4 3 3 2",
"output": "0"
},
{
"input": "5 3\n4 2 3 1 1\n2 1 3",
"output": "3"
},
{
"input": "3 5\n5 2 5\n1 4 1 4 2",
"output": "0"
},
{
"input": "7 3\n9 7 10 2 1 1 1\n8 9 6",
"output": "3"
},
{
"input": "5 3\n2 5 3 3 2\n2 5 3",
"output": "3"
}
] | 1,541,343,256
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 109
| 0
|
n, m = map(int, input().split())
c = list(map(int, input().split()))
a = list(map(int, input().split()))
Pc, Pa, ans = 0, 0, 0
while Pc < n and Pa < m :
if a[Pa] >= c[Pc] :
ans += 1
Pa += 1
Pc += 1
else:
Pc += 1
print(ans)
|
Title: Game Shopping
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
Input Specification:
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
Output Specification:
Print a single integer — the number of games Maxim will buy.
Demo Input:
['5 4\n2 4 5 2 4\n5 3 4 6\n', '5 2\n20 40 50 20 40\n19 20\n', '6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n']
Demo Output:
['3\n', '0\n', '4\n']
Note:
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
|
```python
n, m = map(int, input().split())
c = list(map(int, input().split()))
a = list(map(int, input().split()))
Pc, Pa, ans = 0, 0, 0
while Pc < n and Pa < m :
if a[Pa] >= c[Pc] :
ans += 1
Pa += 1
Pc += 1
else:
Pc += 1
print(ans)
```
| 3
|
|
875
|
A
|
Classroom Watch
|
PROGRAMMING
| 1,200
|
[
"brute force",
"math"
] | null | null |
Eighth-grader Vova is on duty today in the class. After classes, he went into the office to wash the board, and found on it the number *n*. He asked what is this number and the teacher of mathematics Inna Petrovna answered Vova that *n* is the answer to the arithmetic task for first-graders. In the textbook, a certain positive integer *x* was given. The task was to add *x* to the sum of the digits of the number *x* written in decimal numeral system.
Since the number *n* on the board was small, Vova quickly guessed which *x* could be in the textbook. Now he wants to get a program which will search for arbitrary values of the number *n* for all suitable values of *x* or determine that such *x* does not exist. Write such a program for Vova.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=109).
|
In the first line print one integer *k* — number of different values of *x* satisfying the condition.
In next *k* lines print these values in ascending order.
|
[
"21\n",
"20\n"
] |
[
"1\n15\n",
"0\n"
] |
In the first test case *x* = 15 there is only one variant: 15 + 1 + 5 = 21.
In the second test case there are no such *x*.
| 500
|
[
{
"input": "21",
"output": "1\n15"
},
{
"input": "20",
"output": "0"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "1\n1"
},
{
"input": "3",
"output": "0"
},
{
"input": "100000001",
"output": "2\n99999937\n100000000"
},
{
"input": "1000000000",
"output": "1\n999999932"
},
{
"input": "999999979",
"output": "2\n999999899\n999999908"
},
{
"input": "9",
"output": "0"
},
{
"input": "10",
"output": "1\n5"
},
{
"input": "11",
"output": "1\n10"
},
{
"input": "39",
"output": "1\n33"
},
{
"input": "66",
"output": "1\n60"
},
{
"input": "75",
"output": "0"
},
{
"input": "100",
"output": "1\n86"
},
{
"input": "101",
"output": "2\n91\n100"
},
{
"input": "2014",
"output": "2\n1988\n2006"
},
{
"input": "999999994",
"output": "0"
}
] | 1,595,027,530
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 93
| 6,656,000
|
n = int(input())
count = 0
res = []
if n >1000000: # if it is a big number, check from the last few numbers instead from beginning
limit = 100
else:
limit = n
for i in range(n-limit, n):
if n - i == sum(map(int,(str(i)))):
res.append(i)
if res:
print(len(res))
for i in res:
print(i)
else:
print(0)
|
Title: Classroom Watch
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eighth-grader Vova is on duty today in the class. After classes, he went into the office to wash the board, and found on it the number *n*. He asked what is this number and the teacher of mathematics Inna Petrovna answered Vova that *n* is the answer to the arithmetic task for first-graders. In the textbook, a certain positive integer *x* was given. The task was to add *x* to the sum of the digits of the number *x* written in decimal numeral system.
Since the number *n* on the board was small, Vova quickly guessed which *x* could be in the textbook. Now he wants to get a program which will search for arbitrary values of the number *n* for all suitable values of *x* or determine that such *x* does not exist. Write such a program for Vova.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
In the first line print one integer *k* — number of different values of *x* satisfying the condition.
In next *k* lines print these values in ascending order.
Demo Input:
['21\n', '20\n']
Demo Output:
['1\n15\n', '0\n']
Note:
In the first test case *x* = 15 there is only one variant: 15 + 1 + 5 = 21.
In the second test case there are no such *x*.
|
```python
n = int(input())
count = 0
res = []
if n >1000000: # if it is a big number, check from the last few numbers instead from beginning
limit = 100
else:
limit = n
for i in range(n-limit, n):
if n - i == sum(map(int,(str(i)))):
res.append(i)
if res:
print(len(res))
for i in res:
print(i)
else:
print(0)
```
| 3
|
|
160
|
A
|
Twins
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] | null | null |
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
|
In the single line print the single number — the minimum needed number of coins.
|
[
"2\n3 3\n",
"3\n2 1 2\n"
] |
[
"2\n",
"2\n"
] |
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
| 500
|
[
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "5\n4 2 2 2 2",
"output": "3"
},
{
"input": "7\n1 10 1 2 1 1 1",
"output": "1"
},
{
"input": "5\n3 2 3 3 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "4"
},
{
"input": "7\n10 10 5 5 5 5 1",
"output": "3"
},
{
"input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4",
"output": "8"
},
{
"input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40",
"output": "8"
},
{
"input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90",
"output": "6"
},
{
"input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28",
"output": "14"
},
{
"input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42",
"output": "22"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "51"
},
{
"input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2",
"output": "37"
},
{
"input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "36"
},
{
"input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3",
"output": "33"
},
{
"input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "30"
},
{
"input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2",
"output": "29"
},
{
"input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "30"
},
{
"input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "29"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "30"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n4 1 2 3",
"output": "2"
},
{
"input": "5\n2 2 2 4 4",
"output": "2"
},
{
"input": "4\n100 99 99 100",
"output": "2"
}
] | 1,696,336,388
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 29
| 124
| 1,638,400
|
n=int(input())
c=0
k=0
l=list(map(int,input().split()))
for i in range(n):
c+=max(l)
k+=1
l.remove(max(l))
if c>sum(l):
print(k)
break
|
Title: Twins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
Output Specification:
In the single line print the single number — the minimum needed number of coins.
Demo Input:
['2\n3 3\n', '3\n2 1 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
|
```python
n=int(input())
c=0
k=0
l=list(map(int,input().split()))
for i in range(n):
c+=max(l)
k+=1
l.remove(max(l))
if c>sum(l):
print(k)
break
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,589,812,657
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 155
| 20,172,800
|
a = str(input())
b =0
word="hello"
for i in range(len(a)):
if(a[i]==word[b]):
b+=1
if(b==5):
break
if(b==5):
print("YES")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
a = str(input())
b =0
word="hello"
for i in range(len(a)):
if(a[i]==word[b]):
b+=1
if(b==5):
break
if(b==5):
print("YES")
else:
print("NO")
```
| 3.884925
|
294
|
A
|
Shaass and Oskols
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
|
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100).
The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
|
On the *i*-th line of the output print the number of birds on the *i*-th wire.
|
[
"5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n",
"3\n2 4 1\n1\n2 2\n"
] |
[
"0\n12\n5\n0\n16\n",
"3\n0\n3\n"
] |
none
| 500
|
[
{
"input": "5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6",
"output": "0\n12\n5\n0\n16"
},
{
"input": "3\n2 4 1\n1\n2 2",
"output": "3\n0\n3"
},
{
"input": "5\n58 51 45 27 48\n5\n4 9\n5 15\n4 5\n5 8\n1 43",
"output": "0\n66\n57\n7\n0"
},
{
"input": "10\n48 53 10 28 91 56 81 2 67 52\n2\n2 40\n6 51",
"output": "87\n0\n23\n28\n141\n0\n86\n2\n67\n52"
},
{
"input": "2\n72 45\n6\n1 69\n2 41\n1 19\n2 7\n1 5\n2 1",
"output": "0\n0"
},
{
"input": "10\n95 54 36 39 98 30 19 24 14 12\n3\n9 5\n8 15\n7 5",
"output": "95\n54\n36\n39\n98\n34\n0\n28\n13\n21"
},
{
"input": "100\n95 15 25 18 64 62 23 59 70 84 50 26 87 35 75 86 0 22 77 60 66 41 21 9 75 50 25 3 69 14 39 68 64 46 59 99 2 0 21 76 90 12 61 42 6 91 36 39 47 41 93 81 66 57 70 36 68 89 52 1 19 93 67 22 76 20 8 81 98 18 100 73 61 93 75 80 53 72 40 20 2 86 33 59 27 16 11 26 55 44 47 55 94 58 2 55 82 22 9 95\n0",
"output": "95\n15\n25\n18\n64\n62\n23\n59\n70\n84\n50\n26\n87\n35\n75\n86\n0\n22\n77\n60\n66\n41\n21\n9\n75\n50\n25\n3\n69\n14\n39\n68\n64\n46\n59\n99\n2\n0\n21\n76\n90\n12\n61\n42\n6\n91\n36\n39\n47\n41\n93\n81\n66\n57\n70\n36\n68\n89\n52\n1\n19\n93\n67\n22\n76\n20\n8\n81\n98\n18\n100\n73\n61\n93\n75\n80\n53\n72\n40\n20\n2\n86\n33\n59\n27\n16\n11\n26\n55\n44\n47\n55\n94\n58\n2\n55\n82\n22\n9\n95"
},
{
"input": "1\n100\n1\n1 100",
"output": "0"
},
{
"input": "1\n100\n1\n1 1",
"output": "0"
},
{
"input": "1\n50\n1\n1 25",
"output": "0"
},
{
"input": "2\n50 0\n1\n1 1",
"output": "0\n49"
},
{
"input": "1\n10\n0",
"output": "10"
}
] | 1,549,024,918
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 218
| 0
|
input()
Wires = list(map(int, input().split()))
N = int(input())
Shot = list()
for i in range(N):
Shot.append(list(map(int, input().split())))
Shot[i][0] -= 1
for i in range(len(Shot)):
if Shot[i][0] != 0:
Wires[Shot[i][0] - 1] += Shot[i][1] - 1
if Shot[i][0] != len(Wires) - 1:
Wires[Shot[i][0] + 1] += Wires[Shot[i][0]] - Shot[i][1]
Wires[Shot[i][0]] = 0
print(*Wires, sep="\n")
|
Title: Shaass and Oskols
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
Input Specification:
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100).
The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
Output Specification:
On the *i*-th line of the output print the number of birds on the *i*-th wire.
Demo Input:
['5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n', '3\n2 4 1\n1\n2 2\n']
Demo Output:
['0\n12\n5\n0\n16\n', '3\n0\n3\n']
Note:
none
|
```python
input()
Wires = list(map(int, input().split()))
N = int(input())
Shot = list()
for i in range(N):
Shot.append(list(map(int, input().split())))
Shot[i][0] -= 1
for i in range(len(Shot)):
if Shot[i][0] != 0:
Wires[Shot[i][0] - 1] += Shot[i][1] - 1
if Shot[i][0] != len(Wires) - 1:
Wires[Shot[i][0] + 1] += Wires[Shot[i][0]] - Shot[i][1]
Wires[Shot[i][0]] = 0
print(*Wires, sep="\n")
```
| 3
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,688,037,100
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
"""
Problema: Gioco di Sereja e Dima
Descrizione del problema:
Sereja e Dima stanno giocando a un gioco con delle carte numerate. Durante il gioco, i giocatori si alternano a prendere una carta dalla fila, scegliendo la carta più a sinistra o più a destra. Alla fine del gioco, i punti dei giocatori sono determinati dalla somma dei numeri sulle carte che hanno preso. L'obiettivo è determinare i punteggi finali di Sereja e Dima, dato lo stato iniziale del gioco.
Input:
- La prima riga contiene un numero intero n, che rappresenta il numero di carte sul tavolo.
- La seconda riga contiene n numeri separati da spazi, che rappresentano i numeri sulle carte, in ordine dalla sinistra alla destra.
Output:
- Una riga contenente due numeri interi separati da uno spazio, che rappresentano i punti finali di Sereja e Dima, rispettivamente.
Esempio di input:
4
4 1 2 10
Esempio di output:
12 5
Spiegazione:
Durante il gioco, Sereja prenderà le carte con i numeri 10 e 2, ottenendo un punteggio di 12. Dima prenderà le carte con i numeri 4 e 1, ottenendo un punteggio di 5.
"""
# Numero di carte sul tavolo
n = int(input())
# Valori sulle carte
cards = list(map(int, input().split()))
# Punteggi iniziali
score_sereja = 0
score_dima = 0
# Indici delle carte agli estremi (array valori)
indexLeft = 0
indexRight = n - 1
# Finché ci sono ancora carte disponibili
while indexLeft <= indexRight:
# Sereja prende la carta più a sinistra
if cards[indexLeft] >= cards[indexRight]:
score_sereja += cards[indexLeft]
indexLeft += 1 # Passa alla prossima carta a sinistra
else:
# Dima prende la carta più a destra
score_sereja += cards[indexRight]
indexRight -= 1 # Passa alla prossima carta a destra
# Se ci sono ancora carte disponibili
if indexLeft <= indexRight:
# Dima prende la carta più a sinistra
if cards[indexLeft] >= cards[indexRight]:
score_dima += cards[indexLeft]
indexLeft += 1 # Passa alla prossima carta a sinistra
else:
# Sereja prende la carta più a destra
score_dima += cards[indexRight]
indexRight -= 1 # Passa alla prossima carta a destra
# Stampa i punteggi finali di Sereja e Dima
print(score_sereja, score_dima)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
"""
Problema: Gioco di Sereja e Dima
Descrizione del problema:
Sereja e Dima stanno giocando a un gioco con delle carte numerate. Durante il gioco, i giocatori si alternano a prendere una carta dalla fila, scegliendo la carta più a sinistra o più a destra. Alla fine del gioco, i punti dei giocatori sono determinati dalla somma dei numeri sulle carte che hanno preso. L'obiettivo è determinare i punteggi finali di Sereja e Dima, dato lo stato iniziale del gioco.
Input:
- La prima riga contiene un numero intero n, che rappresenta il numero di carte sul tavolo.
- La seconda riga contiene n numeri separati da spazi, che rappresentano i numeri sulle carte, in ordine dalla sinistra alla destra.
Output:
- Una riga contenente due numeri interi separati da uno spazio, che rappresentano i punti finali di Sereja e Dima, rispettivamente.
Esempio di input:
4
4 1 2 10
Esempio di output:
12 5
Spiegazione:
Durante il gioco, Sereja prenderà le carte con i numeri 10 e 2, ottenendo un punteggio di 12. Dima prenderà le carte con i numeri 4 e 1, ottenendo un punteggio di 5.
"""
# Numero di carte sul tavolo
n = int(input())
# Valori sulle carte
cards = list(map(int, input().split()))
# Punteggi iniziali
score_sereja = 0
score_dima = 0
# Indici delle carte agli estremi (array valori)
indexLeft = 0
indexRight = n - 1
# Finché ci sono ancora carte disponibili
while indexLeft <= indexRight:
# Sereja prende la carta più a sinistra
if cards[indexLeft] >= cards[indexRight]:
score_sereja += cards[indexLeft]
indexLeft += 1 # Passa alla prossima carta a sinistra
else:
# Dima prende la carta più a destra
score_sereja += cards[indexRight]
indexRight -= 1 # Passa alla prossima carta a destra
# Se ci sono ancora carte disponibili
if indexLeft <= indexRight:
# Dima prende la carta più a sinistra
if cards[indexLeft] >= cards[indexRight]:
score_dima += cards[indexLeft]
indexLeft += 1 # Passa alla prossima carta a sinistra
else:
# Sereja prende la carta più a destra
score_dima += cards[indexRight]
indexRight -= 1 # Passa alla prossima carta a destra
# Stampa i punteggi finali di Sereja e Dima
print(score_sereja, score_dima)
```
| 3
|
|
264
|
A
|
Escape from Stones
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"data structures",
"implementation",
"two pointers"
] | null | null |
Squirrel Liss lived in a forest peacefully, but unexpected trouble happens. Stones fall from a mountain. Initially Squirrel Liss occupies an interval [0,<=1]. Next, *n* stones will fall and Liss will escape from the stones. The stones are numbered from 1 to *n* in order.
The stones always fall to the center of Liss's interval. When Liss occupies the interval [*k*<=-<=*d*,<=*k*<=+<=*d*] and a stone falls to *k*, she will escape to the left or to the right. If she escapes to the left, her new interval will be [*k*<=-<=*d*,<=*k*]. If she escapes to the right, her new interval will be [*k*,<=*k*<=+<=*d*].
You are given a string *s* of length *n*. If the *i*-th character of *s* is "l" or "r", when the *i*-th stone falls Liss will escape to the left or to the right, respectively. Find the sequence of stones' numbers from left to right after all the *n* stones falls.
|
The input consists of only one line. The only line contains the string *s* (1<=≤<=|*s*|<=≤<=106). Each character in *s* will be either "l" or "r".
|
Output *n* lines — on the *i*-th line you should print the *i*-th stone's number from the left.
|
[
"llrlr\n",
"rrlll\n",
"lrlrr\n"
] |
[
"3\n5\n4\n2\n1\n",
"1\n2\n5\n4\n3\n",
"2\n4\n5\n3\n1\n"
] |
In the first example, the positions of stones 1, 2, 3, 4, 5 will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/58fdb5684df807bfcb705a9da9ce175613362b7d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, respectively. So you should print the sequence: 3, 5, 4, 2, 1.
| 500
|
[
{
"input": "llrlr",
"output": "3\n5\n4\n2\n1"
},
{
"input": "rrlll",
"output": "1\n2\n5\n4\n3"
},
{
"input": "lrlrr",
"output": "2\n4\n5\n3\n1"
},
{
"input": "lllrlrllrl",
"output": "4\n6\n9\n10\n8\n7\n5\n3\n2\n1"
},
{
"input": "llrlrrrlrr",
"output": "3\n5\n6\n7\n9\n10\n8\n4\n2\n1"
},
{
"input": "rlrrrllrrr",
"output": "1\n3\n4\n5\n8\n9\n10\n7\n6\n2"
},
{
"input": "lrrlrrllrrrrllllllrr",
"output": "2\n3\n5\n6\n9\n10\n11\n12\n19\n20\n18\n17\n16\n15\n14\n13\n8\n7\n4\n1"
},
{
"input": "rlrrrlrrrllrrllrlrll",
"output": "1\n3\n4\n5\n7\n8\n9\n12\n13\n16\n18\n20\n19\n17\n15\n14\n11\n10\n6\n2"
},
{
"input": "lllrrlrlrllrrrrrllrl",
"output": "4\n5\n7\n9\n12\n13\n14\n15\n16\n19\n20\n18\n17\n11\n10\n8\n6\n3\n2\n1"
},
{
"input": "rrrllrrrlllrlllrlrrr",
"output": "1\n2\n3\n6\n7\n8\n12\n16\n18\n19\n20\n17\n15\n14\n13\n11\n10\n9\n5\n4"
},
{
"input": "rrlllrrrlrrlrrrlllrlrlrrrlllrllrrllrllrrlrlrrllllrlrrrrlrlllrlrrrlrlrllrlrlrrlrrllrrrlrlrlllrrllllrl",
"output": "1\n2\n6\n7\n8\n10\n11\n13\n14\n15\n19\n21\n23\n24\n25\n29\n32\n33\n36\n39\n40\n42\n44\n45\n50\n52\n53\n54\n55\n57\n61\n63\n64\n65\n67\n69\n72\n74\n76\n77\n79\n80\n83\n84\n85\n87\n89\n93\n94\n99\n100\n98\n97\n96\n95\n92\n91\n90\n88\n86\n82\n81\n78\n75\n73\n71\n70\n68\n66\n62\n60\n59\n58\n56\n51\n49\n48\n47\n46\n43\n41\n38\n37\n35\n34\n31\n30\n28\n27\n26\n22\n20\n18\n17\n16\n12\n9\n5\n4\n3"
},
{
"input": "llrlrlllrrllrllllrlrrlrlrrllrlrlrrlrrrrrrlllrrlrrrrrlrrrlrlrlrrlllllrrrrllrrlrlrrrllllrlrrlrrlrlrrll",
"output": "3\n5\n9\n10\n13\n18\n20\n21\n23\n25\n26\n29\n31\n33\n34\n36\n37\n38\n39\n40\n41\n45\n46\n48\n49\n50\n51\n52\n54\n55\n56\n58\n60\n62\n63\n69\n70\n71\n72\n75\n76\n78\n80\n81\n82\n87\n89\n90\n92\n93\n95\n97\n98\n100\n99\n96\n94\n91\n88\n86\n85\n84\n83\n79\n77\n74\n73\n68\n67\n66\n65\n64\n61\n59\n57\n53\n47\n44\n43\n42\n35\n32\n30\n28\n27\n24\n22\n19\n17\n16\n15\n14\n12\n11\n8\n7\n6\n4\n2\n1"
},
{
"input": "llrrrrllrrlllrlrllrlrllllllrrrrrrrrllrrrrrrllrlrrrlllrrrrrrlllllllrrlrrllrrrllllrrlllrrrlrlrrlrlrllr",
"output": "3\n4\n5\n6\n9\n10\n14\n16\n19\n21\n28\n29\n30\n31\n32\n33\n34\n35\n38\n39\n40\n41\n42\n43\n46\n48\n49\n50\n54\n55\n56\n57\n58\n59\n67\n68\n70\n71\n74\n75\n76\n81\n82\n86\n87\n88\n90\n92\n93\n95\n97\n100\n99\n98\n96\n94\n91\n89\n85\n84\n83\n80\n79\n78\n77\n73\n72\n69\n66\n65\n64\n63\n62\n61\n60\n53\n52\n51\n47\n45\n44\n37\n36\n27\n26\n25\n24\n23\n22\n20\n18\n17\n15\n13\n12\n11\n8\n7\n2\n1"
},
{
"input": "lllllrllrrlllrrrllrrrrlrrlrllllrrrrrllrlrllllllrrlrllrlrllrlrrlrlrrlrrrlrrrrllrlrrrrrrrllrllrrlrllrl",
"output": "6\n9\n10\n14\n15\n16\n19\n20\n21\n22\n24\n25\n27\n32\n33\n34\n35\n36\n39\n41\n48\n49\n51\n54\n56\n59\n61\n62\n64\n66\n67\n69\n70\n71\n73\n74\n75\n76\n79\n81\n82\n83\n84\n85\n86\n87\n90\n93\n94\n96\n99\n100\n98\n97\n95\n92\n91\n89\n88\n80\n78\n77\n72\n68\n65\n63\n60\n58\n57\n55\n53\n52\n50\n47\n46\n45\n44\n43\n42\n40\n38\n37\n31\n30\n29\n28\n26\n23\n18\n17\n13\n12\n11\n8\n7\n5\n4\n3\n2\n1"
},
{
"input": "llrlrlrlrlrlrrlllllllrllllrllrrrlllrrllrllrrlllrrlllrlrrllllrrlllrrllrrllllrrlllrlllrrrllrrrrrrllrrl",
"output": "3\n5\n7\n9\n11\n13\n14\n22\n27\n30\n31\n32\n36\n37\n40\n43\n44\n48\n49\n53\n55\n56\n61\n62\n66\n67\n70\n71\n76\n77\n81\n85\n86\n87\n90\n91\n92\n93\n94\n95\n98\n99\n100\n97\n96\n89\n88\n84\n83\n82\n80\n79\n78\n75\n74\n73\n72\n69\n68\n65\n64\n63\n60\n59\n58\n57\n54\n52\n51\n50\n47\n46\n45\n42\n41\n39\n38\n35\n34\n33\n29\n28\n26\n25\n24\n23\n21\n20\n19\n18\n17\n16\n15\n12\n10\n8\n6\n4\n2\n1"
},
{
"input": "l",
"output": "1"
},
{
"input": "r",
"output": "1"
}
] | 1,694,617,100
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 1,575
| 3,276,800
|
s = input()
for a in range(len(s)):
if s[a] == 'r':
print(a +1)
for a in range(len(s), 0 , -1):
# print(a)
if s[a - 1] == 'l':
print(a)
|
Title: Escape from Stones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Squirrel Liss lived in a forest peacefully, but unexpected trouble happens. Stones fall from a mountain. Initially Squirrel Liss occupies an interval [0,<=1]. Next, *n* stones will fall and Liss will escape from the stones. The stones are numbered from 1 to *n* in order.
The stones always fall to the center of Liss's interval. When Liss occupies the interval [*k*<=-<=*d*,<=*k*<=+<=*d*] and a stone falls to *k*, she will escape to the left or to the right. If she escapes to the left, her new interval will be [*k*<=-<=*d*,<=*k*]. If she escapes to the right, her new interval will be [*k*,<=*k*<=+<=*d*].
You are given a string *s* of length *n*. If the *i*-th character of *s* is "l" or "r", when the *i*-th stone falls Liss will escape to the left or to the right, respectively. Find the sequence of stones' numbers from left to right after all the *n* stones falls.
Input Specification:
The input consists of only one line. The only line contains the string *s* (1<=≤<=|*s*|<=≤<=106). Each character in *s* will be either "l" or "r".
Output Specification:
Output *n* lines — on the *i*-th line you should print the *i*-th stone's number from the left.
Demo Input:
['llrlr\n', 'rrlll\n', 'lrlrr\n']
Demo Output:
['3\n5\n4\n2\n1\n', '1\n2\n5\n4\n3\n', '2\n4\n5\n3\n1\n']
Note:
In the first example, the positions of stones 1, 2, 3, 4, 5 will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/58fdb5684df807bfcb705a9da9ce175613362b7d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, respectively. So you should print the sequence: 3, 5, 4, 2, 1.
|
```python
s = input()
for a in range(len(s)):
if s[a] == 'r':
print(a +1)
for a in range(len(s), 0 , -1):
# print(a)
if s[a - 1] == 'l':
print(a)
```
| 3
|
|
656
|
C
|
Without Text
|
PROGRAMMING
| 2,000
|
[
"*special"
] | null | null |
You can preview the image in better quality by the link: [http://assets.codeforces.com/files/656/without-text.png](//assets.codeforces.com/files/656/without-text.png)
|
The only line of the input is a string (between 1 and 50 characters long, inclusive). Each character will be an alphanumeric character or a full stop ".".
|
Output the required answer.
|
[
"Codeforces\n",
"APRIL.1st\n"
] |
[
"-87\n",
"17\n"
] |
none
| 0
|
[
{
"input": "Codeforces",
"output": "-87"
},
{
"input": "APRIL.1st",
"output": "17"
},
{
"input": ".0.1.2.",
"output": "0"
},
{
"input": "CODEcode",
"output": "0"
},
{
"input": "A",
"output": "1"
},
{
"input": "ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ",
"output": "1300"
},
{
"input": ".5i7kqPokKqEsLMn8ib",
"output": "-67"
},
{
"input": "Bgh",
"output": "-13"
},
{
"input": "LHg25JHfDf74yUj2rezrsTGBzsVZKyFMikyesiW",
"output": "-95"
},
{
"input": "XugVHXi3RqJWXaP9i6g.0fP",
"output": "108"
},
{
"input": "vTUvjiXvQbCUrJ5tbAblMtPZ6r8RVFFXrV6CL",
"output": "88"
},
{
"input": "uVVcZsrSe",
"output": "23"
},
{
"input": "rXVKP0A.qQnv9ATzvUxSz.eMD6ZoIIvb",
"output": "0"
},
{
"input": "sVmF.LOJCNrkn2iupiiou",
"output": "-93"
},
{
"input": "rXoypUjrOofxvzuSUrNfhxn490ZBwQZ0mMHYFlY4DCNQW",
"output": "-11"
},
{
"input": "oZndfd2PbCT85u6081",
"output": "-1"
},
{
"input": "K1mOToYzavp3Kaeacv",
"output": "-43"
},
{
"input": "K3n5JwuWoJdFUVq8H5QldFqDD2B9yCUDFY1TTMN10",
"output": "118"
},
{
"input": "J5pm96D11kPTf",
"output": "4"
},
{
"input": "G7pT.FXaC9ChoODEaRkTGL41NIcXmG9FiiS",
"output": "137"
},
{
"input": "G45OZakwa5JVOES9UdXq9Edpj",
"output": "82"
},
{
"input": "F646Pj3RlX5iZ9ei8oCh.IDjGCcvPQofAPCpNRwkBa6uido8w",
"output": "-44"
},
{
"input": "D86oFsPzzwtuj5oEoxrYo",
"output": "-191"
},
{
"input": "D5LkqCdKJsy",
"output": "-36"
},
{
"input": "C7NRgNxtXJlwSuEhNJHkWH0LmEpUwcKbs",
"output": "17"
},
{
"input": "B9O9WWF",
"output": "69"
},
{
"input": "M1TEc65C1h",
"output": "30"
},
{
"input": "L3TuSHPiE7oQPhOnQlHZhsknMEO5.2.R",
"output": "99"
},
{
"input": "L5VbIQ",
"output": "58"
},
{
"input": "I9WJ8Z4neyQpjakuk6bIJyzbWVnT",
"output": "-14"
},
{
"input": "I6lEiuI6zuUfJQ0peI",
"output": "-36"
},
{
"input": "H8nxY2bfCKIrUMANJT2V1v7JPOnoQGMuk7SZp.oS",
"output": "121"
},
{
"input": "FApeOAvCPk64",
"output": "-12"
},
{
"input": "F7",
"output": "6"
},
{
"input": "E94HphU3y4z6Q3nMYz8YYuvvtR",
"output": "-43"
},
{
"input": "DB6zepob9WnHY0zvC8nPOzVpSYDZsTgLfzdvj4L8DrRPCdHS",
"output": "6"
},
{
"input": "O",
"output": "15"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "-1300"
},
{
"input": "kKKKKKkkkkkKKKKKkkkKKKKKkkkkkkkkkkkKKKKKkkkkkKKKKK",
"output": "0"
}
] | 1,576,512,247
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 39
| 156
| 0
|
s = input()
ans = 0
for x in s:
if x.isupper(): ans += ord(x) - ord('A') + 1
if x.islower(): ans -= ord(x) - ord('a') + 1
print(ans)
|
Title: Without Text
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You can preview the image in better quality by the link: [http://assets.codeforces.com/files/656/without-text.png](//assets.codeforces.com/files/656/without-text.png)
Input Specification:
The only line of the input is a string (between 1 and 50 characters long, inclusive). Each character will be an alphanumeric character or a full stop ".".
Output Specification:
Output the required answer.
Demo Input:
['Codeforces\n', 'APRIL.1st\n']
Demo Output:
['-87\n', '17\n']
Note:
none
|
```python
s = input()
ans = 0
for x in s:
if x.isupper(): ans += ord(x) - ord('A') + 1
if x.islower(): ans -= ord(x) - ord('a') + 1
print(ans)
```
| 3
|
|
514
|
A
|
Chewbaсca and Number
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
|
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
|
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
|
[
"27\n",
"4545\n"
] |
[
"22\n",
"4444\n"
] |
none
| 500
|
[
{
"input": "27",
"output": "22"
},
{
"input": "4545",
"output": "4444"
},
{
"input": "1",
"output": "1"
},
{
"input": "9",
"output": "9"
},
{
"input": "8772",
"output": "1222"
},
{
"input": "81",
"output": "11"
},
{
"input": "71723447",
"output": "21223442"
},
{
"input": "91730629",
"output": "91230320"
},
{
"input": "420062703497",
"output": "420032203402"
},
{
"input": "332711047202",
"output": "332211042202"
},
{
"input": "3395184971407775",
"output": "3304114021402224"
},
{
"input": "8464062628894325",
"output": "1434032321104324"
},
{
"input": "164324828731963982",
"output": "134324121231033012"
},
{
"input": "384979173822804784",
"output": "314020123122104214"
},
{
"input": "41312150450968417",
"output": "41312140440031412"
},
{
"input": "2156",
"output": "2143"
},
{
"input": "1932",
"output": "1032"
},
{
"input": "5902",
"output": "4002"
},
{
"input": "5728",
"output": "4221"
},
{
"input": "8537",
"output": "1432"
},
{
"input": "55403857",
"output": "44403142"
},
{
"input": "270739",
"output": "220230"
},
{
"input": "28746918",
"output": "21243011"
},
{
"input": "10279211",
"output": "10220211"
},
{
"input": "40289679",
"output": "40210320"
},
{
"input": "545203238506",
"output": "444203231403"
},
{
"input": "461117063340",
"output": "431112033340"
},
{
"input": "658492686568",
"output": "341402313431"
},
{
"input": "857373361868",
"output": "142323331131"
},
{
"input": "429325660016",
"output": "420324330013"
},
{
"input": "9894448650287940",
"output": "9104441340212040"
},
{
"input": "6354510839296263",
"output": "3344410130203233"
},
{
"input": "6873575462224593",
"output": "3123424432224403"
},
{
"input": "4237951492601449",
"output": "4232041402301440"
},
{
"input": "2680352384836991",
"output": "2310342314133001"
},
{
"input": "606187734191890310",
"output": "303112234101100310"
},
{
"input": "351499943576823355",
"output": "341400043423123344"
},
{
"input": "180593481782177068",
"output": "110403411212122031"
},
{
"input": "999999999999999999",
"output": "900000000000000000"
},
{
"input": "1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "9999",
"output": "9000"
},
{
"input": "99",
"output": "90"
},
{
"input": "9991",
"output": "9001"
}
] | 1,695,478,969
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 43
| 62
| 0
|
n = list(map(int, list(input())))
for i in range(len(n)):
n[i] = min(n[i], 9 - n[i])
if n[0] == 0:
n[0] = 9
print("".join(map(str, n)))
|
Title: Chewbaсca and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Output Specification:
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
Demo Input:
['27\n', '4545\n']
Demo Output:
['22\n', '4444\n']
Note:
none
|
```python
n = list(map(int, list(input())))
for i in range(len(n)):
n[i] = min(n[i], 9 - n[i])
if n[0] == 0:
n[0] = 9
print("".join(map(str, n)))
```
| 3
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.