contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
313
|
A
|
Ilya and Bank Account
|
PROGRAMMING
| 900
|
[
"implementation",
"number theory"
] | null | null |
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money.
Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance.
Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
|
The single line contains integer *n* (10<=β€<=|*n*|<=β€<=109) β the state of Ilya's bank account.
|
In a single line print an integer β the maximum state of the bank account that Ilya can get.
|
[
"2230\n",
"-10\n",
"-100003\n"
] |
[
"2230\n",
"0\n",
"-10000\n"
] |
In the first test sample Ilya doesn't profit from using the present.
In the second test sample you can delete digit 1 and get the state of the account equal to 0.
| 500
|
[
{
"input": "2230",
"output": "2230"
},
{
"input": "-10",
"output": "0"
},
{
"input": "-100003",
"output": "-10000"
},
{
"input": "544883178",
"output": "544883178"
},
{
"input": "-847251738",
"output": "-84725173"
},
{
"input": "423654797",
"output": "423654797"
},
{
"input": "-623563697",
"output": "-62356367"
},
{
"input": "645894116",
"output": "645894116"
},
{
"input": "-384381709",
"output": "-38438170"
},
{
"input": "437587210",
"output": "437587210"
},
{
"input": "-297534606",
"output": "-29753460"
},
{
"input": "891773002",
"output": "891773002"
},
{
"input": "-56712976",
"output": "-5671296"
},
{
"input": "963662765",
"output": "963662765"
},
{
"input": "-272656295",
"output": "-27265625"
},
{
"input": "383441522",
"output": "383441522"
},
{
"input": "-477665112",
"output": "-47766511"
},
{
"input": "791725034",
"output": "791725034"
},
{
"input": "-812168727",
"output": "-81216872"
},
{
"input": "528894922",
"output": "528894922"
},
{
"input": "-479977172",
"output": "-47997712"
},
{
"input": "568044564",
"output": "568044564"
},
{
"input": "-392784794",
"output": "-39278474"
},
{
"input": "925596634",
"output": "925596634"
},
{
"input": "-836078769",
"output": "-83607876"
},
{
"input": "71036059",
"output": "71036059"
},
{
"input": "-337396162",
"output": "-33739612"
},
{
"input": "87129297",
"output": "87129297"
},
{
"input": "-648171877",
"output": "-64817187"
},
{
"input": "20218400",
"output": "20218400"
},
{
"input": "10",
"output": "10"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "-1000000000",
"output": "-100000000"
},
{
"input": "-102",
"output": "-10"
},
{
"input": "-120",
"output": "-10"
},
{
"input": "-20",
"output": "0"
},
{
"input": "-15",
"output": "-1"
},
{
"input": "-5575533",
"output": "-557553"
},
{
"input": "-50",
"output": "0"
},
{
"input": "-31",
"output": "-1"
},
{
"input": "-55",
"output": "-5"
},
{
"input": "-81",
"output": "-1"
},
{
"input": "-99",
"output": "-9"
},
{
"input": "-23",
"output": "-2"
},
{
"input": "-41",
"output": "-1"
},
{
"input": "-24",
"output": "-2"
},
{
"input": "46",
"output": "46"
}
] | 1,699,464,912
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 92
| 0
|
n=str(input())
m = n
if n[0] == '-':
if int(n[-2]) <= int(n[-1]):
m=n[:-1]
else:
m=n[:-2]+n[-1]
m=int(m)
print(m)
|
Title: Ilya and Bank Account
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money.
Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance.
Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
Input Specification:
The single line contains integer *n* (10<=β€<=|*n*|<=β€<=109) β the state of Ilya's bank account.
Output Specification:
In a single line print an integer β the maximum state of the bank account that Ilya can get.
Demo Input:
['2230\n', '-10\n', '-100003\n']
Demo Output:
['2230\n', '0\n', '-10000\n']
Note:
In the first test sample Ilya doesn't profit from using the present.
In the second test sample you can delete digit 1 and get the state of the account equal to 0.
|
```python
n=str(input())
m = n
if n[0] == '-':
if int(n[-2]) <= int(n[-1]):
m=n[:-1]
else:
m=n[:-2]+n[-1]
m=int(m)
print(m)
```
| 3
|
|
907
|
B
|
Tic-Tac-Toe
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Two bears are playing tic-tac-toe via mail. It's boring for them to play usual tic-tac-toe game, so they are a playing modified version of this game. Here are its rules.
The game is played on the following field.
Players are making moves by turns. At first move a player can put his chip in any cell of any small field. For following moves, there are some restrictions: if during last move the opposite player put his chip to cell with coordinates (*x**l*,<=*y**l*) in some small field, the next move should be done in one of the cells of the small field with coordinates (*x**l*,<=*y**l*). For example, if in the first move a player puts his chip to lower left cell of central field, then the second player on his next move should put his chip into some cell of lower left field (pay attention to the first test case). If there are no free cells in the required field, the player can put his chip to any empty cell on any field.
You are given current state of the game and coordinates of cell in which the last move was done. You should find all cells in which the current player can put his chip.
A hare works as a postman in the forest, he likes to foul bears. Sometimes he changes the game field a bit, so the current state of the game could be unreachable. However, after his changes the cell where the last move was done is not empty. You don't need to find if the state is unreachable or not, just output possible next moves according to the rules.
|
First 11 lines contains descriptions of table with 9 rows and 9 columns which are divided into 9 small fields by spaces and empty lines. Each small field is described by 9 characters without spaces and empty lines. character "x" (ASCII-code 120) means that the cell is occupied with chip of the first player, character "o" (ASCII-code 111) denotes a field occupied with chip of the second player, character "." (ASCII-code 46) describes empty cell.
The line after the table contains two integers *x* and *y* (1<=β€<=*x*,<=*y*<=β€<=9). They describe coordinates of the cell in table where the last move was done. Rows in the table are numbered from up to down and columns are numbered from left to right.
It's guaranteed that cell where the last move was done is filled with "x" or "o". Also, it's guaranteed that there is at least one empty cell. It's not guaranteed that current state of game is reachable.
|
Output the field in same format with characters "!" (ASCII-code 33) on positions where the current player can put his chip. All other cells should not be modified.
|
[
"... ... ...\n... ... ...\n... ... ...\n\n... ... ...\n... ... ...\n... x.. ...\n\n... ... ...\n... ... ...\n... ... ...\n6 4\n",
"xoo x.. x..\nooo ... ...\nooo ... ...\n\nx.. x.. x..\n... ... ...\n... ... ...\n\nx.. x.. x..\n... ... ...\n... ... ...\n7 4\n",
"o.. ... ...\n... ... ...\n... ... ...\n\n... xxx ...\n... xox ...\n... ooo ...\n\n... ... ...\n... ... ...\n... ... ...\n5 5\n"
] |
[
"... ... ... \n... ... ... \n... ... ... \n\n... ... ... \n... ... ... \n... x.. ... \n\n!!! ... ... \n!!! ... ... \n!!! ... ... \n\n",
"xoo x!! x!! \nooo !!! !!! \nooo !!! !!! \n\nx!! x!! x!! \n!!! !!! !!! \n!!! !!! !!! \n\nx!! x!! x!! \n!!! !!! !!! \n!!! !!! !!! \n\n",
"o!! !!! !!! \n!!! !!! !!! \n!!! !!! !!! \n\n!!! xxx !!! \n!!! xox !!! \n!!! ooo !!! \n\n!!! !!! !!! \n!!! !!! !!! \n!!! !!! !!! \n\n"
] |
In the first test case the first player made a move to lower left cell of central field, so the second player can put a chip only to cells of lower left field.
In the second test case the last move was done to upper left cell of lower central field, however all cells in upper left field are occupied, so the second player can put his chip to any empty cell.
In the third test case the last move was done to central cell of central field, so current player can put his chip to any cell of central field, which is already occupied, so he can move anywhere. Pay attention that this state of the game is unreachable.
| 1,000
|
[
{
"input": "... ... ...\n... ... ...\n... ... ...\n\n... ... ...\n... ... ...\n... x.. ...\n\n... ... ...\n... ... ...\n... ... ...\n6 4",
"output": "... ... ... \n... ... ... \n... ... ... \n\n... ... ... \n... ... ... \n... x.. ... \n\n!!! ... ... \n!!! ... ... \n!!! ... ... "
},
{
"input": "xoo x.. x..\nooo ... ...\nooo ... ...\n\nx.. x.. x..\n... ... ...\n... ... ...\n\nx.. x.. x..\n... ... ...\n... ... ...\n7 4",
"output": "xoo x!! x!! \nooo !!! !!! \nooo !!! !!! \n\nx!! x!! x!! \n!!! !!! !!! \n!!! !!! !!! \n\nx!! x!! x!! \n!!! !!! !!! \n!!! !!! !!! "
},
{
"input": "o.. ... ...\n... ... ...\n... ... ...\n\n... xxx ...\n... xox ...\n... ooo ...\n\n... ... ...\n... ... ...\n... ... ...\n5 5",
"output": "o!! !!! !!! \n!!! !!! !!! \n!!! !!! !!! \n\n!!! xxx !!! \n!!! xox !!! \n!!! ooo !!! \n\n!!! !!! !!! \n!!! !!! !!! \n!!! !!! !!! "
},
{
"input": ".o. .o. ..x\n..x .xx ..o\n... ... ...\n\n... ... xxo\n..x o.o oxo\n.x. .o. xoo\n\n... o.. ...\n..o .xx ..x\n... ... ...\n5 9",
"output": "!o! !o! !!x \n!!x !xx !!o \n!!! !!! !!! \n\n!!! !!! xxo \n!!x o!o oxo \n!x! !o! xoo \n\n!!! o!! !!! \n!!o !xx !!x \n!!! !!! !!! "
},
{
"input": "... .o. ...\n... ... ...\n... ... ...\n\n... ... ...\n... ... ...\n... .x. ..x\n\n.x. ... ...\n..o ... .o.\n... o.o xx.\n1 5",
"output": "... !o! ... \n... !!! ... \n... !!! ... \n\n... ... ... \n... ... ... \n... .x. ..x \n\n.x. ... ... \n..o ... .o. \n... o.o xx. "
},
{
"input": "ooo oxx xxo\nx.x oox xox\noox xo. xxx\n\nxxo xxx o.o\nxoo xo. oxo\nooo xox ox.\n\nxoo xoo .oo\nxox xox ox.\noxx xox oxo\n1 3",
"output": "ooo oxx xxo \nx!x oox xox \noox xo! xxx \n\nxxo xxx o!o \nxoo xo! oxo \nooo xox ox! \n\nxoo xoo !oo \nxox xox ox! \noxx xox oxo "
},
{
"input": "... ... ...\n..o ... ..o\n... .x. ..x\n\nx.. ... ...\n.x. .ox oo.\n... .xo ..x\n\n... ... .ox\n... ox. ..x\n... ..o .o.\n2 3",
"output": "... ... ... \n..o ... ..o \n... .x. ..x \n\nx.. ... !!! \n.x. .ox oo! \n... .xo !!x \n\n... ... .ox \n... ox. ..x \n... ..o .o. "
},
{
"input": "xox o.x xxo\nxox xox oxo\nxxx .xx xoo\n\nooo oox o.x\n.xx xx. oo.\nooo xox ooo\n\nooo oxo xox\nx.x xox xox\noxo x.o xxo\n1 7",
"output": "xox o!x xxo \nxox xox oxo \nxxx !xx xoo \n\nooo oox o!x \n!xx xx! oo! \nooo xox ooo \n\nooo oxo xox \nx!x xox xox \noxo x!o xxo "
},
{
"input": "ox. x.o ..x\n... ..o .o.\n.o. ... x.o\n\nx.x .oo ...\n..o ox. .xx\n..x o.x .o.\n\n... ... .x.\nox. xx. .o.\n... ... ..o\n9 9",
"output": "ox. x.o ..x \n... ..o .o. \n.o. ... x.o \n\nx.x .oo ... \n..o ox. .xx \n..x o.x .o. \n\n... ... !x! \nox. xx. !o! \n... ... !!o "
},
{
"input": "xx. oxx .xo\nxxx o.o xox\nxoo xoo xoo\n\nooo o.x xox\no.. xoo .xo\noxx .x. xoo\n\nooo oxo oxx\nxxx xox ..o\noo. oxx xx.\n3 8",
"output": "xx! oxx !xo \nxxx o!o xox \nxoo xoo xoo \n\nooo o!x xox \no!! xoo !xo \noxx !x! xoo \n\nooo oxo oxx \nxxx xox !!o \noo! oxx xx! "
},
{
"input": "... xo. o..\noo. ..o xx.\n..x x.. ..o\n\n.ox .xx ...\no.x xox xo.\nxox .xo ..o\n\n..o ... xxo\no.. .o. oxo\n..o x.. ..x\n8 9",
"output": "... xo. o.. \noo. ..o xx. \n..x x.. ..o \n\n.ox .xx !!! \no.x xox xo! \nxox .xo !!o \n\n..o ... xxo \no.. .o. oxo \n..o x.. ..x "
},
{
"input": "oox xoo xxx\nooo xxo oxo\nxxx xoo xxo\n\noxo oxx xoo\nxoo oox xox\nxox oox oox\n\nxxo xoo oxo\noxx xxx xxx\noxo oxo oo.\n1 5",
"output": "oox xoo xxx \nooo xxo oxo \nxxx xoo xxo \n\noxo oxx xoo \nxoo oox xox \nxox oox oox \n\nxxo xoo oxo \noxx xxx xxx \noxo oxo oo! "
},
{
"input": ".oo x.o xoo\n.o. xxx .x.\n..o x.o xxx\n\n..o .oo .xx\n.x. xox o.o\n.xo o.o .x.\n\n.o. xo. xxx\n.xo o.. .xo\n..o ..o xox\n1 8",
"output": ".oo x!o xoo \n.o. xxx .x. \n..o x!o xxx \n\n..o .oo .xx \n.x. xox o.o \n.xo o.o .x. \n\n.o. xo. xxx \n.xo o.. .xo \n..o ..o xox "
},
{
"input": "xxo xoo xxo\nooo ooo xxx\noox oxo oxx\n\noxo oxo xxx\nxoo oxx oxo\nxxx oxx ooo\n\noxx xoo xxo\nxxx oox xox\nxxo o.o oxo\n9 6",
"output": "xxo xoo xxo \nooo ooo xxx \noox oxo oxx \n\noxo oxo xxx \nxoo oxx oxo \nxxx oxx ooo \n\noxx xoo xxo \nxxx oox xox \nxxo o!o oxo "
},
{
"input": "ox. o.x .o.\nxxo xoo .oo\n.xx oox o..\n\nxx. oox oxx\noox oxx xxo\nxo. oxo x.x\n\no.x .x. xx.\n.xo ox. ooo\n.ox xo. ..o\n6 2",
"output": "ox. o.x .o. \nxxo xoo .oo \n.xx oox o.. \n\nxx. oox oxx \noox oxx xxo \nxo. oxo x.x \n\no.x !x! xx. \n.xo ox! ooo \n.ox xo! ..o "
},
{
"input": "oxo xoo ox.\nxxx xoo xxo\nxoo xxx xox\n\nxxx xxx xoo\nooo o.o oxx\nxxo ooo xxx\n\nooo oox ooo\nooo oxo xxx\nxxo xox xxo\n6 1",
"output": "oxo xoo ox! \nxxx xoo xxo \nxoo xxx xox \n\nxxx xxx xoo \nooo o!o oxx \nxxo ooo xxx \n\nooo oox ooo \nooo oxo xxx \nxxo xox xxo "
},
{
"input": ".xo oxx xoo\nooo .xo xxx\noxo oox xoo\n\nx.o xoo xxx\nxo. oxo oxx\nx.x xoo o.o\n\nxoo xox oxx\nooo .x. .xx\nxox x.. xoo\n6 5",
"output": ".xo oxx xoo \nooo .xo xxx \noxo oox xoo \n\nx.o xoo xxx \nxo. oxo oxx \nx.x xoo o.o \n\nxoo xox oxx \nooo !x! .xx \nxox x!! xoo "
},
{
"input": "oxo xox ooo\n.xo xxo oxx\nxxx oxo xxx\n\nxxo oxx .xx\nxo. xoo oxx\noxo oxx xox\n\nxoo ooo oox\nooo ooo xxo\nxxx x.o oxo\n2 2",
"output": "oxo xox ooo \n!xo xxo oxx \nxxx oxo xxx \n\nxxo oxx !xx \nxo! xoo oxx \noxo oxx xox \n\nxoo ooo oox \nooo ooo xxo \nxxx x!o oxo "
},
{
"input": "xox xxx xoo\nxoo xxx oxo\nxoo oox xoo\n\noxo oox xox\noxo xox xox\noox xoo oox\n\no.o xox oox\noox xxo xxo\nxox xxx oxo\n3 4",
"output": "xox xxx xoo \nxoo xxx oxo \nxoo oox xoo \n\noxo oox xox \noxo xox xox \noox xoo oox \n\no!o xox oox \noox xxo xxo \nxox xxx oxo "
},
{
"input": "ooo xxx .x.\nxxo oox ooo\n.o. oox xxx\n\nxox oxx xxo\nxxx oxx oxx\noxx ooo ooo\n\n.oo xoo xo.\nxxo oox ooo\nxox xxx xxo\n5 1",
"output": "ooo xxx !x! \nxxo oox ooo \n!o! oox xxx \n\nxox oxx xxo \nxxx oxx oxx \noxx ooo ooo \n\n!oo xoo xo! \nxxo oox ooo \nxox xxx xxo "
}
] | 1,514,041,282
| 3,382
|
Python 3
|
OK
|
TESTS
| 20
| 62
| 5,632,000
|
field = [[""]*9 for i in range(9)]
z = 0
for i in range(3):
temp2 = input()
for z2 in range(len(temp2)):
if temp2[z2] != " ":
field[i][z] = temp2[z2]
z+= 1
z = 0
input()
for i in range(3,6):
temp2 = input()
for z2 in range(len(temp2)):
if temp2[z2] != " ":
field[i][z] = temp2[z2]
z+= 1
z = 0
input()
for i in range(6,9):
temp2 = input()
for z2 in range(len(temp2)):
if temp2[z2] != " ":
field[i][z] = temp2[z2]
z+= 1
z = 0
x, y = map(int,input().split())
x2 = ((y-1) % 3) * 3
y2 = ((x-1) % 3) * 3
temp = 0
for i in range(3):
for j in range(3):
if field[y2+i][x2+j] == ".":
field[y2+i][x2+j] = "!"
temp += 1
if temp == 0:
for i in range(9):
for j in range(9):
if field[i][j] == ".":
field[i][j] = "!"
for i in range(9):
for j in range(9):
if j % 3 == 0 and j != 0:
print("",end=" ")
print(field[i][j],end="")
if i % 3 == 2 and i != 8:
print()
print()
|
Title: Tic-Tac-Toe
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two bears are playing tic-tac-toe via mail. It's boring for them to play usual tic-tac-toe game, so they are a playing modified version of this game. Here are its rules.
The game is played on the following field.
Players are making moves by turns. At first move a player can put his chip in any cell of any small field. For following moves, there are some restrictions: if during last move the opposite player put his chip to cell with coordinates (*x**l*,<=*y**l*) in some small field, the next move should be done in one of the cells of the small field with coordinates (*x**l*,<=*y**l*). For example, if in the first move a player puts his chip to lower left cell of central field, then the second player on his next move should put his chip into some cell of lower left field (pay attention to the first test case). If there are no free cells in the required field, the player can put his chip to any empty cell on any field.
You are given current state of the game and coordinates of cell in which the last move was done. You should find all cells in which the current player can put his chip.
A hare works as a postman in the forest, he likes to foul bears. Sometimes he changes the game field a bit, so the current state of the game could be unreachable. However, after his changes the cell where the last move was done is not empty. You don't need to find if the state is unreachable or not, just output possible next moves according to the rules.
Input Specification:
First 11 lines contains descriptions of table with 9 rows and 9 columns which are divided into 9 small fields by spaces and empty lines. Each small field is described by 9 characters without spaces and empty lines. character "x" (ASCII-code 120) means that the cell is occupied with chip of the first player, character "o" (ASCII-code 111) denotes a field occupied with chip of the second player, character "." (ASCII-code 46) describes empty cell.
The line after the table contains two integers *x* and *y* (1<=β€<=*x*,<=*y*<=β€<=9). They describe coordinates of the cell in table where the last move was done. Rows in the table are numbered from up to down and columns are numbered from left to right.
It's guaranteed that cell where the last move was done is filled with "x" or "o". Also, it's guaranteed that there is at least one empty cell. It's not guaranteed that current state of game is reachable.
Output Specification:
Output the field in same format with characters "!" (ASCII-code 33) on positions where the current player can put his chip. All other cells should not be modified.
Demo Input:
['... ... ...\n... ... ...\n... ... ...\n\n... ... ...\n... ... ...\n... x.. ...\n\n... ... ...\n... ... ...\n... ... ...\n6 4\n', 'xoo x.. x..\nooo ... ...\nooo ... ...\n\nx.. x.. x..\n... ... ...\n... ... ...\n\nx.. x.. x..\n... ... ...\n... ... ...\n7 4\n', 'o.. ... ...\n... ... ...\n... ... ...\n\n... xxx ...\n... xox ...\n... ooo ...\n\n... ... ...\n... ... ...\n... ... ...\n5 5\n']
Demo Output:
['... ... ... \n... ... ... \n... ... ... \n\n... ... ... \n... ... ... \n... x.. ... \n\n!!! ... ... \n!!! ... ... \n!!! ... ... \n\n', 'xoo x!! x!! \nooo !!! !!! \nooo !!! !!! \n\nx!! x!! x!! \n!!! !!! !!! \n!!! !!! !!! \n\nx!! x!! x!! \n!!! !!! !!! \n!!! !!! !!! \n\n', 'o!! !!! !!! \n!!! !!! !!! \n!!! !!! !!! \n\n!!! xxx !!! \n!!! xox !!! \n!!! ooo !!! \n\n!!! !!! !!! \n!!! !!! !!! \n!!! !!! !!! \n\n']
Note:
In the first test case the first player made a move to lower left cell of central field, so the second player can put a chip only to cells of lower left field.
In the second test case the last move was done to upper left cell of lower central field, however all cells in upper left field are occupied, so the second player can put his chip to any empty cell.
In the third test case the last move was done to central cell of central field, so current player can put his chip to any cell of central field, which is already occupied, so he can move anywhere. Pay attention that this state of the game is unreachable.
|
```python
field = [[""]*9 for i in range(9)]
z = 0
for i in range(3):
temp2 = input()
for z2 in range(len(temp2)):
if temp2[z2] != " ":
field[i][z] = temp2[z2]
z+= 1
z = 0
input()
for i in range(3,6):
temp2 = input()
for z2 in range(len(temp2)):
if temp2[z2] != " ":
field[i][z] = temp2[z2]
z+= 1
z = 0
input()
for i in range(6,9):
temp2 = input()
for z2 in range(len(temp2)):
if temp2[z2] != " ":
field[i][z] = temp2[z2]
z+= 1
z = 0
x, y = map(int,input().split())
x2 = ((y-1) % 3) * 3
y2 = ((x-1) % 3) * 3
temp = 0
for i in range(3):
for j in range(3):
if field[y2+i][x2+j] == ".":
field[y2+i][x2+j] = "!"
temp += 1
if temp == 0:
for i in range(9):
for j in range(9):
if field[i][j] == ".":
field[i][j] = "!"
for i in range(9):
for j in range(9):
if j % 3 == 0 and j != 0:
print("",end=" ")
print(field[i][j],end="")
if i % 3 == 2 and i != 8:
print()
print()
```
| 3
|
|
137
|
B
|
Permutation
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
"Hey, it's homework time" β thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
|
The first line of the input data contains an integer *n* (1<=β€<=*n*<=β€<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=β€<=*a**i*<=β€<=5000,<=1<=β€<=*i*<=β€<=*n*).
|
Print the only number β the minimum number of changes needed to get the permutation.
|
[
"3\n3 1 2\n",
"2\n2 2\n",
"5\n5 3 3 3 1\n"
] |
[
"0\n",
"1\n",
"2\n"
] |
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2.
| 1,000
|
[
{
"input": "3\n3 1 2",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "5\n5 3 3 3 1",
"output": "2"
},
{
"input": "5\n6 6 6 6 6",
"output": "5"
},
{
"input": "10\n1 1 2 2 8 8 7 7 9 9",
"output": "5"
},
{
"input": "8\n9 8 7 6 5 4 3 2",
"output": "1"
},
{
"input": "15\n1 2 3 4 5 5 4 3 2 1 1 2 3 4 5",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n5000",
"output": "1"
},
{
"input": "4\n5000 5000 5000 5000",
"output": "4"
},
{
"input": "5\n3366 3461 4 5 4370",
"output": "3"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "0"
},
{
"input": "10\n551 3192 3213 2846 3068 1224 3447 1 10 9",
"output": "7"
},
{
"input": "15\n4 1459 12 4281 3241 2748 10 3590 14 845 3518 1721 2 2880 1974",
"output": "10"
},
{
"input": "15\n15 1 8 2 13 11 12 7 3 14 6 10 9 4 5",
"output": "0"
},
{
"input": "15\n2436 2354 4259 1210 2037 2665 700 3578 2880 973 1317 1024 24 3621 4142",
"output": "15"
},
{
"input": "30\n28 1 3449 9 3242 4735 26 3472 15 21 2698 7 4073 3190 10 3 29 1301 4526 22 345 3876 19 12 4562 2535 2 630 18 27",
"output": "14"
},
{
"input": "100\n50 39 95 30 66 78 2169 4326 81 31 74 34 80 40 19 48 97 63 82 6 88 16 21 57 92 77 10 1213 17 93 32 91 38 4375 29 75 44 22 4 45 14 2395 3254 59 3379 2 85 96 8 83 27 94 1512 2960 100 9 73 79 7 25 55 69 90 99 51 87 98 62 18 35 43 4376 4668 28 72 56 4070 61 65 36 54 4106 11 24 15 86 70 71 4087 23 13 76 20 4694 26 4962 4726 37 14 64",
"output": "18"
},
{
"input": "100\n340 14 3275 2283 2673 1107 817 2243 1226 32 2382 3638 4652 418 68 4962 387 764 4647 159 1846 225 2760 4904 3150 403 3 2439 91 4428 92 4705 75 348 1566 1465 69 6 49 4 62 4643 564 1090 3447 1871 2255 139 24 99 2669 969 86 61 4550 158 4537 3993 1589 872 2907 1888 401 80 1825 1483 63 1 2264 4068 4113 2548 41 885 4806 36 67 167 4447 34 1248 2593 82 202 81 1783 1284 4973 16 43 95 7 865 2091 3008 1793 20 947 4912 3604",
"output": "70"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "2\n5000 5000",
"output": "2"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
},
{
"input": "2\n3 4",
"output": "2"
},
{
"input": "10\n1 2 3 4 5 6 7 1000 10 10",
"output": "2"
}
] | 1,435,950,845
| 245
|
Python 3
|
OK
|
TESTS
| 48
| 124
| 512,000
|
n = int(input())
a = input().split()
d = {}
for i in a:
t = int(i)
if t in d:
d[t] += 1
else:
d[t] = 1
res = 0
for i in range(1, n+1):
if i not in d:
res += 1
print(res)
|
Title: Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Hey, it's homework time" β thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
Input Specification:
The first line of the input data contains an integer *n* (1<=β€<=*n*<=β€<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=β€<=*a**i*<=β€<=5000,<=1<=β€<=*i*<=β€<=*n*).
Output Specification:
Print the only number β the minimum number of changes needed to get the permutation.
Demo Input:
['3\n3 1 2\n', '2\n2 2\n', '5\n5 3 3 3 1\n']
Demo Output:
['0\n', '1\n', '2\n']
Note:
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2.
|
```python
n = int(input())
a = input().split()
d = {}
for i in a:
t = int(i)
if t in d:
d[t] += 1
else:
d[t] = 1
res = 0
for i in range(1, n+1):
if i not in d:
res += 1
print(res)
```
| 3
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=β€<=*n*<=β€<=100) β the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=β€<=*p**i*<=β€<=100) β the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3Β·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,685,079,310
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n=int(input())
print(sum(list(map(int,input().split())))/n)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=β€<=*n*<=β€<=100) β the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=β€<=*p**i*<=β€<=100) β the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3Β·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
n=int(input())
print(sum(list(map(int,input().split())))/n)
```
| 3
|
|
713
|
C
|
Sonya and Problem Wihtout a Legend
|
PROGRAMMING
| 2,300
|
[
"dp",
"sortings"
] | null | null |
Sonya was unable to think of a story for this problem, so here comes the formal description.
You are given the array containing *n* positive integers. At one turn you can pick any element and increase or decrease it by 1. The goal is the make the array strictly increasing by making the minimum possible number of operations. You are allowed to change elements in any way, they can become negative or equal to 0.
|
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=3000)Β β the length of the array.
Next line contains *n* integer *a**i* (1<=β€<=*a**i*<=β€<=109).
|
Print the minimum number of operation required to make the array strictly increasing.
|
[
"7\n2 1 5 11 5 9 11\n",
"5\n5 4 3 2 1\n"
] |
[
"9\n",
"12\n"
] |
In the first sample, the array is going to look as follows:
2 3 5 6 7 9 11
|2β-β2|β+β|1β-β3|β+β|5β-β5|β+β|11β-β6|β+β|5β-β7|β+β|9β-β9|β+β|11β-β11|β=β9
And for the second sample:
1 2 3 4 5
|5β-β1|β+β|4β-β2|β+β|3β-β3|β+β|2β-β4|β+β|1β-β5|β=β12
| 2,000
|
[
{
"input": "7\n2 1 5 11 5 9 11",
"output": "9"
},
{
"input": "5\n5 4 3 2 1",
"output": "12"
},
{
"input": "2\n1 1000",
"output": "0"
},
{
"input": "2\n1000 1",
"output": "1000"
},
{
"input": "5\n100 80 60 70 90",
"output": "54"
},
{
"input": "10\n10 16 17 11 1213 1216 1216 1209 3061 3062",
"output": "16"
},
{
"input": "20\n103 103 110 105 107 119 113 121 116 132 128 124 128 125 138 137 140 136 154 158",
"output": "43"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "5\n1 1 1 2 3",
"output": "3"
},
{
"input": "1\n1000",
"output": "0"
},
{
"input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319",
"output": "12423"
},
{
"input": "75\n392 593 98 533 515 448 220 310 386 79 539 294 208 828 75 534 875 493 94 205 656 105 546 493 60 188 222 108 788 504 809 621 934 455 307 212 630 298 938 62 850 421 839 134 950 256 934 817 209 559 866 67 990 835 534 672 468 768 757 516 959 893 275 315 692 927 321 554 801 805 885 12 67 245 495",
"output": "17691"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "2546"
},
{
"input": "20\n245 891 363 6 193 704 420 447 237 947 664 894 512 194 513 616 671 623 686 378",
"output": "3208"
},
{
"input": "5\n850 840 521 42 169",
"output": "1485"
}
] | 1,583,323,835
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 57
| 249
| 11,366,400
|
from bisect import bisect_left as BL
n = int(input())
graph = [(-99**9, 0)] # x, slope
ans = 0
for i,a in enumerate(map(int,input().split())):
a-= i
new = []
turnj = BL(graph, (a,99**9)) - 1
if turnj != len(graph)-1:
ans+= graph[-1][0] - a
# add |x-a|
for j in range(turnj):
x, sl = graph[j]
new.append((x, sl-1))
for j in range(turnj, len(graph)):
x, sl = graph[j]
if j == turnj:
new.append((x, sl-1))
new.append((a, sl+1))
else: new.append((x, sl+1))
# remove positive slopes
graph = new
while graph[-1][1] > 0: x, sl = graph.pop()
if graph[-1][1] != 0: graph.append((x, 0))
print(ans)
|
Title: Sonya and Problem Wihtout a Legend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya was unable to think of a story for this problem, so here comes the formal description.
You are given the array containing *n* positive integers. At one turn you can pick any element and increase or decrease it by 1. The goal is the make the array strictly increasing by making the minimum possible number of operations. You are allowed to change elements in any way, they can become negative or equal to 0.
Input Specification:
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=3000)Β β the length of the array.
Next line contains *n* integer *a**i* (1<=β€<=*a**i*<=β€<=109).
Output Specification:
Print the minimum number of operation required to make the array strictly increasing.
Demo Input:
['7\n2 1 5 11 5 9 11\n', '5\n5 4 3 2 1\n']
Demo Output:
['9\n', '12\n']
Note:
In the first sample, the array is going to look as follows:
2 3 5 6 7 9 11
|2β-β2|β+β|1β-β3|β+β|5β-β5|β+β|11β-β6|β+β|5β-β7|β+β|9β-β9|β+β|11β-β11|β=β9
And for the second sample:
1 2 3 4 5
|5β-β1|β+β|4β-β2|β+β|3β-β3|β+β|2β-β4|β+β|1β-β5|β=β12
|
```python
from bisect import bisect_left as BL
n = int(input())
graph = [(-99**9, 0)] # x, slope
ans = 0
for i,a in enumerate(map(int,input().split())):
a-= i
new = []
turnj = BL(graph, (a,99**9)) - 1
if turnj != len(graph)-1:
ans+= graph[-1][0] - a
# add |x-a|
for j in range(turnj):
x, sl = graph[j]
new.append((x, sl-1))
for j in range(turnj, len(graph)):
x, sl = graph[j]
if j == turnj:
new.append((x, sl-1))
new.append((a, sl+1))
else: new.append((x, sl+1))
# remove positive slopes
graph = new
while graph[-1][1] > 0: x, sl = graph.pop()
if graph[-1][1] != 0: graph.append((x, 0))
print(ans)
```
| 3
|
|
877
|
A
|
Alex and broken contest
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
|
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 β the name of the problem.
|
Print "YES", if problem is from this contest, and "NO" otherwise.
|
[
"Alex_and_broken_contest\n",
"NikitaAndString\n",
"Danil_and_Olya\n"
] |
[
"NO",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "Alex_and_broken_contest",
"output": "NO"
},
{
"input": "NikitaAndString",
"output": "YES"
},
{
"input": "Danil_and_Olya",
"output": "NO"
},
{
"input": "Slava____and_the_game",
"output": "YES"
},
{
"input": "Olya_and_energy_drinks",
"output": "YES"
},
{
"input": "Danil_and_part_time_job",
"output": "YES"
},
{
"input": "Ann_and_books",
"output": "YES"
},
{
"input": "Olya",
"output": "YES"
},
{
"input": "Nikita",
"output": "YES"
},
{
"input": "Slava",
"output": "YES"
},
{
"input": "Vanya",
"output": "NO"
},
{
"input": "I_dont_know_what_to_write_here",
"output": "NO"
},
{
"input": "danil_and_work",
"output": "NO"
},
{
"input": "Ann",
"output": "YES"
},
{
"input": "Batman_Nananananananan_Batman",
"output": "NO"
},
{
"input": "Olya_Nikita_Ann_Slava_Danil",
"output": "NO"
},
{
"input": "its_me_Mario",
"output": "NO"
},
{
"input": "A",
"output": "NO"
},
{
"input": "Wake_up_Neo",
"output": "NO"
},
{
"input": "Hardest_problem_ever",
"output": "NO"
},
{
"input": "Nikita_Nikita",
"output": "NO"
},
{
"input": "____________________________________________________________________________________________________",
"output": "NO"
},
{
"input": "Nikitb",
"output": "NO"
},
{
"input": "Unn",
"output": "NO"
},
{
"input": "oLya_adn_smth",
"output": "NO"
},
{
"input": "FloorISLava",
"output": "NO"
},
{
"input": "ann",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "AAnnnnn",
"output": "YES"
},
{
"input": "AnnAnn",
"output": "NO"
},
{
"input": "Annn",
"output": "YES"
},
{
"input": "Dilzhan",
"output": "NO"
},
{
"input": "Danilaaa",
"output": "YES"
},
{
"input": "AndAnn",
"output": "YES"
},
{
"input": "OlyaAnnAnn",
"output": "NO"
},
{
"input": "DanilDanilOlya",
"output": "NO"
},
{
"input": "DDanil",
"output": "YES"
},
{
"input": "AnnAnnDanil",
"output": "NO"
},
{
"input": "And_Danil",
"output": "YES"
},
{
"input": "abcddddDanil",
"output": "YES"
},
{
"input": "DanilOlyaOlya",
"output": "NO"
},
{
"input": "Nikitaaa",
"output": "YES"
},
{
"input": "aaabbba",
"output": "NO"
},
{
"input": "Ann_Ann_Danil",
"output": "NO"
},
{
"input": "Danil_Danil_Nikita",
"output": "NO"
},
{
"input": "AlexaaaaaaBBBBBOlyaDDDDD",
"output": "YES"
},
{
"input": "IloveDaniland",
"output": "YES"
},
{
"input": "AnAnn",
"output": "YES"
},
{
"input": "Danil_Danil_Olya",
"output": "NO"
},
{
"input": "DanilDanilSlava",
"output": "NO"
},
{
"input": "DanilDanil",
"output": "NO"
},
{
"input": "OlyOlya",
"output": "YES"
},
{
"input": "NikitaNikitb",
"output": "YES"
},
{
"input": "ababaca",
"output": "NO"
},
{
"input": "AnnNikitaNikitaNikitaNikita__good_luck",
"output": "NO"
}
] | 1,684,211,447
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 62
| 921,600
|
import re
str = 'Danil|Olya|Slava|Ann|Nikita'
if (len(re.findall(str, input())) == 1):
print('YES')
else:
print('NO')
|
Title: Alex and broken contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
Input Specification:
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 β the name of the problem.
Output Specification:
Print "YES", if problem is from this contest, and "NO" otherwise.
Demo Input:
['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n']
Demo Output:
['NO', 'YES', 'NO']
Note:
none
|
```python
import re
str = 'Danil|Olya|Slava|Ann|Nikita'
if (len(re.findall(str, input())) == 1):
print('YES')
else:
print('NO')
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Santa Claus is the first who came to the Christmas Olympiad, and he is going to be the first to take his place at a desk! In the classroom there are *n* lanes of *m* desks each, and there are two working places at each of the desks. The lanes are numbered from 1 to *n* from the left to the right, the desks in a lane are numbered from 1 to *m* starting from the blackboard. Note that the lanes go perpendicularly to the blackboard, not along it (see picture).
The organizers numbered all the working places from 1 to 2*nm*. The places are numbered by lanes (i.Β e. all the places of the first lane go first, then all the places of the second lane, and so on), in a lane the places are numbered starting from the nearest to the blackboard (i.Β e. from the first desk in the lane), at each desk, the place on the left is numbered before the place on the right.
Santa Clause knows that his place has number *k*. Help him to determine at which lane at which desk he should sit, and whether his place is on the left or on the right!
|
The only line contains three integers *n*, *m* and *k* (1<=β€<=*n*,<=*m*<=β€<=10<=000, 1<=β€<=*k*<=β€<=2*nm*)Β β the number of lanes, the number of desks in each lane and the number of Santa Claus' place.
|
Print two integers: the number of lane *r*, the number of desk *d*, and a character *s*, which stands for the side of the desk Santa Claus. The character *s* should be "L", if Santa Clause should sit on the left, and "R" if his place is on the right.
|
[
"4 3 9\n",
"4 3 24\n",
"2 4 4\n"
] |
[
"2 2 L\n",
"4 3 R\n",
"1 2 R\n"
] |
The first and the second samples are shown on the picture. The green place corresponds to Santa Claus' place in the first example, the blue place corresponds to Santa Claus' place in the second example.
In the third sample there are two lanes with four desks in each, and Santa Claus has the fourth place. Thus, his place is in the first lane at the second desk on the right.
| 0
|
[
{
"input": "4 3 9",
"output": "2 2 L"
},
{
"input": "4 3 24",
"output": "4 3 R"
},
{
"input": "2 4 4",
"output": "1 2 R"
},
{
"input": "3 10 24",
"output": "2 2 R"
},
{
"input": "10 3 59",
"output": "10 3 L"
},
{
"input": "10000 10000 160845880",
"output": "8043 2940 R"
},
{
"input": "1 1 1",
"output": "1 1 L"
},
{
"input": "1 1 2",
"output": "1 1 R"
},
{
"input": "1 10000 1",
"output": "1 1 L"
},
{
"input": "1 10000 20000",
"output": "1 10000 R"
},
{
"input": "10000 1 1",
"output": "1 1 L"
},
{
"input": "10000 1 10000",
"output": "5000 1 R"
},
{
"input": "10000 1 20000",
"output": "10000 1 R"
},
{
"input": "3 2 1",
"output": "1 1 L"
},
{
"input": "3 2 2",
"output": "1 1 R"
},
{
"input": "3 2 3",
"output": "1 2 L"
},
{
"input": "3 2 4",
"output": "1 2 R"
},
{
"input": "3 2 5",
"output": "2 1 L"
},
{
"input": "3 2 6",
"output": "2 1 R"
},
{
"input": "3 2 7",
"output": "2 2 L"
},
{
"input": "3 2 8",
"output": "2 2 R"
},
{
"input": "3 2 9",
"output": "3 1 L"
},
{
"input": "3 2 10",
"output": "3 1 R"
},
{
"input": "3 2 11",
"output": "3 2 L"
},
{
"input": "3 2 12",
"output": "3 2 R"
},
{
"input": "300 2000 1068628",
"output": "268 314 R"
},
{
"input": "300 2000 584756",
"output": "147 378 R"
},
{
"input": "300 2000 268181",
"output": "68 91 L"
},
{
"input": "10000 9999 186450844",
"output": "9324 4745 R"
},
{
"input": "10000 9999 197114268",
"output": "9857 6990 R"
},
{
"input": "10000 9999 112390396",
"output": "5621 818 R"
},
{
"input": "10000 10000 1",
"output": "1 1 L"
},
{
"input": "10000 10000 2",
"output": "1 1 R"
},
{
"input": "10000 10000 100000001",
"output": "5001 1 L"
},
{
"input": "10000 10000 199999999",
"output": "10000 10000 L"
},
{
"input": "10000 10000 200000000",
"output": "10000 10000 R"
},
{
"input": "1 2 1",
"output": "1 1 L"
},
{
"input": "1 2 2",
"output": "1 1 R"
},
{
"input": "1 2 3",
"output": "1 2 L"
},
{
"input": "1 2 4",
"output": "1 2 R"
},
{
"input": "2 1 1",
"output": "1 1 L"
},
{
"input": "2 1 2",
"output": "1 1 R"
},
{
"input": "2 1 3",
"output": "2 1 L"
},
{
"input": "2 1 4",
"output": "2 1 R"
},
{
"input": "4 3 7",
"output": "2 1 L"
},
{
"input": "1 1 1",
"output": "1 1 L"
}
] | 1,482,657,384
| 684
|
Python 3
|
OK
|
TESTS
| 46
| 77
| 4,608,000
|
ins = list(map(int, input().split()))
n = ins[0]
m = ins[1]
k = ins[2]
koln = 1
kolm = 1
while k > 2*m:
k -= 2*m
koln+=1
while k > 2:
k-=2
kolm += 1
if k == 1:
print(koln,kolm,"L")
else:
print(koln, kolm, "R")
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus is the first who came to the Christmas Olympiad, and he is going to be the first to take his place at a desk! In the classroom there are *n* lanes of *m* desks each, and there are two working places at each of the desks. The lanes are numbered from 1 to *n* from the left to the right, the desks in a lane are numbered from 1 to *m* starting from the blackboard. Note that the lanes go perpendicularly to the blackboard, not along it (see picture).
The organizers numbered all the working places from 1 to 2*nm*. The places are numbered by lanes (i.Β e. all the places of the first lane go first, then all the places of the second lane, and so on), in a lane the places are numbered starting from the nearest to the blackboard (i.Β e. from the first desk in the lane), at each desk, the place on the left is numbered before the place on the right.
Santa Clause knows that his place has number *k*. Help him to determine at which lane at which desk he should sit, and whether his place is on the left or on the right!
Input Specification:
The only line contains three integers *n*, *m* and *k* (1<=β€<=*n*,<=*m*<=β€<=10<=000, 1<=β€<=*k*<=β€<=2*nm*)Β β the number of lanes, the number of desks in each lane and the number of Santa Claus' place.
Output Specification:
Print two integers: the number of lane *r*, the number of desk *d*, and a character *s*, which stands for the side of the desk Santa Claus. The character *s* should be "L", if Santa Clause should sit on the left, and "R" if his place is on the right.
Demo Input:
['4 3 9\n', '4 3 24\n', '2 4 4\n']
Demo Output:
['2 2 L\n', '4 3 R\n', '1 2 R\n']
Note:
The first and the second samples are shown on the picture. The green place corresponds to Santa Claus' place in the first example, the blue place corresponds to Santa Claus' place in the second example.
In the third sample there are two lanes with four desks in each, and Santa Claus has the fourth place. Thus, his place is in the first lane at the second desk on the right.
|
```python
ins = list(map(int, input().split()))
n = ins[0]
m = ins[1]
k = ins[2]
koln = 1
kolm = 1
while k > 2*m:
k -= 2*m
koln+=1
while k > 2:
k-=2
kolm += 1
if k == 1:
print(koln,kolm,"L")
else:
print(koln, kolm, "R")
```
| 3
|
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisorsΒ β 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=β€<=*n*<=β€<=100<=000).
|
The first line of the output contains a single integer *k*Β β maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,696,413,180
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 77
| 1,024,000
|
a = int(input())
print(a // 2)
b = [2] * (a // 2)
if a % 2 == 0:
print(*b)
else:
b[-1] = 3
print(*b)
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisorsΒ β 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=β€<=*n*<=β€<=100<=000).
Output Specification:
The first line of the output contains a single integer *k*Β β maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
a = int(input())
print(a // 2)
b = [2] * (a // 2)
if a % 2 == 0:
print(*b)
else:
b[-1] = 3
print(*b)
```
| 3
|
|
348
|
A
|
Mafia
|
PROGRAMMING
| 1,600
|
[
"binary search",
"math",
"sortings"
] | null | null |
One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want?
|
The first line contains integer *n* (3<=β€<=*n*<=β€<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=109) β the *i*-th number in the list is the number of rounds the *i*-th person wants to play.
|
In a single line print a single integer β the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds.
Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"3\n3 2 2\n",
"4\n2 2 2 2\n"
] |
[
"4\n",
"3\n"
] |
You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
| 500
|
[
{
"input": "3\n3 2 2",
"output": "4"
},
{
"input": "4\n2 2 2 2",
"output": "3"
},
{
"input": "7\n9 7 7 8 8 7 8",
"output": "9"
},
{
"input": "10\n13 12 10 13 13 14 10 10 12 12",
"output": "14"
},
{
"input": "10\n94 96 91 95 99 94 96 92 95 99",
"output": "106"
},
{
"input": "100\n1 555 876 444 262 234 231 598 416 261 206 165 181 988 469 123 602 592 533 97 864 716 831 156 962 341 207 377 892 51 866 96 757 317 832 476 549 472 770 1000 887 145 956 515 992 653 972 677 973 527 984 559 280 346 580 30 372 547 209 929 492 520 446 726 47 170 699 560 814 206 688 955 308 287 26 102 77 430 262 71 415 586 532 562 419 615 732 658 108 315 268 574 86 12 23 429 640 995 342 305",
"output": "1000"
},
{
"input": "3\n1 1 1",
"output": "2"
},
{
"input": "30\n94 93 90 94 90 91 93 91 93 94 93 90 100 94 97 94 94 95 94 96 94 98 97 95 97 91 91 95 98 96",
"output": "100"
},
{
"input": "5\n1000000000 5 5 4 4",
"output": "1000000000"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "4\n1 2 3 4",
"output": "4"
},
{
"input": "3\n1000000000 1000000000 10000000",
"output": "1005000000"
},
{
"input": "3\n677876423 834056477 553175531",
"output": "1032554216"
},
{
"input": "5\n1000000000 1 1 1 1",
"output": "1000000000"
},
{
"input": "4\n1000000000 1000000000 1000000000 1000000000",
"output": "1333333334"
},
{
"input": "3\n4 10 11",
"output": "13"
},
{
"input": "5\n1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1250000000"
}
] | 1,694,163,899
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 216
| 15,872,000
|
from cmath import inf
import math
import sys
from os import path
#import bisect
#import math
from functools import reduce
import collections
import sys
if (path.exists('CP/input.txt')):
sys.stdout = open('CP/output.txt', 'w')
sys.stdin = open('CP/input.txt', 'r')
def ok(mid,arr,maxi):
d = 0
for x in arr:
d += (mid - x)
#print(d)
if(d>=mid):
return True
return False
def answer():
n = int(input())
arr = list(map(int,input().split()))
l,r = 0,(2**31 - 1)
for x in arr:
l = max(l,x)
maxi = l
ans=-1
while(l<=r):
#print(l," ",r)
mid = (l+r)//2
#print(mid)
if(ok(mid,arr,maxi)):
ans = mid
r=mid-1
else:
l=mid+1
print(ans)
#t = int(input())
t=1
for _ in range(t):
answer()
|
Title: Mafia
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want?
Input Specification:
The first line contains integer *n* (3<=β€<=*n*<=β€<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=109) β the *i*-th number in the list is the number of rounds the *i*-th person wants to play.
Output Specification:
In a single line print a single integer β the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds.
Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['3\n3 2 2\n', '4\n2 2 2 2\n']
Demo Output:
['4\n', '3\n']
Note:
You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
|
```python
from cmath import inf
import math
import sys
from os import path
#import bisect
#import math
from functools import reduce
import collections
import sys
if (path.exists('CP/input.txt')):
sys.stdout = open('CP/output.txt', 'w')
sys.stdin = open('CP/input.txt', 'r')
def ok(mid,arr,maxi):
d = 0
for x in arr:
d += (mid - x)
#print(d)
if(d>=mid):
return True
return False
def answer():
n = int(input())
arr = list(map(int,input().split()))
l,r = 0,(2**31 - 1)
for x in arr:
l = max(l,x)
maxi = l
ans=-1
while(l<=r):
#print(l," ",r)
mid = (l+r)//2
#print(mid)
if(ok(mid,arr,maxi)):
ans = mid
r=mid-1
else:
l=mid+1
print(ans)
#t = int(input())
t=1
for _ in range(t):
answer()
```
| 3
|
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=β€<=*n*<=β€<=1000, 1<=β€<=*h*<=β€<=1000)Β β the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=β€<=*a**i*<=β€<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integerΒ β the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1β+β1β+β2β=β4.
In the second sample, all friends are short enough and no one has to bend, so the width 1β+β1β+β1β+β1β+β1β+β1β=β6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2β+β2β+β2β+β2β+β2β+β1β=β11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,691,168,574
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
n,h=map(int, input().split())
a= list(map(int, input().strip().split())) [:n]
c=0
for i in a:
if(i>h):
c+=2
else:
c+=1
print(c)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=β€<=*n*<=β€<=1000, 1<=β€<=*h*<=β€<=1000)Β β the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=β€<=*a**i*<=β€<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integerΒ β the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1β+β1β+β2β=β4.
In the second sample, all friends are short enough and no one has to bend, so the width 1β+β1β+β1β+β1β+β1β+β1β=β6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2β+β2β+β2β+β2β+β2β+β1β=β11.
|
```python
n,h=map(int, input().split())
a= list(map(int, input().strip().split())) [:n]
c=0
for i in a:
if(i>h):
c+=2
else:
c+=1
print(c)
```
| 3
|
|
731
|
A
|
Night at the Museum
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
|
The only line of input contains the name of some exhibitΒ β the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
|
Print one integerΒ β the minimum number of rotations of the wheel, required to print the name given in the input.
|
[
"zeus\n",
"map\n",
"ares\n"
] |
[
"18\n",
"35\n",
"34\n"
] |
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
| 500
|
[
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,663,185,732
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 44
| 62
| 0
|
wheel = input()
counter = 0
pointer = 'a'
for c in wheel:
distance = abs(ord(pointer) - ord(c))
if distance < 13:
counter += distance
else:
counter += (26 - distance)
pointer = c
print(counter)
|
Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibitΒ β the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integerΒ β the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
|
```python
wheel = input()
counter = 0
pointer = 'a'
for c in wheel:
distance = abs(ord(pointer) - ord(c))
if distance < 13:
counter += distance
else:
counter += (26 - distance)
pointer = c
print(counter)
```
| 3
|
|
431
|
A
|
Black Square
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
|
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=β€<=*a*1,<=*a*2,<=*a*3,<=*a*4<=β€<=104).
The second line contains string *s* (1<=β€<=|*s*|<=β€<=105), where the *Ρ*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
|
Print a single integer β the total number of calories that Jury wastes.
|
[
"1 2 3 4\n123214\n",
"1 5 3 2\n11221\n"
] |
[
"13\n",
"13\n"
] |
none
| 500
|
[
{
"input": "1 2 3 4\n123214",
"output": "13"
},
{
"input": "1 5 3 2\n11221",
"output": "13"
},
{
"input": "5 5 5 1\n3422",
"output": "16"
},
{
"input": "4 3 2 1\n2",
"output": "3"
},
{
"input": "5651 6882 6954 4733\n2442313421",
"output": "60055"
},
{
"input": "0 0 0 0\n4132",
"output": "0"
},
{
"input": "3163 5778 83 7640\n11141442444",
"output": "64270"
},
{
"input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442",
"output": "420780"
},
{
"input": "0 0 0 0\n1",
"output": "0"
},
{
"input": "1 2 3 4\n4",
"output": "4"
},
{
"input": "2343 7653 1242 5432\n1",
"output": "2343"
},
{
"input": "2343 7653 1242 5432\n2",
"output": "7653"
},
{
"input": "2343 7653 1242 5432\n3",
"output": "1242"
},
{
"input": "2343 7653 1242 5432\n4",
"output": "5432"
},
{
"input": "1 2 3 4\n123412",
"output": "13"
},
{
"input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111",
"output": "2650"
},
{
"input": "1 2 3 4\n11111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "1 2 3 4\n23123231321231231231231231221232123121312321",
"output": "87"
},
{
"input": "1 2 3 4\n1111111111111222222222233333333333444444444444444",
"output": "126"
},
{
"input": "2 3 1 4\n121321232412342112312313213123123412131231231232",
"output": "105"
}
] | 1,687,535,146
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 62
| 102,400
|
sList = [int(x) for x in input().split()][:4]
game = input()
count = 0
for i in game:
count += sList[int(i)-1]
print(count)
|
Title: Black Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
Input Specification:
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=β€<=*a*1,<=*a*2,<=*a*3,<=*a*4<=β€<=104).
The second line contains string *s* (1<=β€<=|*s*|<=β€<=105), where the *Ρ*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Output Specification:
Print a single integer β the total number of calories that Jury wastes.
Demo Input:
['1 2 3 4\n123214\n', '1 5 3 2\n11221\n']
Demo Output:
['13\n', '13\n']
Note:
none
|
```python
sList = [int(x) for x in input().split()][:4]
game = input()
count = 0
for i in game:
count += sList[int(i)-1]
print(count)
```
| 3
|
|
835
|
A
|
Key races
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
|
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=β€<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=β€<=1000)Β β the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
|
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
|
[
"5 1 2 1 2\n",
"3 3 1 1 1\n",
"4 5 3 1 5\n"
] |
[
"First\n",
"Second\n",
"Friendship\n"
] |
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participantΒ β in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participantΒ β in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participantΒ β in 22 milliseconds. So, it is be a draw.
| 500
|
[
{
"input": "5 1 2 1 2",
"output": "First"
},
{
"input": "3 3 1 1 1",
"output": "Second"
},
{
"input": "4 5 3 1 5",
"output": "Friendship"
},
{
"input": "1000 1000 1000 1000 1000",
"output": "Friendship"
},
{
"input": "1 1 1 1 1",
"output": "Friendship"
},
{
"input": "8 8 1 1 1",
"output": "Second"
},
{
"input": "15 14 32 65 28",
"output": "First"
},
{
"input": "894 197 325 232 902",
"output": "First"
},
{
"input": "1 2 8 8 5",
"output": "Friendship"
},
{
"input": "37 261 207 1 1000",
"output": "Friendship"
},
{
"input": "29 344 406 900 1",
"output": "Friendship"
},
{
"input": "1 2 8 9 8",
"output": "First"
},
{
"input": "2 9 8 8 9",
"output": "Friendship"
},
{
"input": "213 480 811 134 745",
"output": "First"
},
{
"input": "2 313 856 964 421",
"output": "Friendship"
},
{
"input": "1 10 2 6 10",
"output": "Friendship"
},
{
"input": "2 7 6 2 3",
"output": "Friendship"
},
{
"input": "637 324 69 612 998",
"output": "Second"
},
{
"input": "13 849 819 723 918",
"output": "Friendship"
},
{
"input": "9 5 7 8 7",
"output": "First"
},
{
"input": "6 5 7 10 4",
"output": "Friendship"
},
{
"input": "61 464 623 89 548",
"output": "First"
},
{
"input": "641 31 29 161 802",
"output": "Friendship"
},
{
"input": "3 3 1 6 9",
"output": "Friendship"
},
{
"input": "2 3 9 8 2",
"output": "Friendship"
},
{
"input": "485 117 368 567 609",
"output": "First"
},
{
"input": "4 202 512 995 375",
"output": "Friendship"
},
{
"input": "424 41 41 909 909",
"output": "Friendship"
},
{
"input": "884 913 263 641 265",
"output": "Second"
},
{
"input": "12 462 8 311 327",
"output": "Second"
},
{
"input": "436 306 266 493 580",
"output": "Second"
},
{
"input": "69 1 2 1 2",
"output": "First"
}
] | 1,663,772,699
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
s, v_1, v_2, t_1, t_2 = map(int, input().split())
if (result_1 := s * v_1 + 2 * t_1) != (result_2 := s * v_2 + 2 * t_2):
if result_1 > result_2:
print('Second')
else:
print('First')
else:
print('Friendship')
|
Title: Key races
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
Input Specification:
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=β€<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=β€<=1000)Β β the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
Output Specification:
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
Demo Input:
['5 1 2 1 2\n', '3 3 1 1 1\n', '4 5 3 1 5\n']
Demo Output:
['First\n', 'Second\n', 'Friendship\n']
Note:
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participantΒ β in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participantΒ β in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participantΒ β in 22 milliseconds. So, it is be a draw.
|
```python
s, v_1, v_2, t_1, t_2 = map(int, input().split())
if (result_1 := s * v_1 + 2 * t_1) != (result_2 := s * v_2 + 2 * t_2):
if result_1 > result_2:
print('Second')
else:
print('First')
else:
print('Friendship')
```
| 3
|
|
387
|
B
|
George and Round
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"two pointers"
] | null | null |
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=β₯<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
|
The first line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=3000) β the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=β€<=106) β the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=β€<=*b*1<=β€<=*b*2...<=β€<=*b**m*<=β€<=106) β the complexities of the problems prepared by George.
|
Print a single integer β the answer to the problem.
|
[
"3 5\n1 2 3\n1 2 2 3 3\n",
"3 5\n1 2 3\n1 1 1 1 1\n",
"3 1\n2 3 4\n1\n"
] |
[
"0\n",
"2\n",
"3\n"
] |
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2,β3,β4.
| 1,000
|
[
{
"input": "3 5\n1 2 3\n1 2 2 3 3",
"output": "0"
},
{
"input": "3 5\n1 2 3\n1 1 1 1 1",
"output": "2"
},
{
"input": "3 1\n2 3 4\n1",
"output": "3"
},
{
"input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98",
"output": "24"
}
] | 1,548,161,892
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 109
| 614,400
|
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
jb = 0
cnt = 0
for ai in a:
while jb < m and b[jb] < ai:
jb += 1
if jb == m:
break
cnt += 1
jb += 1
print(len(a) - cnt)
|
Title: George and Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=β₯<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
Input Specification:
The first line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=3000) β the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=β€<=106) β the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=β€<=*b*1<=β€<=*b*2...<=β€<=*b**m*<=β€<=106) β the complexities of the problems prepared by George.
Output Specification:
Print a single integer β the answer to the problem.
Demo Input:
['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n']
Demo Output:
['0\n', '2\n', '3\n']
Note:
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2,β3,β4.
|
```python
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
jb = 0
cnt = 0
for ai in a:
while jb < m and b[jb] < ai:
jb += 1
if jb == m:
break
cnt += 1
jb += 1
print(len(a) - cnt)
```
| 3
|
|
527
|
A
|
Playing with Paper
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=Γ<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=Γ<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
|
The first line of the input contains two integers *a*, *b* (1<=β€<=*b*<=<<=*a*<=β€<=1012) β the sizes of the original sheet of paper.
|
Print a single integer β the number of ships that Vasya will make.
|
[
"2 1\n",
"10 7\n",
"1000000000000 1\n"
] |
[
"2\n",
"6\n",
"1000000000000\n"
] |
Pictures to the first and second sample test.
| 500
|
[
{
"input": "2 1",
"output": "2"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "1000000000000 1",
"output": "1000000000000"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "1000 700",
"output": "6"
},
{
"input": "959986566087 524054155168",
"output": "90"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "7 6",
"output": "7"
},
{
"input": "1000 999",
"output": "1000"
},
{
"input": "1000 998",
"output": "500"
},
{
"input": "1000 997",
"output": "336"
},
{
"input": "42 1",
"output": "42"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "13 8",
"output": "6"
},
{
"input": "987 610",
"output": "15"
},
{
"input": "442 42",
"output": "22"
},
{
"input": "754 466",
"output": "13"
},
{
"input": "1000000000000 999999999999",
"output": "1000000000000"
},
{
"input": "1000000000000 999999999998",
"output": "500000000000"
},
{
"input": "941 14",
"output": "74"
},
{
"input": "998 2",
"output": "499"
},
{
"input": "1000 42",
"output": "32"
},
{
"input": "1000 17",
"output": "66"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "5 3",
"output": "4"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "293 210",
"output": "17"
},
{
"input": "787878787878 424242424242",
"output": "8"
},
{
"input": "956722026041 591286729879",
"output": "58"
},
{
"input": "956722026041 365435296162",
"output": "58"
},
{
"input": "628625247282 464807889701",
"output": "102"
},
{
"input": "695928431619 424778620208",
"output": "167"
},
{
"input": "1000000000000 42",
"output": "23809523821"
},
{
"input": "987654345678 23",
"output": "42941493300"
},
{
"input": "10000000001 2",
"output": "5000000002"
},
{
"input": "1000000000000 2",
"output": "500000000000"
},
{
"input": "1000000000000 3",
"output": "333333333336"
},
{
"input": "100000000000 3",
"output": "33333333336"
},
{
"input": "100000000000 23",
"output": "4347826109"
},
{
"input": "999999999997 7",
"output": "142857142861"
},
{
"input": "8589934592 4294967296",
"output": "2"
}
] | 1,592,812,484
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 46
| 140
| 0
|
a,b = list(map(int,input().split()))
ans = 0
while True:
if b>a:
a,b = b,a
if a%b==0:
ans+=a//b
break
else:
ans+=a//b
a = a%b
print(ans)
|
Title: Playing with Paper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=Γ<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=Γ<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
Input Specification:
The first line of the input contains two integers *a*, *b* (1<=β€<=*b*<=<<=*a*<=β€<=1012) β the sizes of the original sheet of paper.
Output Specification:
Print a single integer β the number of ships that Vasya will make.
Demo Input:
['2 1\n', '10 7\n', '1000000000000 1\n']
Demo Output:
['2\n', '6\n', '1000000000000\n']
Note:
Pictures to the first and second sample test.
|
```python
a,b = list(map(int,input().split()))
ans = 0
while True:
if b>a:
a,b = b,a
if a%b==0:
ans+=a//b
break
else:
ans+=a//b
a = a%b
print(ans)
```
| 3
|
|
125
|
A
|
Measuring Lengths in Baden
|
PROGRAMMING
| 1,400
|
[
"math"
] | null | null |
Lengths are measures in Baden in inches and feet. To a length from centimeters it is enough to know that an inch equals three centimeters in Baden and one foot contains 12 inches.
You are given a length equal to *n* centimeters. Your task is to convert it to feet and inches so that the number of feet was maximum. The result should be an integer rounded to the closest value containing an integral number of inches.
Note that when you round up, 1 cm rounds up to 0 inches and 2 cm round up to 1 inch.
|
The only line contains an integer *n* (1<=β€<=*n*<=β€<=10000).
|
Print two non-negative space-separated integers *a* and *b*, where *a* is the numbers of feet and *b* is the number of inches.
|
[
"42\n",
"5\n"
] |
[
"1 2\n",
"0 2\n"
] |
none
| 1,000
|
[
{
"input": "42",
"output": "1 2"
},
{
"input": "5",
"output": "0 2"
},
{
"input": "24",
"output": "0 8"
},
{
"input": "1",
"output": "0 0"
},
{
"input": "2",
"output": "0 1"
},
{
"input": "3",
"output": "0 1"
},
{
"input": "4",
"output": "0 1"
},
{
"input": "8",
"output": "0 3"
},
{
"input": "10",
"output": "0 3"
},
{
"input": "12",
"output": "0 4"
},
{
"input": "13",
"output": "0 4"
},
{
"input": "100",
"output": "2 9"
},
{
"input": "120",
"output": "3 4"
},
{
"input": "199",
"output": "5 6"
},
{
"input": "501",
"output": "13 11"
},
{
"input": "1000",
"output": "27 9"
},
{
"input": "1233",
"output": "34 3"
},
{
"input": "9876",
"output": "274 4"
},
{
"input": "9999",
"output": "277 9"
},
{
"input": "10000",
"output": "277 9"
},
{
"input": "35",
"output": "1 0"
},
{
"input": "71",
"output": "2 0"
}
] | 1,597,230,293
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 22
| 216
| 6,656,000
|
x = int(input())
x = (x+1)//3
print(x//12, x%12)
|
Title: Measuring Lengths in Baden
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Lengths are measures in Baden in inches and feet. To a length from centimeters it is enough to know that an inch equals three centimeters in Baden and one foot contains 12 inches.
You are given a length equal to *n* centimeters. Your task is to convert it to feet and inches so that the number of feet was maximum. The result should be an integer rounded to the closest value containing an integral number of inches.
Note that when you round up, 1 cm rounds up to 0 inches and 2 cm round up to 1 inch.
Input Specification:
The only line contains an integer *n* (1<=β€<=*n*<=β€<=10000).
Output Specification:
Print two non-negative space-separated integers *a* and *b*, where *a* is the numbers of feet and *b* is the number of inches.
Demo Input:
['42\n', '5\n']
Demo Output:
['1 2\n', '0 2\n']
Note:
none
|
```python
x = int(input())
x = (x+1)//3
print(x//12, x%12)
```
| 3
|
|
1,005
|
B
|
Delete from the Left
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty.
For example:
- by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "".
You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings.
Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
|
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
|
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
|
[
"test\nwest\n",
"codeforces\nyes\n",
"test\nyes\n",
"b\nab\n"
] |
[
"2\n",
"9\n",
"7\n",
"1\n"
] |
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est".
In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es".
In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty.
In the fourth example, the first character of the second string should be deleted.
| 0
|
[
{
"input": "test\nwest",
"output": "2"
},
{
"input": "codeforces\nyes",
"output": "9"
},
{
"input": "test\nyes",
"output": "7"
},
{
"input": "b\nab",
"output": "1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "abacabadabacaba\nabacabadacaba",
"output": "18"
},
{
"input": "z\na",
"output": "2"
},
{
"input": "ama\nsama",
"output": "1"
},
{
"input": "aaabc\nbc",
"output": "3"
},
{
"input": "lxuyspmieeuyxluv\ndfwxqvavzxctblaa",
"output": "32"
},
{
"input": "ahmedaly\naly",
"output": "5"
},
{
"input": "aa\na",
"output": "1"
},
{
"input": "aa\nba",
"output": "2"
},
{
"input": "cccba\nba",
"output": "3"
},
{
"input": "a\nab",
"output": "3"
},
{
"input": "dadc\ndddc",
"output": "4"
},
{
"input": "aacaaab\nb",
"output": "6"
},
{
"input": "dddc\ncdcde",
"output": "9"
},
{
"input": "bbdab\ndab",
"output": "2"
},
{
"input": "a\naa",
"output": "1"
},
{
"input": "aa\nab",
"output": "4"
},
{
"input": "codeforces\nces",
"output": "7"
}
] | 1,636,077,207
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 124
| 5,734,400
|
string1 = input()
string2 = input()
same = 0
minn = min(len(string1),len(string2))
for i in range(minn):
if string1[-1-i]==string2[-1-i]:
same += 2
else:
break
print((len(string1)+len(string2))-same)
|
Title: Delete from the Left
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty.
For example:
- by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "".
You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings.
Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
Input Specification:
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
Output Specification:
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
Demo Input:
['test\nwest\n', 'codeforces\nyes\n', 'test\nyes\n', 'b\nab\n']
Demo Output:
['2\n', '9\n', '7\n', '1\n']
Note:
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est".
In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es".
In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty.
In the fourth example, the first character of the second string should be deleted.
|
```python
string1 = input()
string2 = input()
same = 0
minn = min(len(string1),len(string2))
for i in range(minn):
if string1[-1-i]==string2[-1-i]:
same += 2
else:
break
print((len(string1)+len(string2))-same)
```
| 3
|
|
546
|
A
|
Soldier and Bananas
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"math"
] | null | null |
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*Β·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
|
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=β€<=<=*k*,<=*w*<=<=β€<=<=1000, 0<=β€<=*n*<=β€<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
|
Output one integer β the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
|
[
"3 17 4\n"
] |
[
"13"
] |
none
| 500
|
[
{
"input": "3 17 4",
"output": "13"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 5 6",
"output": "16"
},
{
"input": "1 1000000000 1",
"output": "0"
},
{
"input": "1000 0 1000",
"output": "500500000"
},
{
"input": "859 453892 543",
"output": "126416972"
},
{
"input": "1000 1000000000 1000",
"output": "0"
},
{
"input": "1000 500500000 1000",
"output": "0"
},
{
"input": "1000 500500001 1000",
"output": "0"
},
{
"input": "1000 500499999 1000",
"output": "1"
},
{
"input": "634 87973 214",
"output": "14497197"
},
{
"input": "432 10000 241",
"output": "12587552"
},
{
"input": "111 111111111 111",
"output": "0"
},
{
"input": "20 43 3",
"output": "77"
}
] | 1,694,183,550
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 15
| 46
| 0
|
while True:
try:
a, b, c = map(int, input().split())
t = sum(i * a for i in range(1, c + 1))
res = max(0, t - b)
print(res)
except EOFError:
break
|
Title: Soldier and Bananas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*Β·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
Input Specification:
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=β€<=<=*k*,<=*w*<=<=β€<=<=1000, 0<=β€<=*n*<=β€<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output Specification:
Output one integer β the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
Demo Input:
['3 17 4\n']
Demo Output:
['13']
Note:
none
|
```python
while True:
try:
a, b, c = map(int, input().split())
t = sum(i * a for i in range(1, c + 1))
res = max(0, t - b)
print(res)
except EOFError:
break
```
| 3
|
|
554
|
B
|
Ohana Cleans Up
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"strings"
] | null | null |
Ohana Matsumae is trying to clean a room, which is divided up into an *n* by *n* grid of squares. Each square is initially either clean or dirty. Ohana can sweep her broom over columns of the grid. Her broom is very strange: if she sweeps over a clean square, it will become dirty, and if she sweeps over a dirty square, it will become clean. She wants to sweep some columns of the room to maximize the number of rows that are completely clean. It is not allowed to sweep over the part of the column, Ohana can only sweep the whole column.
Return the maximum number of rows that she can make completely clean.
|
The first line of input will be a single integer *n* (1<=β€<=*n*<=β€<=100).
The next *n* lines will describe the state of the room. The *i*-th line will contain a binary string with *n* characters denoting the state of the *i*-th row of the room. The *j*-th character on this line is '1' if the *j*-th square in the *i*-th row is clean, and '0' if it is dirty.
|
The output should be a single line containing an integer equal to a maximum possible number of rows that are completely clean.
|
[
"4\n0101\n1000\n1111\n0101\n",
"3\n111\n111\n111\n"
] |
[
"2\n",
"3\n"
] |
In the first sample, Ohana can sweep the 1st and 3rd columns. This will make the 1st and 4th row be completely clean.
In the second sample, everything is already clean, so Ohana doesn't need to do anything.
| 500
|
[
{
"input": "4\n0101\n1000\n1111\n0101",
"output": "2"
},
{
"input": "3\n111\n111\n111",
"output": "3"
},
{
"input": "10\n0100000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000",
"output": "9"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n0111010011\n0111010011\n1010010001\n0111010011\n0000110000\n0111010011\n0111010011\n0000110000\n1010010001\n0111010011",
"output": "6"
},
{
"input": "20\n10101011101000011010\n11111010001100110101\n01011100010000001111\n10110100000101010011\n11010001110111101101\n00100110011011101010\n01000110101011001100\n01101100111101101101\n10111010010100111100\n00010010110001101110\n10111110010000101010\n10010111110100100100\n11010111001111110100\n11110111101100000001\n00011010100111011000\n11110001011000011010\n10001101010000011011\n01010101110010000111\n11100110111101101111\n11011111110010001111",
"output": "1"
},
{
"input": "10\n1001000000\n0111101111\n1111001011\n1000010100\n0111101111\n0101100110\n1001000000\n1000010100\n0111101111\n1001000000",
"output": "3"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000",
"output": "10"
},
{
"input": "10\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111",
"output": "10"
},
{
"input": "10\n1000000000\n0100000000\n0010000000\n0001000000\n0000100000\n0000010000\n0000001000\n0000000100\n0000000010\n0000000001",
"output": "1"
},
{
"input": "2\n10\n01",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "4\n0000\n0000\n1111\n1111",
"output": "2"
},
{
"input": "11\n10000000001\n10000000001\n10000000001\n10000000001\n10001000001\n10001000000\n10001000001\n10001000001\n10001000000\n10001000000\n10001000100",
"output": "4"
}
] | 1,606,082,537
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 124
| 409,600
|
from collections import defaultdict
n = int(input())
ans = 0
rows = defaultdict()
for _ in range(n):
row = str(input())
if row in rows:
rows[row] += 1
else:
rows[row] = 1
curr = rows[row]
if curr > ans:
ans = curr
print(ans)
|
Title: Ohana Cleans Up
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ohana Matsumae is trying to clean a room, which is divided up into an *n* by *n* grid of squares. Each square is initially either clean or dirty. Ohana can sweep her broom over columns of the grid. Her broom is very strange: if she sweeps over a clean square, it will become dirty, and if she sweeps over a dirty square, it will become clean. She wants to sweep some columns of the room to maximize the number of rows that are completely clean. It is not allowed to sweep over the part of the column, Ohana can only sweep the whole column.
Return the maximum number of rows that she can make completely clean.
Input Specification:
The first line of input will be a single integer *n* (1<=β€<=*n*<=β€<=100).
The next *n* lines will describe the state of the room. The *i*-th line will contain a binary string with *n* characters denoting the state of the *i*-th row of the room. The *j*-th character on this line is '1' if the *j*-th square in the *i*-th row is clean, and '0' if it is dirty.
Output Specification:
The output should be a single line containing an integer equal to a maximum possible number of rows that are completely clean.
Demo Input:
['4\n0101\n1000\n1111\n0101\n', '3\n111\n111\n111\n']
Demo Output:
['2\n', '3\n']
Note:
In the first sample, Ohana can sweep the 1st and 3rd columns. This will make the 1st and 4th row be completely clean.
In the second sample, everything is already clean, so Ohana doesn't need to do anything.
|
```python
from collections import defaultdict
n = int(input())
ans = 0
rows = defaultdict()
for _ in range(n):
row = str(input())
if row in rows:
rows[row] += 1
else:
rows[row] = 1
curr = rows[row]
if curr > ans:
ans = curr
print(ans)
```
| 3
|
|
298
|
A
|
Snow Footprints
|
PROGRAMMING
| 1,300
|
[
"greedy",
"implementation"
] | null | null |
There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one.
At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road.
You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints.
|
The first line of the input contains integer *n* (3<=β€<=*n*<=β€<=1000).
The second line contains the description of the road β the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint).
It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists.
|
Print two space-separated integers β the values of *s* and *t*. If there are several possible solutions you can print any of them.
|
[
"9\n..RRLL...\n",
"11\n.RRRLLLLL..\n"
] |
[
"3 4\n",
"7 5\n"
] |
The first test sample is the one in the picture.
| 500
|
[
{
"input": "11\n.RRRLLLLL..",
"output": "7 5"
},
{
"input": "4\n.RL.",
"output": "3 2"
},
{
"input": "3\n.L.",
"output": "2 1"
},
{
"input": "3\n.R.",
"output": "2 3"
}
] | 1,548,536,535
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 23
| 186
| 0
|
n=int(input())
s=input()
r=0
for i in range(n):
if s[i]=='R':
r=1
if r==0:
for i in range(n):
if s[i]=='L':
a=i
break
for j in range(i,n):
if s[j]=='.':
b=j
break
print(b,a)
else:
for i in range(n):
if s[i]!='.':
print(i+1,end=" ")
k=s[i]
break
if k=='L':
k='R'
else:
k='L'
q=0
for j in range(i,n):
if s[j]==k:
print(j)
q=1
break
elif s[j]=='.':
print(j+1)
q=1
break
if q==0:
print(n)
|
Title: Snow Footprints
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one.
At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road.
You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints.
Input Specification:
The first line of the input contains integer *n* (3<=β€<=*n*<=β€<=1000).
The second line contains the description of the road β the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint).
It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists.
Output Specification:
Print two space-separated integers β the values of *s* and *t*. If there are several possible solutions you can print any of them.
Demo Input:
['9\n..RRLL...\n', '11\n.RRRLLLLL..\n']
Demo Output:
['3 4\n', '7 5\n']
Note:
The first test sample is the one in the picture.
|
```python
n=int(input())
s=input()
r=0
for i in range(n):
if s[i]=='R':
r=1
if r==0:
for i in range(n):
if s[i]=='L':
a=i
break
for j in range(i,n):
if s[j]=='.':
b=j
break
print(b,a)
else:
for i in range(n):
if s[i]!='.':
print(i+1,end=" ")
k=s[i]
break
if k=='L':
k='R'
else:
k='L'
q=0
for j in range(i,n):
if s[j]==k:
print(j)
q=1
break
elif s[j]=='.':
print(j+1)
q=1
break
if q==0:
print(n)
```
| 3
|
|
281
|
A
|
Word Capitalization
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500
|
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,698,515,903
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 25
| 124
| 0
|
def solve(word):
return word[0].upper() + word[1:]
def main():
word = input().strip() # string values
print(solve(word))
if __name__ == "__main__":
main()
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
def solve(word):
return word[0].upper() + word[1:]
def main():
word = input().strip() # string values
print(solve(word))
if __name__ == "__main__":
main()
```
| 3
|
|
546
|
A
|
Soldier and Bananas
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"math"
] | null | null |
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*Β·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
|
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=β€<=<=*k*,<=*w*<=<=β€<=<=1000, 0<=β€<=*n*<=β€<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
|
Output one integer β the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
|
[
"3 17 4\n"
] |
[
"13"
] |
none
| 500
|
[
{
"input": "3 17 4",
"output": "13"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 5 6",
"output": "16"
},
{
"input": "1 1000000000 1",
"output": "0"
},
{
"input": "1000 0 1000",
"output": "500500000"
},
{
"input": "859 453892 543",
"output": "126416972"
},
{
"input": "1000 1000000000 1000",
"output": "0"
},
{
"input": "1000 500500000 1000",
"output": "0"
},
{
"input": "1000 500500001 1000",
"output": "0"
},
{
"input": "1000 500499999 1000",
"output": "1"
},
{
"input": "634 87973 214",
"output": "14497197"
},
{
"input": "432 10000 241",
"output": "12587552"
},
{
"input": "111 111111111 111",
"output": "0"
},
{
"input": "20 43 3",
"output": "77"
}
] | 1,695,701,447
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 15
| 62
| 0
|
number = input()
list = number.split()
cost = int(list[0])
money = int(list[1])
want = int(list[2])
for i in range(want):
current_cost = cost*(i + 1)
money -= current_cost
if money < 0:
money *= -1
print(money)
else:
print(0)
|
Title: Soldier and Bananas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*Β·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
Input Specification:
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=β€<=<=*k*,<=*w*<=<=β€<=<=1000, 0<=β€<=*n*<=β€<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output Specification:
Output one integer β the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
Demo Input:
['3 17 4\n']
Demo Output:
['13']
Note:
none
|
```python
number = input()
list = number.split()
cost = int(list[0])
money = int(list[1])
want = int(list[2])
for i in range(want):
current_cost = cost*(i + 1)
money -= current_cost
if money < 0:
money *= -1
print(money)
else:
print(0)
```
| 3
|
|
855
|
A
|
Tom Riddle's Diary
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
|
First line of input contains an integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
|
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
|
[
"6\ntom\nlucius\nginny\nharry\nginny\nharry\n",
"3\na\na\na\n"
] |
[
"NO\nNO\nNO\nNO\nYES\nYES\n",
"NO\nYES\nYES\n"
] |
In test case 1, for *i*β=β5 there exists *j*β=β3 such that *s*<sub class="lower-index">*i*</sub>β=β*s*<sub class="lower-index">*j*</sub> and *j*β<β*i*, which means that answer for *i*β=β5 is "YES".
| 500
|
[
{
"input": "6\ntom\nlucius\nginny\nharry\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nYES\nYES"
},
{
"input": "3\na\na\na",
"output": "NO\nYES\nYES"
},
{
"input": "1\nzn",
"output": "NO"
},
{
"input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth",
"output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "1\nz",
"output": "NO"
},
{
"input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO"
},
{
"input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr",
"output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES"
},
{
"input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES"
},
{
"input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO\nNO\nNO"
},
{
"input": "2\nab\nba",
"output": "NO\nNO"
},
{
"input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde",
"output": "NO\nYES"
},
{
"input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,584,385,794
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 124
| 0
|
n=int(input())
a=[]
for i in range(n):
c=0
a.append(input())
for j in range(0,i):
if j!=i:
if a[i]==a[j]:
c+=1
if c>0:
print("YES")
else:
print("NO")
|
Title: Tom Riddle's Diary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
Input Specification:
First line of input contains an integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output Specification:
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
Demo Input:
['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n']
Demo Output:
['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n']
Note:
In test case 1, for *i*β=β5 there exists *j*β=β3 such that *s*<sub class="lower-index">*i*</sub>β=β*s*<sub class="lower-index">*j*</sub> and *j*β<β*i*, which means that answer for *i*β=β5 is "YES".
|
```python
n=int(input())
a=[]
for i in range(n):
c=0
a.append(input())
for j in range(0,i):
if j!=i:
if a[i]==a[j]:
c+=1
if c>0:
print("YES")
else:
print("NO")
```
| 3
|
|
902
|
B
|
Coloring a Tree
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"dsu",
"greedy"
] | null | null |
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
|
The first line contains a single integer *n* (2<=β€<=*n*<=β€<=104)Β β the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=β€<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=β€<=*c**i*<=β€<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
|
Print a single integerΒ β the minimum number of steps you have to perform to color the tree into given colors.
|
[
"6\n1 2 2 1 5\n2 1 1 1 1 1\n",
"7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n"
] |
[
"3\n",
"5\n"
] |
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6\n1 2 2 1 5\n2 1 1 1 1 1",
"output": "3"
},
{
"input": "7\n1 1 2 3 1 4\n3 3 1 1 1 2 3",
"output": "5"
},
{
"input": "2\n1\n2 2",
"output": "1"
},
{
"input": "3\n1 1\n2 2 2",
"output": "1"
},
{
"input": "4\n1 2 1\n1 2 3 4",
"output": "4"
},
{
"input": "4\n1 2 3\n4 1 2 4",
"output": "4"
},
{
"input": "5\n1 2 1 4\n1 1 1 2 2",
"output": "2"
},
{
"input": "3\n1 2\n2 1 1",
"output": "2"
},
{
"input": "4\n1 1 1\n3 1 3 1",
"output": "3"
},
{
"input": "4\n1 1 2\n4 1 4 1",
"output": "2"
},
{
"input": "4\n1 2 2\n3 1 2 3",
"output": "4"
},
{
"input": "3\n1 1\n1 2 2",
"output": "3"
}
] | 1,513,700,454
| 2,754
|
Python 3
|
OK
|
TESTS
| 50
| 92
| 6,963,200
|
N = int(input())
con = [0]
vert = [i for i in range(1,N+1)]
a = input().split(" ")
for i in range(N-1):
con.append(int(a[i])-1)
color=[]
a = input().split(" ")
for i in range(N):
color.append(int(a[i]))
cur = [color[0] for i in range(N)]
steps=1
for i in range(1,N):
if cur[con[i]]==color[i]:
cur[i] = color[i]
else:
steps+=1
cur[i] = color[i]
print(steps)
#print(con)
#print(color)
#print(vert)
|
Title: Coloring a Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
Input Specification:
The first line contains a single integer *n* (2<=β€<=*n*<=β€<=104)Β β the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=β€<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=β€<=*c**i*<=β€<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
Output Specification:
Print a single integerΒ β the minimum number of steps you have to perform to color the tree into given colors.
Demo Input:
['6\n1 2 2 1 5\n2 1 1 1 1 1\n', '7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n']
Demo Output:
['3\n', '5\n']
Note:
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
N = int(input())
con = [0]
vert = [i for i in range(1,N+1)]
a = input().split(" ")
for i in range(N-1):
con.append(int(a[i])-1)
color=[]
a = input().split(" ")
for i in range(N):
color.append(int(a[i]))
cur = [color[0] for i in range(N)]
steps=1
for i in range(1,N):
if cur[con[i]]==color[i]:
cur[i] = color[i]
else:
steps+=1
cur[i] = color[i]
print(steps)
#print(con)
#print(color)
#print(vert)
```
| 3
|
|
144
|
A
|
Arrival of the General
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
|
The first input line contains the only integer *n* (2<=β€<=*n*<=β€<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
|
Print the only integer β the minimum number of seconds the colonel will need to form a line-up the general will like.
|
[
"4\n33 44 11 22\n",
"7\n10 10 58 31 63 40 76\n"
] |
[
"2\n",
"10\n"
] |
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
| 500
|
[
{
"input": "4\n33 44 11 22",
"output": "2"
},
{
"input": "7\n10 10 58 31 63 40 76",
"output": "10"
},
{
"input": "2\n88 89",
"output": "1"
},
{
"input": "5\n100 95 100 100 88",
"output": "0"
},
{
"input": "7\n48 48 48 48 45 45 45",
"output": "0"
},
{
"input": "10\n68 47 67 29 63 71 71 65 54 56",
"output": "10"
},
{
"input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92",
"output": "4"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14",
"output": "0"
},
{
"input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42",
"output": "7"
},
{
"input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99",
"output": "47"
},
{
"input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57",
"output": "50"
},
{
"input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13",
"output": "3"
},
{
"input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36",
"output": "3"
},
{
"input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73",
"output": "73"
},
{
"input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68",
"output": "7"
},
{
"input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94",
"output": "15"
},
{
"input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64",
"output": "104"
},
{
"input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97",
"output": "33"
},
{
"input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43",
"output": "145"
},
{
"input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26",
"output": "76"
},
{
"input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34",
"output": "15"
},
{
"input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81",
"output": "11"
},
{
"input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95",
"output": "13"
},
{
"input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15",
"output": "104"
},
{
"input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67",
"output": "100"
},
{
"input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32",
"output": "107"
},
{
"input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22",
"output": "50"
},
{
"input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61",
"output": "59"
},
{
"input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95",
"output": "99"
},
{
"input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "2\n100 99",
"output": "0"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "197"
},
{
"input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87",
"output": "0"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 3 2",
"output": "2"
}
] | 1,689,222,558
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 92
| 0
|
n = int(input())
lst = list(map(int,input().split()))
a=0
b=100
max_ind=0
min_ind=0
for i in range(n):
if lst[i]>a:
a=lst[i]
max_ind = i
if lst[i]<=b:
b = lst[i]
min_ind = i
if max_ind<min_ind:
print(max_ind+(n-min_ind)-1)
else:
print(max_ind+((n-min_ind)-2))
|
Title: Arrival of the General
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
Input Specification:
The first input line contains the only integer *n* (2<=β€<=*n*<=β€<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Output Specification:
Print the only integer β the minimum number of seconds the colonel will need to form a line-up the general will like.
Demo Input:
['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n']
Demo Output:
['2\n', '10\n']
Note:
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
|
```python
n = int(input())
lst = list(map(int,input().split()))
a=0
b=100
max_ind=0
min_ind=0
for i in range(n):
if lst[i]>a:
a=lst[i]
max_ind = i
if lst[i]<=b:
b = lst[i]
min_ind = i
if max_ind<min_ind:
print(max_ind+(n-min_ind)-1)
else:
print(max_ind+((n-min_ind)-2))
```
| 3
|
|
408
|
A
|
Line to Cashier
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=β€<=*k**i*<=β€<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=β€<=*m**i*,<=*j*<=β€<=100)Β β the number of products the *j*-th person in the queue for the *i*-th cash has.
|
Print a single integer β the minimum number of seconds Vasya needs to get to the cashier.
|
[
"1\n1\n1\n",
"4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n"
] |
[
"20\n",
"100\n"
] |
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100Β·5β+β15β=β515 seconds. But if he chooses the second queue, he will need 1Β·5β+β2Β·5β+β2Β·5β+β3Β·5β+β4Β·15β=β100 seconds. He will need 1Β·5β+β9Β·5β+β1Β·5β+β3Β·15β=β100 seconds for the third one and 7Β·5β+β8Β·5β+β2Β·15β=β105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
| 500
|
[
{
"input": "1\n1\n1",
"output": "20"
},
{
"input": "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8",
"output": "100"
},
{
"input": "4\n5 4 5 5\n3 1 3 1 2\n3 1 1 3\n1 1 1 2 2\n2 2 1 1 3",
"output": "100"
},
{
"input": "5\n5 3 6 6 4\n7 5 3 3 9\n6 8 2\n1 10 8 5 9 2\n9 7 8 5 9 10\n9 8 3 3",
"output": "125"
},
{
"input": "5\n10 10 10 10 10\n6 7 8 6 8 5 9 8 10 5\n9 6 9 8 7 8 8 10 8 5\n8 7 7 8 7 5 6 8 9 5\n6 5 10 5 5 10 7 8 5 5\n10 9 8 7 6 9 7 9 6 5",
"output": "480"
},
{
"input": "10\n9 10 10 10 9 5 9 7 8 7\n11 6 10 4 4 15 7 15 5\n3 9 11 12 11 1 13 13 1 5\n6 15 9 12 3 2 8 12 11 10\n7 1 1 6 10 2 6 1 14 2\n8 14 2 3 6 1 14 1 12\n6 10 9 3 5\n13 12 12 7 13 4 4 8 10\n5 6 4 3 14 9 13\n8 12 1 5 7 4 13 1\n1 9 5 3 5 1 4",
"output": "240"
},
{
"input": "10\n5 5 5 5 5 5 5 5 5 5\n5 5 4 5 4\n6 5 7 7 6\n5 4 4 5 5\n4 4 5 5 5\n7 6 4 5 7\n4 6 5 4 5\n6 6 7 6 6\n4 5 4 4 7\n7 5 4 4 5\n6 6 7 4 4",
"output": "190"
},
{
"input": "1\n1\n100",
"output": "515"
},
{
"input": "1\n90\n90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90",
"output": "41850"
}
] | 1,668,685,804
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
def solve():
n = int(input())
ak = [int(i) for i in input().split()]
ans = float("inf")
for i in range(n):
a = [int(k) for k in input().split()]
s = 0
for j in range(len(a)):
s+=a[j]*5
s+=15*ak[i]
ans = min(ans,s)
print(ans)
return
# t = int(input())
# for _ in range(t):
# solve()
solve()
|
Title: Line to Cashier
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=β€<=*k**i*<=β€<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=β€<=*m**i*,<=*j*<=β€<=100)Β β the number of products the *j*-th person in the queue for the *i*-th cash has.
Output Specification:
Print a single integer β the minimum number of seconds Vasya needs to get to the cashier.
Demo Input:
['1\n1\n1\n', '4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n']
Demo Output:
['20\n', '100\n']
Note:
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100Β·5β+β15β=β515 seconds. But if he chooses the second queue, he will need 1Β·5β+β2Β·5β+β2Β·5β+β3Β·5β+β4Β·15β=β100 seconds. He will need 1Β·5β+β9Β·5β+β1Β·5β+β3Β·15β=β100 seconds for the third one and 7Β·5β+β8Β·5β+β2Β·15β=β105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
|
```python
def solve():
n = int(input())
ak = [int(i) for i in input().split()]
ans = float("inf")
for i in range(n):
a = [int(k) for k in input().split()]
s = 0
for j in range(len(a)):
s+=a[j]*5
s+=15*ak[i]
ans = min(ans,s)
print(ans)
return
# t = int(input())
# for _ in range(t):
# solve()
solve()
```
| 3
|
|
741
|
B
|
Arpa's weak amphitheater and Mehrdad's valuable Hoses
|
PROGRAMMING
| 1,600
|
[
"dfs and similar",
"dp",
"dsu"
] | null | null |
Just to remind, girls in Arpa's land are really nice.
Mehrdad wants to invite some Hoses to the palace for a dancing party. Each Hos has some weight *w**i* and some beauty *b**i*. Also each Hos may have some friends. Hoses are divided in some friendship groups. Two Hoses *x* and *y* are in the same friendship group if and only if there is a sequence of Hoses *a*1,<=*a*2,<=...,<=*a**k* such that *a**i* and *a**i*<=+<=1 are friends for each 1<=β€<=*i*<=<<=*k*, and *a*1<==<=*x* and *a**k*<==<=*y*.
Arpa allowed to use the amphitheater of palace to Mehrdad for this party. Arpa's amphitheater can hold at most *w* weight on it.
Mehrdad is so greedy that he wants to invite some Hoses such that sum of their weights is not greater than *w* and sum of their beauties is as large as possible. Along with that, from each friendship group he can either invite all Hoses, or no more than one. Otherwise, some Hoses will be hurt. Find for Mehrdad the maximum possible total beauty of Hoses he can invite so that no one gets hurt and the total weight doesn't exceed *w*.
|
The first line contains integers *n*, *m* and *w* (1<=<=β€<=<=*n*<=<=β€<=<=1000, , 1<=β€<=*w*<=β€<=1000)Β β the number of Hoses, the number of pair of friends and the maximum total weight of those who are invited.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=β€<=*w**i*<=β€<=1000)Β β the weights of the Hoses.
The third line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=β€<=*b**i*<=β€<=106)Β β the beauties of the Hoses.
The next *m* lines contain pairs of friends, the *i*-th of them contains two integers *x**i* and *y**i* (1<=β€<=*x**i*,<=*y**i*<=β€<=*n*, *x**i*<=β <=*y**i*), meaning that Hoses *x**i* and *y**i* are friends. Note that friendship is bidirectional. All pairs (*x**i*,<=*y**i*) are distinct.
|
Print the maximum possible total beauty of Hoses Mehrdad can invite so that no one gets hurt and the total weight doesn't exceed *w*.
|
[
"3 1 5\n3 2 5\n2 4 2\n1 2\n",
"4 2 11\n2 4 6 6\n6 4 2 1\n1 2\n2 3\n"
] |
[
"6\n",
"7\n"
] |
In the first sample there are two friendship groups: Hoses {1,β2} and Hos {3}. The best way is to choose all of Hoses in the first group, sum of their weights is equal to 5 and sum of their beauty is 6.
In the second sample there are two friendship groups: Hoses {1,β2,β3} and Hos {4}. Mehrdad can't invite all the Hoses from the first group because their total weight is 12β>β11, thus the best way is to choose the first Hos from the first group and the only one from the second group. The total weight will be 8, and the total beauty will be 7.
| 1,000
|
[
{
"input": "3 1 5\n3 2 5\n2 4 2\n1 2",
"output": "6"
},
{
"input": "4 2 11\n2 4 6 6\n6 4 2 1\n1 2\n2 3",
"output": "7"
},
{
"input": "10 5 100\n70 67 8 64 28 82 18 61 82 7\n596434 595982 237932 275698 361351 850374 936914 877996 789231 331012\n1 7\n2 4\n3 6\n5 7\n1 5",
"output": "2383854"
},
{
"input": "10 5 100\n64 90 3 94 96 97 52 54 82 31\n796554 444893 214351 43810 684158 555762 686198 339093 383018 699152\n6 8\n8 3\n3 9\n2 3\n10 3",
"output": "1495706"
},
{
"input": "10 5 100\n6 18 35 6 87 58 4 53 37 71\n465782 57034 547741 748298 315223 370368 679320 349012 9740 622511\n1 2\n10 9\n6 7\n3 6\n7 1",
"output": "2050129"
},
{
"input": "10 5 100\n78 89 3 2 95 96 87 11 13 60\n694709 921 799687 428614 221900 536251 117674 36488 219932 771513\n4 5\n3 4\n6 2\n2 3\n8 3",
"output": "1791132"
},
{
"input": "10 5 100\n48 73 30 46 95 19 98 73 94 24\n501216 675859 843572 565104 879875 828759 80776 766980 213551 492652\n1 2\n6 5\n7 6\n10 3\n8 1",
"output": "2237435"
},
{
"input": "10 5 100\n68 55 15 94 53 100 52 68 24 3\n286803 660813 226501 624597 215418 290774 416040 961916 910482 50278\n1 5\n7 2\n2 8\n5 3\n10 3",
"output": "1922676"
},
{
"input": "10 5 100\n19 8 95 18 9 79 42 94 20 49\n735491 935681 717266 935275 521356 866021 356037 394445 589369 585077\n9 4\n5 6\n5 1\n1 4\n7 1",
"output": "2456033"
}
] | 1,606,089,124
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 68
| 842
| 614,400
|
def g(x):
if x == t[x]: return x
t[x] = g(t[x])
return t[x]
f = lambda: map(int, input().split())
hoses, pairOfFriends, weight = f()
weightsAndBeauties = [(0, 0)] + list(zip(f(), f()))
t = list(range(hoses + 1))
for i in range(pairOfFriends):
f1, f2 = f()
f1, f2 = g(f1), g(f2)
if f1 != f2:
t[f2] = f1
p = [[] for j in range(hoses + 1)]
for i in range(1, hoses + 1):
p[g(i)].append(i)
beauties = [1] + [0] * weight
for q in p:
if len(q) > 1:
t = [weightsAndBeauties[i] for i in q]
t.append((sum(f1[0] for f1 in t), sum(f1[1] for f1 in t)))
t.sort(key=lambda f1: f1[0])
for j in range(weight, -1, -1):
if beauties[j]:
for w, b in t:
if j + w > weight:
break
else:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
elif len(q) == 1:
w, b = weightsAndBeauties[q[0]]
for j in range(weight - w, -1, -1):
if beauties[j]:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
maxBeauty = max(beauties) - 1
print(maxBeauty)
|
Title: Arpa's weak amphitheater and Mehrdad's valuable Hoses
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Just to remind, girls in Arpa's land are really nice.
Mehrdad wants to invite some Hoses to the palace for a dancing party. Each Hos has some weight *w**i* and some beauty *b**i*. Also each Hos may have some friends. Hoses are divided in some friendship groups. Two Hoses *x* and *y* are in the same friendship group if and only if there is a sequence of Hoses *a*1,<=*a*2,<=...,<=*a**k* such that *a**i* and *a**i*<=+<=1 are friends for each 1<=β€<=*i*<=<<=*k*, and *a*1<==<=*x* and *a**k*<==<=*y*.
Arpa allowed to use the amphitheater of palace to Mehrdad for this party. Arpa's amphitheater can hold at most *w* weight on it.
Mehrdad is so greedy that he wants to invite some Hoses such that sum of their weights is not greater than *w* and sum of their beauties is as large as possible. Along with that, from each friendship group he can either invite all Hoses, or no more than one. Otherwise, some Hoses will be hurt. Find for Mehrdad the maximum possible total beauty of Hoses he can invite so that no one gets hurt and the total weight doesn't exceed *w*.
Input Specification:
The first line contains integers *n*, *m* and *w* (1<=<=β€<=<=*n*<=<=β€<=<=1000, , 1<=β€<=*w*<=β€<=1000)Β β the number of Hoses, the number of pair of friends and the maximum total weight of those who are invited.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=β€<=*w**i*<=β€<=1000)Β β the weights of the Hoses.
The third line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=β€<=*b**i*<=β€<=106)Β β the beauties of the Hoses.
The next *m* lines contain pairs of friends, the *i*-th of them contains two integers *x**i* and *y**i* (1<=β€<=*x**i*,<=*y**i*<=β€<=*n*, *x**i*<=β <=*y**i*), meaning that Hoses *x**i* and *y**i* are friends. Note that friendship is bidirectional. All pairs (*x**i*,<=*y**i*) are distinct.
Output Specification:
Print the maximum possible total beauty of Hoses Mehrdad can invite so that no one gets hurt and the total weight doesn't exceed *w*.
Demo Input:
['3 1 5\n3 2 5\n2 4 2\n1 2\n', '4 2 11\n2 4 6 6\n6 4 2 1\n1 2\n2 3\n']
Demo Output:
['6\n', '7\n']
Note:
In the first sample there are two friendship groups: Hoses {1,β2} and Hos {3}. The best way is to choose all of Hoses in the first group, sum of their weights is equal to 5 and sum of their beauty is 6.
In the second sample there are two friendship groups: Hoses {1,β2,β3} and Hos {4}. Mehrdad can't invite all the Hoses from the first group because their total weight is 12β>β11, thus the best way is to choose the first Hos from the first group and the only one from the second group. The total weight will be 8, and the total beauty will be 7.
|
```python
def g(x):
if x == t[x]: return x
t[x] = g(t[x])
return t[x]
f = lambda: map(int, input().split())
hoses, pairOfFriends, weight = f()
weightsAndBeauties = [(0, 0)] + list(zip(f(), f()))
t = list(range(hoses + 1))
for i in range(pairOfFriends):
f1, f2 = f()
f1, f2 = g(f1), g(f2)
if f1 != f2:
t[f2] = f1
p = [[] for j in range(hoses + 1)]
for i in range(1, hoses + 1):
p[g(i)].append(i)
beauties = [1] + [0] * weight
for q in p:
if len(q) > 1:
t = [weightsAndBeauties[i] for i in q]
t.append((sum(f1[0] for f1 in t), sum(f1[1] for f1 in t)))
t.sort(key=lambda f1: f1[0])
for j in range(weight, -1, -1):
if beauties[j]:
for w, b in t:
if j + w > weight:
break
else:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
elif len(q) == 1:
w, b = weightsAndBeauties[q[0]]
for j in range(weight - w, -1, -1):
if beauties[j]:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
maxBeauty = max(beauties) - 1
print(maxBeauty)
```
| 3
|
|
710
|
A
|
King Moves
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
|
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
|
Print the only integer *x* β the number of moves permitted for the king.
|
[
"e4\n"
] |
[
"8\n"
] |
none
| 0
|
[
{
"input": "e4",
"output": "8"
},
{
"input": "a1",
"output": "3"
},
{
"input": "h8",
"output": "3"
},
{
"input": "a4",
"output": "5"
},
{
"input": "g7",
"output": "8"
},
{
"input": "e1",
"output": "5"
},
{
"input": "b2",
"output": "8"
},
{
"input": "c7",
"output": "8"
},
{
"input": "h6",
"output": "5"
},
{
"input": "c8",
"output": "5"
},
{
"input": "h2",
"output": "5"
},
{
"input": "h5",
"output": "5"
},
{
"input": "a8",
"output": "3"
},
{
"input": "f8",
"output": "5"
},
{
"input": "h1",
"output": "3"
},
{
"input": "f2",
"output": "8"
},
{
"input": "e8",
"output": "5"
},
{
"input": "h3",
"output": "5"
},
{
"input": "b8",
"output": "5"
},
{
"input": "g8",
"output": "5"
},
{
"input": "d8",
"output": "5"
},
{
"input": "h4",
"output": "5"
},
{
"input": "b1",
"output": "5"
},
{
"input": "a2",
"output": "5"
}
] | 1,630,347,311
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 24
| 109
| 20,172,800
|
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def solve():
a=read()
c=0
if a[0]=='a' or a[0]=='h':
c+=1
if a[1]=='1' or a[1]=='8':
c+=1
if c==0:
print(8)
elif c==1:
print(5)
else:
print(3)
solve()
|
Title: King Moves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
Input Specification:
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
Output Specification:
Print the only integer *x* β the number of moves permitted for the king.
Demo Input:
['e4\n']
Demo Output:
['8\n']
Note:
none
|
```python
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def solve():
a=read()
c=0
if a[0]=='a' or a[0]=='h':
c+=1
if a[1]=='1' or a[1]=='8':
c+=1
if c==0:
print(8)
elif c==1:
print(5)
else:
print(3)
solve()
```
| 3
|
|
807
|
A
|
Is it rated?
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings"
] | null | null |
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
|
The first line contains a single integer *n* (2<=β€<=*n*<=β€<=1000)Β β the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=β€<=*a**i*,<=*b**i*<=β€<=4126)Β β the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
|
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
|
[
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] |
[
"rated\n",
"unrated\n",
"maybe\n"
] |
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
| 500
|
[
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,593,217,124
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 150
| 187
| 21,606,400
|
t = int(input())
left = []
right = []
for i in range(t):
x , y = input().split()
x , y = int(x) , int(y)
left.append(x)
right.append(y)
if left != right :print('rated')
elif left == right and sorted(left , reverse=True) != left and sorted(right , reverse=True) != right:print('unrated')
else:print('maybe')
|
Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=β€<=*n*<=β€<=1000)Β β the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=β€<=*a**i*,<=*b**i*<=β€<=4126)Β β the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
|
```python
t = int(input())
left = []
right = []
for i in range(t):
x , y = input().split()
x , y = int(x) , int(y)
left.append(x)
right.append(y)
if left != right :print('rated')
elif left == right and sorted(left , reverse=True) != left and sorted(right , reverse=True) != right:print('unrated')
else:print('maybe')
```
| 3
|
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=β€<=*a*<=β€<=1000;Β 2<=β€<=*b*<=β€<=1000).
|
Print a single integer β the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,643,800,871
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
a,b=map(int,input().split())
c=int(a-1)/(b-1)
print(int(a+c))
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=β€<=*a*<=β€<=1000;Β 2<=β€<=*b*<=β€<=1000).
Output Specification:
Print a single integer β the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
a,b=map(int,input().split())
c=int(a-1)/(b-1)
print(int(a+c))
```
| 3
|
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* β the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,694,660,081
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
a=input()
b=[]
for i in range(0,len(a),2):
b.append(a[i])
b.sort()
b="+".join(b)
print(b)
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* β the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
a=input()
b=[]
for i in range(0,len(a),2):
b.append(a[i])
b.sort()
b="+".join(b)
print(b)
```
| 3
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=β€<=*n*<=β€<=1000) β the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer β the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,697,737,931
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
cases_num=int(input())
res=0
for ix in range(cases_num):
inputs=input()
cases=inputs.split(' ')
score=0
for num in cases:
score+=(int(num))
if score>=2:
res+=1
print(res)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=β€<=*n*<=β€<=1000) β the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer β the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
cases_num=int(input())
res=0
for ix in range(cases_num):
inputs=input()
cases=inputs.split(' ')
score=0
for num in cases:
score+=(int(num))
if score>=2:
res+=1
print(res)
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
|
Output one number β the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,647,362,354
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 248
| 6,041,600
|
from tkinter import N
m,n = list(map(int, input().split()))
t= m*n
c=0
if n%2==0:
c= n/2*m
elif m%2==0:
c= m/2*n
else:
c= ((m-1)/2*n)+ (n-1)/2
print(int(c))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
Output Specification:
Output one number β the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
from tkinter import N
m,n = list(map(int, input().split()))
t= m*n
c=0
if n%2==0:
c= n/2*m
elif m%2==0:
c= m/2*n
else:
c= ((m-1)/2*n)+ (n-1)/2
print(int(c))
```
| 3.926747
|
912
|
B
|
New Year's Eve
|
PROGRAMMING
| 1,300
|
[
"bitmasks",
"constructive algorithms",
"number theory"
] | null | null |
Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness.
The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest onesΒ β but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum!
A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)
Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain.
|
The sole string contains two integers *n* and *k* (1<=β€<=*k*<=β€<=*n*<=β€<=1018).
|
Output one numberΒ β the largest possible xor-sum.
|
[
"4 3\n",
"6 6\n"
] |
[
"7\n",
"7\n"
] |
In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7.
In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7.
| 1,000
|
[
{
"input": "4 3",
"output": "7"
},
{
"input": "6 6",
"output": "7"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "1022 10",
"output": "1023"
},
{
"input": "415853337373441 52",
"output": "562949953421311"
},
{
"input": "75 12",
"output": "127"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "1152921504606846975"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000000000000 2",
"output": "1152921504606846975"
},
{
"input": "49194939 22",
"output": "67108863"
},
{
"input": "228104606 17",
"output": "268435455"
},
{
"input": "817034381 7",
"output": "1073741823"
},
{
"input": "700976748 4",
"output": "1073741823"
},
{
"input": "879886415 9",
"output": "1073741823"
},
{
"input": "18007336 10353515",
"output": "33554431"
},
{
"input": "196917003 154783328",
"output": "268435455"
},
{
"input": "785846777 496205300",
"output": "1073741823"
},
{
"input": "964756444 503568330",
"output": "1073741823"
},
{
"input": "848698811 317703059",
"output": "1073741823"
},
{
"input": "676400020444788 1",
"output": "676400020444788"
},
{
"input": "502643198528213 1",
"output": "502643198528213"
},
{
"input": "815936580997298686 684083143940282566",
"output": "1152921504606846975"
},
{
"input": "816762824175382110 752185261508428780",
"output": "1152921504606846975"
},
{
"input": "327942415253132295 222598158321260499",
"output": "576460752303423487"
},
{
"input": "328768654136248423 284493129147496637",
"output": "576460752303423487"
},
{
"input": "329594893019364551 25055600080496801",
"output": "576460752303423487"
},
{
"input": "921874985256864012 297786684518764536",
"output": "1152921504606846975"
},
{
"input": "922701224139980141 573634416190460758",
"output": "1152921504606846975"
},
{
"input": "433880815217730325 45629641110945892",
"output": "576460752303423487"
},
{
"input": "434707058395813749 215729375494216481",
"output": "576460752303423487"
},
{
"input": "435533301573897173 34078453236225189",
"output": "576460752303423487"
},
{
"input": "436359544751980597 199220719961060641",
"output": "576460752303423487"
},
{
"input": "437185783635096725 370972992240105630",
"output": "576460752303423487"
},
{
"input": "438012026813180149 111323110116193830",
"output": "576460752303423487"
},
{
"input": "438838269991263573 295468957052046146",
"output": "576460752303423487"
},
{
"input": "439664513169346997 46560240538186155",
"output": "576460752303423487"
},
{
"input": "440490752052463125 216165966013438147",
"output": "576460752303423487"
},
{
"input": "441316995230546549 401964286420555423",
"output": "576460752303423487"
},
{
"input": "952496582013329437 673506882352402278",
"output": "1152921504606846975"
},
{
"input": "1000000000000000000 1",
"output": "1000000000000000000"
},
{
"input": "2147483647 1",
"output": "2147483647"
},
{
"input": "2147483647 2",
"output": "2147483647"
},
{
"input": "2147483647 31",
"output": "2147483647"
},
{
"input": "8 2",
"output": "15"
},
{
"input": "3 3",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "10 2",
"output": "15"
},
{
"input": "288230376151711743 2",
"output": "288230376151711743"
},
{
"input": "5 2",
"output": "7"
},
{
"input": "576460752303423487 2",
"output": "576460752303423487"
},
{
"input": "36028797018963967 123",
"output": "36028797018963967"
},
{
"input": "1125899906842623 2",
"output": "1125899906842623"
},
{
"input": "576460752303423489 5",
"output": "1152921504606846975"
},
{
"input": "288230376151711743 3",
"output": "288230376151711743"
},
{
"input": "36028797018963967 345",
"output": "36028797018963967"
},
{
"input": "18014398509481984 30",
"output": "36028797018963967"
},
{
"input": "8 8",
"output": "15"
},
{
"input": "8 1",
"output": "8"
}
] | 1,614,694,325
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 62
| 307,200
|
def precompute(arr) :
arr[0] = 1
for index in range(1,60) :
arr[index] = arr[index-1]*2
def solve(n,k,power) :
if k == 1 :
return n
else :
for index in range(59,-1,-1):
if power[index] <= n :
return power[index] + (power[index] - 1)
arr = [0] * 60
n,k = list(map(int,input().split()))
precompute(arr)
print (solve(n,k,arr))
|
Title: New Year's Eve
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness.
The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest onesΒ β but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum!
A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)
Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain.
Input Specification:
The sole string contains two integers *n* and *k* (1<=β€<=*k*<=β€<=*n*<=β€<=1018).
Output Specification:
Output one numberΒ β the largest possible xor-sum.
Demo Input:
['4 3\n', '6 6\n']
Demo Output:
['7\n', '7\n']
Note:
In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7.
In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7.
|
```python
def precompute(arr) :
arr[0] = 1
for index in range(1,60) :
arr[index] = arr[index-1]*2
def solve(n,k,power) :
if k == 1 :
return n
else :
for index in range(59,-1,-1):
if power[index] <= n :
return power[index] + (power[index] - 1)
arr = [0] * 60
n,k = list(map(int,input().split()))
precompute(arr)
print (solve(n,k,arr))
```
| 3
|
|
593
|
B
|
Anton and Lines
|
PROGRAMMING
| 1,600
|
[
"geometry",
"sortings"
] | null | null |
The teacher gave Anton a large geometry homework, but he didn't do it (as usual) as he participated in a regular round on Codeforces. In the task he was given a set of *n* lines defined by the equations *y*<==<=*k**i*Β·*x*<=+<=*b**i*. It was necessary to determine whether there is at least one point of intersection of two of these lines, that lays strictly inside the strip between *x*1<=<<=*x*2. In other words, is it true that there are 1<=β€<=*i*<=<<=*j*<=β€<=*n* and *x*',<=*y*', such that:
- *y*'<==<=*k**i*<=*<=*x*'<=+<=*b**i*, that is, point (*x*',<=*y*') belongs to the line number *i*; - *y*'<==<=*k**j*<=*<=*x*'<=+<=*b**j*, that is, point (*x*',<=*y*') belongs to the line number *j*; - *x*1<=<<=*x*'<=<<=*x*2, that is, point (*x*',<=*y*') lies inside the strip bounded by *x*1<=<<=*x*2.
You can't leave Anton in trouble, can you? Write a program that solves the given task.
|
The first line of the input contains an integer *n* (2<=β€<=*n*<=β€<=100<=000)Β β the number of lines in the task given to Anton. The second line contains integers *x*1 and *x*2 (<=-<=1<=000<=000<=β€<=*x*1<=<<=*x*2<=β€<=1<=000<=000) defining the strip inside which you need to find a point of intersection of at least two lines.
The following *n* lines contain integers *k**i*, *b**i* (<=-<=1<=000<=000<=β€<=*k**i*,<=*b**i*<=β€<=1<=000<=000)Β β the descriptions of the lines. It is guaranteed that all lines are pairwise distinct, that is, for any two *i*<=β <=*j* it is true that either *k**i*<=β <=*k**j*, or *b**i*<=β <=*b**j*.
|
Print "Yes" (without quotes), if there is at least one intersection of two distinct lines, located strictly inside the strip. Otherwise print "No" (without quotes).
|
[
"4\n1 2\n1 2\n1 0\n0 1\n0 2\n",
"2\n1 3\n1 0\n-1 3\n",
"2\n1 3\n1 0\n0 2\n",
"2\n1 3\n1 0\n0 3\n"
] |
[
"NO",
"YES",
"YES",
"NO"
] |
In the first sample there are intersections located on the border of the strip, but there are no intersections located strictly inside it.
| 1,000
|
[
{
"input": "4\n1 2\n1 2\n1 0\n0 1\n0 2",
"output": "NO"
},
{
"input": "2\n1 3\n1 0\n-1 3",
"output": "YES"
},
{
"input": "2\n1 3\n1 0\n0 2",
"output": "YES"
},
{
"input": "2\n1 3\n1 0\n0 3",
"output": "NO"
},
{
"input": "2\n0 1\n-1000000 1000000\n1000000 -1000000",
"output": "NO"
},
{
"input": "2\n-1337 1888\n-1000000 1000000\n1000000 -1000000",
"output": "YES"
},
{
"input": "2\n-1337 1888\n-1000000 1000000\n-999999 -1000000",
"output": "NO"
},
{
"input": "15\n30 32\n-45 1\n-22 -81\n4 42\n-83 -19\n97 70\n55 -91\n-45 -64\n0 64\n11 96\n-16 76\n-46 52\n0 91\n31 -90\n6 75\n65 14",
"output": "NO"
},
{
"input": "15\n-1 3\n2 -4\n0 -6\n-2 -5\n0 -1\n-1 -2\n3 6\n4 4\n0 -4\n1 5\n5 -4\n-5 -6\n3 -6\n5 -3\n-1 6\n-3 -1",
"output": "YES"
},
{
"input": "5\n-197 -126\n0 -94\n-130 -100\n-84 233\n-173 -189\n61 -200",
"output": "NO"
},
{
"input": "2\n9 10\n-7 -11\n9 2",
"output": "NO"
},
{
"input": "3\n4 11\n-2 14\n2 -15\n-8 -15",
"output": "YES"
},
{
"input": "2\n1 2\n2 -2\n0 2",
"output": "NO"
},
{
"input": "10\n1 3\n1 5\n1 2\n1 4\n1 6\n1 3\n1 7\n1 -5\n1 -1\n1 1\n1 8",
"output": "NO"
},
{
"input": "10\n22290 75956\n-66905 -22602\n-88719 12654\n-191 -81032\n0 -26057\n-39609 0\n0 51194\n2648 88230\n90584 15544\n0 23060\n-29107 26878",
"output": "NO"
},
{
"input": "2\n-1337 1888\n100000 -100000\n99999 -100000",
"output": "YES"
},
{
"input": "2\n-100000 100000\n100000 100000\n100000 99999",
"output": "NO"
},
{
"input": "2\n-100000 100000\n100000 -100000\n99999 100000",
"output": "NO"
},
{
"input": "2\n-100000 100000\n100000 100000\n100000 99876",
"output": "NO"
},
{
"input": "2\n9 10\n4 -10\n-9 4",
"output": "NO"
},
{
"input": "3\n4 7\n7 9\n0 10\n-7 2",
"output": "NO"
},
{
"input": "4\n-4 -3\n4 -3\n10 -9\n5 -2\n0 9",
"output": "NO"
},
{
"input": "5\n8 9\n0 -3\n0 -6\n-5 0\n-7 -2\n-4 9",
"output": "NO"
},
{
"input": "6\n-7 8\n6 -1\n-10 -9\n4 8\n0 -2\n-6 -1\n3 -10",
"output": "YES"
},
{
"input": "7\n5 7\n6 4\n-9 4\n-7 5\n1 -3\n5 -2\n7 -8\n6 -8",
"output": "YES"
},
{
"input": "8\n-10 -2\n5 10\n9 7\n-8 -2\n0 6\n-9 0\n-6 2\n6 -8\n-3 2",
"output": "YES"
},
{
"input": "9\n9 10\n8 -3\n9 8\n0 5\n10 1\n0 8\n5 -5\n-4 8\n0 10\n3 -10",
"output": "NO"
},
{
"input": "10\n-1 0\n-2 4\n2 4\n-3 -7\n-2 -9\n7 6\n0 2\n1 4\n0 10\n0 -8\n-5 1",
"output": "YES"
},
{
"input": "11\n3 8\n0 -9\n-8 -10\n3 4\n3 5\n2 1\n-5 4\n0 -10\n-7 6\n5 -4\n-9 -3\n5 1",
"output": "YES"
},
{
"input": "3\n0 2\n10 0\n0 0\n8 2",
"output": "YES"
},
{
"input": "2\n0 1000000\n0 0\n1000000 1000000",
"output": "NO"
},
{
"input": "2\n515806 517307\n530512 500306\n520201 504696",
"output": "NO"
},
{
"input": "2\n0 65536\n65536 0\n0 1",
"output": "YES"
},
{
"input": "3\n1 3\n-1 5\n1 1\n0 4",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1\n1 2",
"output": "YES"
},
{
"input": "2\n0 3\n1 1\n2 1",
"output": "NO"
},
{
"input": "2\n0 1\n1 0\n2 0",
"output": "NO"
},
{
"input": "3\n1 3\n1 0\n-1 3\n0 10",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1000000\n0 3",
"output": "NO"
},
{
"input": "2\n0 1\n1 0\n-2 2",
"output": "YES"
},
{
"input": "2\n5 1000000\n1000000 5\n5 5",
"output": "NO"
},
{
"input": "4\n0 1\n0 0\n0 1\n1 0\n-1 1",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1000000\n1 1",
"output": "NO"
},
{
"input": "3\n0 1000000\n1000000 999999\n-1000000 1000000\n1000000 1000000",
"output": "YES"
},
{
"input": "2\n-1000000 1000000\n2 3\n1 3",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1\n2 2",
"output": "YES"
},
{
"input": "2\n-1 1\n1 0\n-1 0",
"output": "YES"
},
{
"input": "2\n0 1000000\n2200 1\n0 0",
"output": "NO"
},
{
"input": "2\n1 999999\n999999 0\n1 0",
"output": "NO"
},
{
"input": "2\n0 1\n1 0\n-1 1",
"output": "YES"
},
{
"input": "2\n0 1000000\n999999 999999\n0 0",
"output": "NO"
},
{
"input": "7\n0 1\n0 -1\n3 0\n5 0\n2 0\n4 0\n1 0\n0 100",
"output": "NO"
},
{
"input": "2\n0 1000000\n1000000 0\n0 100",
"output": "YES"
},
{
"input": "4\n0 1\n-1 2\n0 1\n1 0\n-1 0",
"output": "NO"
},
{
"input": "3\n0 1\n0 1\n0 10\n2 0",
"output": "YES"
},
{
"input": "4\n0 1\n3 0\n2 0\n1 0\n-1 3",
"output": "YES"
},
{
"input": "2\n0 1000000\n10000 0\n100000 1",
"output": "NO"
},
{
"input": "5\n-2 2\n2 0\n0 100000\n0 10000\n0 1000\n0 0",
"output": "YES"
},
{
"input": "2\n0 1000000\n0 0\n2200 1",
"output": "NO"
},
{
"input": "2\n0 1000000\n1 0\n1000000 1",
"output": "NO"
},
{
"input": "2\n2 5\n2 -4\n3 -6",
"output": "NO"
},
{
"input": "2\n-1 1\n0 0\n0 1",
"output": "NO"
},
{
"input": "2\n900000 1000000\n900000 1000000\n1000000 900000",
"output": "NO"
}
] | 1,446,661,522
| 6,022
|
Python 3
|
OK
|
TESTS
| 93
| 561
| 9,932,800
|
n = int(input())
a = list()
x1, x2 = map(int, input().split())
for i in range(n):
k, b = map(int, input().split())
y1 = k * x1 + b
y2 = k * x2 + b
a.append((y1, y2))
a.sort()
fl = 'NO'
y1m = a[0][0]
y2m = a[0][1]
for y1, y2 in a:
if y2 < y2m:
fl = 'YES'
else:
y2m = max(y2m, y2)
print(fl)
|
Title: Anton and Lines
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The teacher gave Anton a large geometry homework, but he didn't do it (as usual) as he participated in a regular round on Codeforces. In the task he was given a set of *n* lines defined by the equations *y*<==<=*k**i*Β·*x*<=+<=*b**i*. It was necessary to determine whether there is at least one point of intersection of two of these lines, that lays strictly inside the strip between *x*1<=<<=*x*2. In other words, is it true that there are 1<=β€<=*i*<=<<=*j*<=β€<=*n* and *x*',<=*y*', such that:
- *y*'<==<=*k**i*<=*<=*x*'<=+<=*b**i*, that is, point (*x*',<=*y*') belongs to the line number *i*; - *y*'<==<=*k**j*<=*<=*x*'<=+<=*b**j*, that is, point (*x*',<=*y*') belongs to the line number *j*; - *x*1<=<<=*x*'<=<<=*x*2, that is, point (*x*',<=*y*') lies inside the strip bounded by *x*1<=<<=*x*2.
You can't leave Anton in trouble, can you? Write a program that solves the given task.
Input Specification:
The first line of the input contains an integer *n* (2<=β€<=*n*<=β€<=100<=000)Β β the number of lines in the task given to Anton. The second line contains integers *x*1 and *x*2 (<=-<=1<=000<=000<=β€<=*x*1<=<<=*x*2<=β€<=1<=000<=000) defining the strip inside which you need to find a point of intersection of at least two lines.
The following *n* lines contain integers *k**i*, *b**i* (<=-<=1<=000<=000<=β€<=*k**i*,<=*b**i*<=β€<=1<=000<=000)Β β the descriptions of the lines. It is guaranteed that all lines are pairwise distinct, that is, for any two *i*<=β <=*j* it is true that either *k**i*<=β <=*k**j*, or *b**i*<=β <=*b**j*.
Output Specification:
Print "Yes" (without quotes), if there is at least one intersection of two distinct lines, located strictly inside the strip. Otherwise print "No" (without quotes).
Demo Input:
['4\n1 2\n1 2\n1 0\n0 1\n0 2\n', '2\n1 3\n1 0\n-1 3\n', '2\n1 3\n1 0\n0 2\n', '2\n1 3\n1 0\n0 3\n']
Demo Output:
['NO', 'YES', 'YES', 'NO']
Note:
In the first sample there are intersections located on the border of the strip, but there are no intersections located strictly inside it.
|
```python
n = int(input())
a = list()
x1, x2 = map(int, input().split())
for i in range(n):
k, b = map(int, input().split())
y1 = k * x1 + b
y2 = k * x2 + b
a.append((y1, y2))
a.sort()
fl = 'NO'
y1m = a[0][0]
y2m = a[0][1]
for y1, y2 in a:
if y2 < y2m:
fl = 'YES'
else:
y2m = max(y2m, y2)
print(fl)
```
| 3
|
|
628
|
B
|
New Skateboard
|
PROGRAMMING
| 1,300
|
[
"dp"
] | null | null |
Max wants to buy a new skateboard. He has calculated the amount of money that is needed to buy a new skateboard. He left a calculator on the floor and went to ask some money from his parents. Meanwhile his little brother Yusuf came and started to press the keys randomly. Unfortunately Max has forgotten the number which he had calculated. The only thing he knows is that the number is divisible by 4.
You are given a string *s* consisting of digits (the number on the display of the calculator after Yusuf randomly pressed the keys). Your task is to find the number of substrings which are divisible by 4. A substring can start with a zero.
A substring of a string is a nonempty sequence of consecutive characters.
For example if string *s* is 124 then we have four substrings that are divisible by 4: 12, 4, 24 and 124. For the string 04 the answer is three: 0, 4, 04.
As input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use gets/scanf/printf instead of getline/cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
|
The only line contains string *s* (1<=β€<=|*s*|<=β€<=3Β·105). The string *s* contains only digits from 0 to 9.
|
Print integer *a* β the number of substrings of the string *s* that are divisible by 4.
Note that the answer can be huge, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
|
[
"124\n",
"04\n",
"5810438174\n"
] |
[
"4\n",
"3\n",
"9\n"
] |
none
| 0
|
[
{
"input": "124",
"output": "4"
},
{
"input": "04",
"output": "3"
},
{
"input": "5810438174",
"output": "9"
},
{
"input": "1",
"output": "0"
},
{
"input": "039",
"output": "1"
},
{
"input": "97247",
"output": "6"
},
{
"input": "5810438174",
"output": "9"
},
{
"input": "12883340691714056185860211260984431382156326935244",
"output": "424"
},
{
"input": "2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031",
"output": "1528"
},
{
"input": "80124649014054971081213608137817466046254652492627741860478258558206397113198232823859870363821007188476405951611069347299689170240023979048198711745011542774268179055311013054073075176122755643483380248999657649211459997766221072399103579977409770898200358240970169892326442892826731631357561876251276209119521202062222947560634301788787748428236988789594458520867663257476744168528121470923031438015546006185059454402637036376247785881323277542968298682307854655591317046086531554595892680980142608",
"output": "30826"
},
{
"input": "123456",
"output": "7"
},
{
"input": "4",
"output": "1"
},
{
"input": "123",
"output": "1"
}
] | 1,590,996,538
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 22
| 280
| 1,024,000
|
s = input()
res = 0
for i in range(1, len(s)) :
if int(s[i-1 : i+1]) % 4 == 0 :
res += i
res += s.count('0') + s.count('4') + s.count('8')
print(res)
|
Title: New Skateboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Max wants to buy a new skateboard. He has calculated the amount of money that is needed to buy a new skateboard. He left a calculator on the floor and went to ask some money from his parents. Meanwhile his little brother Yusuf came and started to press the keys randomly. Unfortunately Max has forgotten the number which he had calculated. The only thing he knows is that the number is divisible by 4.
You are given a string *s* consisting of digits (the number on the display of the calculator after Yusuf randomly pressed the keys). Your task is to find the number of substrings which are divisible by 4. A substring can start with a zero.
A substring of a string is a nonempty sequence of consecutive characters.
For example if string *s* is 124 then we have four substrings that are divisible by 4: 12, 4, 24 and 124. For the string 04 the answer is three: 0, 4, 04.
As input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use gets/scanf/printf instead of getline/cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
Input Specification:
The only line contains string *s* (1<=β€<=|*s*|<=β€<=3Β·105). The string *s* contains only digits from 0 to 9.
Output Specification:
Print integer *a* β the number of substrings of the string *s* that are divisible by 4.
Note that the answer can be huge, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
Demo Input:
['124\n', '04\n', '5810438174\n']
Demo Output:
['4\n', '3\n', '9\n']
Note:
none
|
```python
s = input()
res = 0
for i in range(1, len(s)) :
if int(s[i-1 : i+1]) % 4 == 0 :
res += i
res += s.count('0') + s.count('4') + s.count('8')
print(res)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,687,675,062
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 0
|
k=input()
count=0
for i in k:
if(i.isupper()):
count+=1
if(count>(len(k)//2)):
print(k.upper())
else:
print(k.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
k=input()
count=0
for i in k:
if(i.isupper()):
count+=1
if(count>(len(k)//2)):
print(k.upper())
else:
print(k.lower())
```
| 3.969
|
702
|
A
|
Maximum Increase
|
PROGRAMMING
| 800
|
[
"dp",
"greedy",
"implementation"
] | null | null |
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
|
The first line contains single positive integer *n* (1<=β€<=*n*<=β€<=105) β the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=109).
|
Print the maximum length of an increasing subarray of the given array.
|
[
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] |
[
"3\n",
"1\n",
"3\n"
] |
none
| 0
|
[
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,679,084,381
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 93
| 7,884,800
|
n = int (input())
current = 1
max = 1
x = list(map(int,input().split()))
for i in range(n-1): # 0 1 2 3 4
if x[i+1] > x[i]: # 1 7 2 11 15
current = current +1
else:
current=1
if max<current:max=current
print (max)
|
Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=β€<=*n*<=β€<=105) β the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none
|
```python
n = int (input())
current = 1
max = 1
x = list(map(int,input().split()))
for i in range(n-1): # 0 1 2 3 4
if x[i+1] > x[i]: # 1 7 2 11 15
current = current +1
else:
current=1
if max<current:max=current
print (max)
```
| 3
|
|
152
|
C
|
Pocket Book
|
PROGRAMMING
| 1,400
|
[
"combinatorics"
] | null | null |
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=β€<=*i*<=<<=*j*<=β€<=*n*, 1<=β€<=*k*<=β€<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
|
The first input line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100) β the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
|
Print the single number β the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
|
[
"2 3\nAAB\nBAA\n",
"4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n"
] |
[
"4\n",
"216\n"
] |
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB".
| 1,500
|
[
{
"input": "2 3\nAAB\nBAA",
"output": "4"
},
{
"input": "4 5\nABABA\nBCGDG\nAAAAA\nYABSA",
"output": "216"
},
{
"input": "1 1\nE",
"output": "1"
},
{
"input": "2 2\nNS\nPD",
"output": "4"
},
{
"input": "3 4\nPJKD\nNFJX\nFGFK",
"output": "81"
},
{
"input": "4 5\nSXFMY\nATHLM\nKDDQW\nZWGDS",
"output": "1024"
},
{
"input": "20 14\nJNFKBBBJYZHWQE\nLBOKZCPFNKDBJY\nXKNWGHQHIOXUPF\nDDNRUKVUGHWMXW\nMTIZFNAAFEAPHX\nIXBQOOHEULZYHU\nMRCSREUEOOMUUN\nHJTSQWKUFYZDQU\nGMCMUZCOPRVEIQ\nXBKKGGJECOBLTH\nXXHTLXCNJZJUAF\nVLJRKXXXWMTPKZ\nPTYMNPTBBCWKAD\nQYJGOBUBHMEDYE\nGTKUUVVNKAHTUI\nZNKXYZPCYLBZFP\nQCBLJTRMBDWNNE\nTDOKJOBKEOVNLZ\nFKZUITYAFJOQIM\nUWQNSGLXEEIRWF",
"output": "515139391"
},
{
"input": "5 14\nAQRXUQQNSKZPGC\nDTTKSPFGGVCLPT\nVLZQWWESCHDTAZ\nCOKOWDWDRUOMHP\nXDTRBIZTTCIDGS",
"output": "124999979"
},
{
"input": "9 23\nOILBYKHRGMPENVFNHLSIUOW\nLPJFHTUQUINAALRDGLSQUXR\nLYYJJEBNZATAFQWTDZSPUNZ\nHSJPIQKKWWERJZIEMLCZUKI\nOJYIEYDGPFWRHCMISJCCUEM\nLMGKZVFYIVDRTIHBWPCNUTG\nUBGGNCITVHAIPKXCLTSAULQ\nOWSAWUOXQDBSXXBHTLSXUVD\nUGQTIZQPBGMASRQPVPSFUWK",
"output": "454717784"
},
{
"input": "25 4\nLVKG\nMICU\nZHKW\nLFGG\nOWQO\nLCQG\nLVXU\nOUKB\nLNQX\nZJTO\nOOQX\nLVQP\nMFQB\nMRQV\nOIQH\nOPXX\nXFKU\nFCQB\nZPKH\nLVCH\nNFCU\nOVQW\nOZKU\nLFHX\nLPXO",
"output": "5733"
},
{
"input": "30 10\nUTNTGOKZYJ\nQHOUHNYZVW\nLTVGHJRZVW\nMZHYHOLZYJ\nERYEUEPZYE\nUZDBFTURYJ\nRVSMQTIZGW\nWDJQHMIRYY\nKCORHQPZYE\nRRPLFOZZVY\nJTXMFNNNYJ\nMVTGGOZZVV\nEHAFFNUZVF\nLBRNWJZNYE\nJVMOHTPZYJ\nWTARFJLZVV\nLVJCWOURVW\nLCLQFJYRVV\nQVBVGNJRYF\nNTZGHOLRYE\nMGQKHOUPYJ\nRRSSBXPZYJ\nRYCRGTLZYJ\nJRDEGNKRVW\nRZKFGHYRVG\nMDJBFNIZYG\nMPLWHXIZYE\nSRZMHMURVE\nMTEBBMRZYJ\nJPJIFOLZYM",
"output": "919913906"
},
{
"input": "40 7\nPNTVVER\nPAHTQDR\nRXMJVAS\nVIQNLYC\nILPUSVX\nYJOXQDJ\nSEFODTO\nOTJMREL\nLIQRZGD\nLBJJPOR\nRUTYHQO\nRIWEPBD\nKQUMFIB\nISTRRYH\nXBTOTGK\nRFQODEY\nHDSTZTP\nYCXFAGL\nAREGRFU\nLELZUYU\nGVABDKH\nFJAMMME\nACVULXE\nJHVPJAS\nAAQNMBX\nJJGUCXG\nOQATILQ\nNEOSHJM\nHFLWOFM\nICYEQHY\nFACGLYP\nPLLXJEQ\nDCHXYPB\nAGDDZJJ\nLSQRXTN\nHDQZXIY\nNAHDDWW\nQCMXRQN\nFDUDSZO\nHKBEVTW",
"output": "206575993"
},
{
"input": "2 2\nAA\nBB",
"output": "4"
},
{
"input": "1 10\nAAAAAAAAAA",
"output": "1"
},
{
"input": "2 8\nAAAAAAAA\nBBBBBBBB",
"output": "256"
},
{
"input": "10 10\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB",
"output": "1048576"
},
{
"input": "1 20\nAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "20 1\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF",
"output": "7"
},
{
"input": "5 60\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE",
"output": "449874206"
},
{
"input": "50 4\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ",
"output": "10000"
},
{
"input": "1 100\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "100 1\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA",
"output": "1"
},
{
"input": "100 1\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB",
"output": "2"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB",
"output": "14"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV",
"output": "26"
}
] | 1,663,609,937
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 92
| 0
|
if __name__ == "__main__":
modulo=10**9+7
n,m=map(int,input().split())
names=[]
for i in range(n):
names.append(input().strip())
res=1
for j in range(m):
unique_col_char_count=0
tmp_arr=[]
for i in range(n):
if names[i][j] not in tmp_arr:
unique_col_char_count+=1
tmp_arr.append(names[i][j])
res*=unique_col_char_count
res=res%(modulo)
print(res)
|
Title: Pocket Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=β€<=*i*<=<<=*j*<=β€<=*n*, 1<=β€<=*k*<=β€<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
Input Specification:
The first input line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100) β the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
Output Specification:
Print the single number β the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\nAAB\nBAA\n', '4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n']
Demo Output:
['4\n', '216\n']
Note:
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB".
|
```python
if __name__ == "__main__":
modulo=10**9+7
n,m=map(int,input().split())
names=[]
for i in range(n):
names.append(input().strip())
res=1
for j in range(m):
unique_col_char_count=0
tmp_arr=[]
for i in range(n):
if names[i][j] not in tmp_arr:
unique_col_char_count+=1
tmp_arr.append(names[i][j])
res*=unique_col_char_count
res=res%(modulo)
print(res)
```
| 3
|
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisorsΒ β 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=β€<=*n*<=β€<=100<=000).
|
The first line of the output contains a single integer *k*Β β maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,676,308,146
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 108
| 0
|
n = int(input())
if n % 2 == 0:
print(n//2)
for x in range(n//2):
print(2,end=" ")
else:
print(n//2)
for x in range((n//2) - 1):
print(2,end=" ")
print(3)
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisorsΒ β 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=β€<=*n*<=β€<=100<=000).
Output Specification:
The first line of the output contains a single integer *k*Β β maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
n = int(input())
if n % 2 == 0:
print(n//2)
for x in range(n//2):
print(2,end=" ")
else:
print(n//2)
for x in range((n//2) - 1):
print(2,end=" ")
print(3)
```
| 3
|
|
928
|
A
|
Login Verification
|
PROGRAMMING
| 1,200
|
[
"*special",
"strings"
] | null | null |
When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc.
Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols (Β«_Β»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types:
- transform lowercase letters to uppercase and vice versa; - change letter Β«OΒ» (uppercase latin letter) to digit Β«0Β» and vice versa; - change digit Β«1Β» (one) to any letter among Β«lΒ» (lowercase latin Β«LΒ»), Β«IΒ» (uppercase latin Β«iΒ») and vice versa, or change one of these letters to other.
For example, logins Β«CodeforcesΒ» and Β«codef0rcesΒ» as well as Β«OO0OOO00O0OOO0O00OOO0OO_lolΒ» and Β«OO0OOO0O00OOO0O00OO0OOO_1oIΒ» are considered similar whereas Β«CodeforcesΒ» and Β«Code_forcesΒ» are not.
You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones.
|
The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols (Β«_Β») with length not exceeding 50 Β β the login itself.
The second line contains a single integer *n* (1<=β€<=*n*<=β€<=1<=000)Β β the number of existing logins.
The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar.
|
Print Β«YesΒ» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it.
Otherwise print Β«NoΒ» (without quotes).
|
[
"1_wat\n2\n2_wat\nwat_1\n",
"000\n3\n00\nooA\noOo\n",
"_i_\n3\n__i_\n_1_\nI\n",
"La0\n3\n2a0\nLa1\n1a0\n",
"abc\n1\naBc\n",
"0Lil\n2\nLIL0\n0Ril\n"
] |
[
"Yes\n",
"No\n",
"No\n",
"No\n",
"No\n",
"Yes\n"
] |
In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing.
In the third sample case the new login is similar with the second one.
| 500
|
[
{
"input": "1_wat\n2\n2_wat\nwat_1",
"output": "Yes"
},
{
"input": "000\n3\n00\nooA\noOo",
"output": "No"
},
{
"input": "_i_\n3\n__i_\n_1_\nI",
"output": "No"
},
{
"input": "La0\n3\n2a0\nLa1\n1a0",
"output": "No"
},
{
"input": "abc\n1\naBc",
"output": "No"
},
{
"input": "0Lil\n2\nLIL0\n0Ril",
"output": "Yes"
},
{
"input": "iloO\n3\niIl0\noIl0\nIooO",
"output": "Yes"
},
{
"input": "L1il0o1L1\n5\niLLoLL\noOI1Io10il\nIoLLoO\nO01ilOoI\nI10l0o",
"output": "Yes"
},
{
"input": "ELioO1lOoOIOiLoooi1iolul1O\n7\nOoEIuOIl1ui1010uiooOoi0Oio001L0EoEolO0\nOLIoOEuoE11u1u1iLOI0oO\nuEOuO0uIOOlO01OlEI0E1Oo0IO1LI0uE0LILO0\nEOo0Il11iIOOOIiuOiIiiLOLEOOII001EE\niOoO0LOulioE0OLIIIulli01OoiuOOOoOlEiI0EiiElIIu0\nlE1LOE1Oil\n1u0EOliIiIOl1u110il0l1O0u",
"output": "Yes"
},
{
"input": "0blo7X\n20\n1oobb6\nXIXIO2X\n2iYI2\n607XXol\n2I6io22\nOl10I\nbXX0Lo\nolOOb7X\n07LlXL\nlXY17\n12iIX2\n7lL70\nbOo11\n17Y6b62\n0O6L7\n1lX2L\n2iYl6lI\n7bXIi1o\niLIY2\n0OIo1X",
"output": "Yes"
},
{
"input": "lkUL\n25\nIIfL\nokl\nfoo\ni0U\noko\niIoU\nUUv\nvli\nv0Uk\n0Of\niill\n1vkl\nUIf\nUfOO\nlvLO\nUUo0\nIOf1\nlovL\nIkk\noIv\nLvfU\n0UI\nkol\n1OO0\n1OOi",
"output": "Yes"
},
{
"input": "L1lo\n3\nOOo1\nL1lo\n0lOl",
"output": "No"
},
{
"input": "LIoooiLO\n5\nLIoooiLO\nl0o01I00\n0OOl0lLO01\nil10i0\noiloi",
"output": "No"
},
{
"input": "1i1lQI\n7\nuLg1uLLigIiOLoggu\nLLLgIuQIQIIloiQuIIoIO0l0o000\n0u1LQu11oIuooIl0OooLg0i0IQu1O1lloI1\nQuQgIQi0LOIliLOuuuioLQou1l\nlLIO00QLi01LogOliOIggII1\no0Ll1uIOQl10IL0IILQ\n1i1lQI",
"output": "No"
},
{
"input": "oIzz1\n20\n1TTl0O\nloF0LT\n1lLzo\noi0Ov\nFlIF1zT\nzoITzx\n0TIFlT\nl1vllil\nOviix1F\nLFvI1lL\nLIl0loz\nixz1v\n1i1vFi\nTIFTol\noIzz1\nIvTl0o\nxv1U0O\niiiioF\n1oiLUlO\nxToxv1",
"output": "No"
},
{
"input": "00L0\n25\n0il\nIlkZ\nL0I\n00L0\nBd0\nZLd\n0d1k\nddk\nIdl\nkBd\nkBOL\nZ1lI\nkBL\nLOko\noZ0i\nZ1lO\nLiOk\niBld\nLO0d\ndIo\nZ10\n1k1i\n0o0L\nIoBd\ni0B0",
"output": "No"
},
{
"input": "Z\n1\nz",
"output": "No"
},
{
"input": "0\n1\no",
"output": "No"
},
{
"input": "0\n1\nO",
"output": "No"
},
{
"input": "o\n1\n0",
"output": "No"
},
{
"input": "o\n1\nO",
"output": "No"
},
{
"input": "o\n1\no",
"output": "No"
},
{
"input": "O\n1\no",
"output": "No"
},
{
"input": "O\n1\n0",
"output": "No"
},
{
"input": "1\n1\nl",
"output": "No"
},
{
"input": "1\n1\nL",
"output": "No"
},
{
"input": "1\n1\ni",
"output": "No"
},
{
"input": "1\n1\nI",
"output": "No"
},
{
"input": "1\n1\no",
"output": "Yes"
},
{
"input": "i\n1\n1",
"output": "No"
},
{
"input": "i\n1\nL",
"output": "No"
},
{
"input": "i\n1\nl",
"output": "No"
},
{
"input": "I\n1\nL",
"output": "No"
},
{
"input": "I\n1\nl",
"output": "No"
},
{
"input": "I\n1\n1",
"output": "No"
},
{
"input": "l\n1\n1",
"output": "No"
},
{
"input": "l\n1\nL",
"output": "No"
},
{
"input": "l\n1\ni",
"output": "No"
},
{
"input": "l\n1\nI",
"output": "No"
},
{
"input": "L\n1\nl",
"output": "No"
},
{
"input": "L\n1\n1",
"output": "No"
},
{
"input": "L\n1\ni",
"output": "No"
},
{
"input": "L\n1\nI",
"output": "No"
}
] | 1,673,892,058
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 73
| 46
| 0
|
s=input()
s=s.upper()
s=s.replace('O','0')
s=s.replace('L','1')
s=s.replace('I','1')
f=1
for i in range(int(input())):
s1=input()
s1=s1.upper()
s1=s1.replace('O','0')
s1=s1.replace('L','1')
s1=s1.replace('I','1')
if(s==s1):
f=0
if(f):
print("Yes")
else:
print("No")
|
Title: Login Verification
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc.
Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols (Β«_Β»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types:
- transform lowercase letters to uppercase and vice versa; - change letter Β«OΒ» (uppercase latin letter) to digit Β«0Β» and vice versa; - change digit Β«1Β» (one) to any letter among Β«lΒ» (lowercase latin Β«LΒ»), Β«IΒ» (uppercase latin Β«iΒ») and vice versa, or change one of these letters to other.
For example, logins Β«CodeforcesΒ» and Β«codef0rcesΒ» as well as Β«OO0OOO00O0OOO0O00OOO0OO_lolΒ» and Β«OO0OOO0O00OOO0O00OO0OOO_1oIΒ» are considered similar whereas Β«CodeforcesΒ» and Β«Code_forcesΒ» are not.
You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones.
Input Specification:
The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols (Β«_Β») with length not exceeding 50 Β β the login itself.
The second line contains a single integer *n* (1<=β€<=*n*<=β€<=1<=000)Β β the number of existing logins.
The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar.
Output Specification:
Print Β«YesΒ» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it.
Otherwise print Β«NoΒ» (without quotes).
Demo Input:
['1_wat\n2\n2_wat\nwat_1\n', '000\n3\n00\nooA\noOo\n', '_i_\n3\n__i_\n_1_\nI\n', 'La0\n3\n2a0\nLa1\n1a0\n', 'abc\n1\naBc\n', '0Lil\n2\nLIL0\n0Ril\n']
Demo Output:
['Yes\n', 'No\n', 'No\n', 'No\n', 'No\n', 'Yes\n']
Note:
In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing.
In the third sample case the new login is similar with the second one.
|
```python
s=input()
s=s.upper()
s=s.replace('O','0')
s=s.replace('L','1')
s=s.replace('I','1')
f=1
for i in range(int(input())):
s1=input()
s1=s1.upper()
s1=s1.replace('O','0')
s1=s1.replace('L','1')
s1=s1.replace('I','1')
if(s==s1):
f=0
if(f):
print("Yes")
else:
print("No")
```
| 3
|
|
799
|
A
|
Carrot Cakes
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
|
The only line contains four integers *n*, *t*, *k*, *d* (1<=β€<=*n*,<=*t*,<=*k*,<=*d*<=β€<=1<=000)Β β the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
|
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
|
[
"8 6 4 5\n",
"8 6 4 6\n",
"10 3 11 4\n",
"4 2 1 4\n"
] |
[
"YES\n",
"NO\n",
"NO\n",
"YES\n"
] |
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven.
| 500
|
[
{
"input": "8 6 4 5",
"output": "YES"
},
{
"input": "8 6 4 6",
"output": "NO"
},
{
"input": "10 3 11 4",
"output": "NO"
},
{
"input": "4 2 1 4",
"output": "YES"
},
{
"input": "28 17 16 26",
"output": "NO"
},
{
"input": "60 69 9 438",
"output": "NO"
},
{
"input": "599 97 54 992",
"output": "YES"
},
{
"input": "11 22 18 17",
"output": "NO"
},
{
"input": "1 13 22 11",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "NO"
},
{
"input": "3 1 1 1",
"output": "YES"
},
{
"input": "1000 1000 1000 1000",
"output": "NO"
},
{
"input": "1000 1000 1 1",
"output": "YES"
},
{
"input": "1000 1000 1 400",
"output": "YES"
},
{
"input": "1000 1000 1 1000",
"output": "YES"
},
{
"input": "1000 1000 1 999",
"output": "YES"
},
{
"input": "53 11 3 166",
"output": "YES"
},
{
"input": "313 2 3 385",
"output": "NO"
},
{
"input": "214 9 9 412",
"output": "NO"
},
{
"input": "349 9 5 268",
"output": "YES"
},
{
"input": "611 16 8 153",
"output": "YES"
},
{
"input": "877 13 3 191",
"output": "YES"
},
{
"input": "340 9 9 10",
"output": "YES"
},
{
"input": "31 8 2 205",
"output": "NO"
},
{
"input": "519 3 2 148",
"output": "YES"
},
{
"input": "882 2 21 219",
"output": "NO"
},
{
"input": "982 13 5 198",
"output": "YES"
},
{
"input": "428 13 6 272",
"output": "YES"
},
{
"input": "436 16 14 26",
"output": "YES"
},
{
"input": "628 10 9 386",
"output": "YES"
},
{
"input": "77 33 18 31",
"output": "YES"
},
{
"input": "527 36 4 8",
"output": "YES"
},
{
"input": "128 18 2 169",
"output": "YES"
},
{
"input": "904 4 2 288",
"output": "YES"
},
{
"input": "986 4 3 25",
"output": "YES"
},
{
"input": "134 8 22 162",
"output": "NO"
},
{
"input": "942 42 3 69",
"output": "YES"
},
{
"input": "894 4 9 4",
"output": "YES"
},
{
"input": "953 8 10 312",
"output": "YES"
},
{
"input": "43 8 1 121",
"output": "YES"
},
{
"input": "12 13 19 273",
"output": "NO"
},
{
"input": "204 45 10 871",
"output": "YES"
},
{
"input": "342 69 50 425",
"output": "NO"
},
{
"input": "982 93 99 875",
"output": "NO"
},
{
"input": "283 21 39 132",
"output": "YES"
},
{
"input": "1000 45 83 686",
"output": "NO"
},
{
"input": "246 69 36 432",
"output": "NO"
},
{
"input": "607 93 76 689",
"output": "NO"
},
{
"input": "503 21 24 435",
"output": "NO"
},
{
"input": "1000 45 65 989",
"output": "NO"
},
{
"input": "30 21 2 250",
"output": "YES"
},
{
"input": "1000 49 50 995",
"output": "NO"
},
{
"input": "383 69 95 253",
"output": "YES"
},
{
"input": "393 98 35 999",
"output": "YES"
},
{
"input": "1000 22 79 552",
"output": "NO"
},
{
"input": "268 294 268 154",
"output": "NO"
},
{
"input": "963 465 706 146",
"output": "YES"
},
{
"input": "304 635 304 257",
"output": "NO"
},
{
"input": "4 2 1 6",
"output": "NO"
},
{
"input": "1 51 10 50",
"output": "NO"
},
{
"input": "5 5 4 4",
"output": "YES"
},
{
"input": "3 2 1 1",
"output": "YES"
},
{
"input": "3 4 3 3",
"output": "NO"
},
{
"input": "7 3 4 1",
"output": "YES"
},
{
"input": "101 10 1 1000",
"output": "NO"
},
{
"input": "5 1 1 1",
"output": "YES"
},
{
"input": "5 10 5 5",
"output": "NO"
},
{
"input": "19 1 7 1",
"output": "YES"
},
{
"input": "763 572 745 262",
"output": "YES"
},
{
"input": "1 2 1 1",
"output": "NO"
},
{
"input": "5 1 1 3",
"output": "YES"
},
{
"input": "170 725 479 359",
"output": "NO"
},
{
"input": "6 2 1 7",
"output": "YES"
},
{
"input": "6 2 5 1",
"output": "YES"
},
{
"input": "1 2 2 1",
"output": "NO"
},
{
"input": "24 2 8 3",
"output": "YES"
},
{
"input": "7 3 3 3",
"output": "YES"
},
{
"input": "5 2 2 2",
"output": "YES"
},
{
"input": "3 2 1 2",
"output": "YES"
},
{
"input": "1000 2 200 8",
"output": "NO"
},
{
"input": "3 100 2 100",
"output": "NO"
},
{
"input": "2 999 1 1000",
"output": "NO"
},
{
"input": "2 1 1 1",
"output": "NO"
},
{
"input": "2 3 5 1",
"output": "NO"
},
{
"input": "100 1 5 1",
"output": "YES"
},
{
"input": "7 2 3 3",
"output": "YES"
},
{
"input": "4 1 1 3",
"output": "NO"
},
{
"input": "3 2 2 1",
"output": "YES"
},
{
"input": "1 1 1 2",
"output": "NO"
},
{
"input": "91 8 7 13",
"output": "YES"
},
{
"input": "3 1 2 1",
"output": "NO"
},
{
"input": "5 3 2 3",
"output": "YES"
},
{
"input": "9 6 6 3",
"output": "YES"
}
] | 1,597,672,221
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 93
| 140
| 0
|
n, t, k, d = map(int, input().split())
g = int((n + k - 1) / k)
o1, o2 = 0, d
i = 0
while i < g:
if o1 <= o2:
o1 += t
else:
o2 += t
i += 1
if max(o1, o2) < g * t:
print("YES")
else:
print("NO")
|
Title: Carrot Cakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
Input Specification:
The only line contains four integers *n*, *t*, *k*, *d* (1<=β€<=*n*,<=*t*,<=*k*,<=*d*<=β€<=1<=000)Β β the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
Output Specification:
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
Demo Input:
['8 6 4 5\n', '8 6 4 6\n', '10 3 11 4\n', '4 2 1 4\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n', 'YES\n']
Note:
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven.
|
```python
n, t, k, d = map(int, input().split())
g = int((n + k - 1) / k)
o1, o2 = 0, d
i = 0
while i < g:
if o1 <= o2:
o1 += t
else:
o2 += t
i += 1
if max(o1, o2) < g * t:
print("YES")
else:
print("NO")
```
| 3
|
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisorsΒ β 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=β€<=*n*<=β€<=100<=000).
|
The first line of the output contains a single integer *k*Β β maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,693,061,281
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 77
| 1,024,000
|
n = int(input())
primes_sum = [2] * (n // 2)
if n % 2 == 1:
primes_sum[-1] = 3
print(len(primes_sum))
print(*primes_sum)
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisorsΒ β 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=β€<=*n*<=β€<=100<=000).
Output Specification:
The first line of the output contains a single integer *k*Β β maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
n = int(input())
primes_sum = [2] * (n // 2)
if n % 2 == 1:
primes_sum[-1] = 3
print(len(primes_sum))
print(*primes_sum)
```
| 3
|
|
909
|
A
|
Generate Login
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"sortings"
] | null | null |
The preferred way to generate user login in Polygon is to concatenate a prefix of the user's first name and a prefix of their last name, in that order. Each prefix must be non-empty, and any of the prefixes can be the full name. Typically there are multiple possible logins for each person.
You are given the first and the last name of a user. Return the alphabetically earliest login they can get (regardless of other potential Polygon users).
As a reminder, a prefix of a string *s* is its substring which occurs at the beginning of *s*: "a", "ab", "abc" etc. are prefixes of string "{abcdef}" but "b" and 'bc" are not. A string *a* is alphabetically earlier than a string *b*, if *a* is a prefix of *b*, or *a* and *b* coincide up to some position, and then *a* has a letter that is alphabetically earlier than the corresponding letter in *b*: "a" and "ab" are alphabetically earlier than "ac" but "b" and "ba" are alphabetically later than "ac".
|
The input consists of a single line containing two space-separated strings: the first and the last names. Each character of each string is a lowercase English letter. The length of each string is between 1 and 10, inclusive.
|
Output a single stringΒ β alphabetically earliest possible login formed from these names. The output should be given in lowercase as well.
|
[
"harry potter\n",
"tom riddle\n"
] |
[
"hap\n",
"tomr\n"
] |
none
| 500
|
[
{
"input": "harry potter",
"output": "hap"
},
{
"input": "tom riddle",
"output": "tomr"
},
{
"input": "a qdpinbmcrf",
"output": "aq"
},
{
"input": "wixjzniiub ssdfodfgap",
"output": "wis"
},
{
"input": "z z",
"output": "zz"
},
{
"input": "ertuyivhfg v",
"output": "ertuv"
},
{
"input": "asdfghjkli ware",
"output": "asdfghjkliw"
},
{
"input": "udggmyop ze",
"output": "udggmyopz"
},
{
"input": "fapkdme rtzxovx",
"output": "fapkdmer"
},
{
"input": "mybiqxmnqq l",
"output": "ml"
},
{
"input": "dtbqya fyyymv",
"output": "df"
},
{
"input": "fyclu zokbxiahao",
"output": "fycluz"
},
{
"input": "qngatnviv rdych",
"output": "qngar"
},
{
"input": "ttvnhrnng lqkfulhrn",
"output": "tl"
},
{
"input": "fya fgx",
"output": "ff"
},
{
"input": "nuis zvjjqlre",
"output": "nuisz"
},
{
"input": "ly qtsmze",
"output": "lq"
},
{
"input": "d kgfpjsurfw",
"output": "dk"
},
{
"input": "lwli ewrpu",
"output": "le"
},
{
"input": "rr wldsfubcs",
"output": "rrw"
},
{
"input": "h qart",
"output": "hq"
},
{
"input": "vugvblnzx kqdwdulm",
"output": "vk"
},
{
"input": "xohesmku ef",
"output": "xe"
},
{
"input": "twvvsl wtcyawv",
"output": "tw"
},
{
"input": "obljndajv q",
"output": "obljndajq"
},
{
"input": "jjxwj kxccwx",
"output": "jjk"
},
{
"input": "sk fftzmv",
"output": "sf"
},
{
"input": "cgpegngs aufzxkyyrw",
"output": "ca"
},
{
"input": "reyjzjdvq skuch",
"output": "res"
},
{
"input": "ardaae mxgdulijf",
"output": "am"
},
{
"input": "bgopsdfji uaps",
"output": "bgopsdfjiu"
},
{
"input": "amolfed pun",
"output": "amolfedp"
},
{
"input": "badkiln yort",
"output": "badkilny"
},
{
"input": "aaaaaaaaaz york",
"output": "aaaaaaaaay"
},
{
"input": "bbbbcbbbbd c",
"output": "bbbbc"
},
{
"input": "aa ab",
"output": "aa"
},
{
"input": "ab b",
"output": "ab"
},
{
"input": "aaaaa ab",
"output": "aa"
},
{
"input": "aa a",
"output": "aa"
},
{
"input": "aba b",
"output": "ab"
},
{
"input": "aaaaaaa aaaaaa",
"output": "aa"
},
{
"input": "a a",
"output": "aa"
},
{
"input": "a aa",
"output": "aa"
},
{
"input": "a b",
"output": "ab"
},
{
"input": "b a",
"output": "ba"
},
{
"input": "z a",
"output": "za"
},
{
"input": "aaa a",
"output": "aa"
},
{
"input": "aa aa",
"output": "aa"
},
{
"input": "a aaa",
"output": "aa"
},
{
"input": "aaaaaaaaaa aaaaaaaaaa",
"output": "aa"
},
{
"input": "aaaaaaaaaa a",
"output": "aa"
},
{
"input": "a aaaaaaaaaa",
"output": "aa"
},
{
"input": "zzaa b",
"output": "zb"
},
{
"input": "ca cf",
"output": "cac"
},
{
"input": "abhi ia",
"output": "abhi"
},
{
"input": "aaaa aaaab",
"output": "aa"
},
{
"input": "aar raa",
"output": "aar"
},
{
"input": "harry hotter",
"output": "hah"
},
{
"input": "aaaaaaa a",
"output": "aa"
},
{
"input": "apple pie",
"output": "ap"
},
{
"input": "aaa aaa",
"output": "aa"
},
{
"input": "kabc buba",
"output": "kab"
},
{
"input": "asd ss",
"output": "as"
},
{
"input": "bbb b",
"output": "bb"
}
] | 1,514,395,082
| 2,582
|
Python 3
|
OK
|
TESTS
| 64
| 78
| 5,529,600
|
def getprfx(s):
tab = [s[0]]
for i in range(1, len(s)):
x = tab[i-1] + s[i]
tab.append(x)
return tab
n, m = input().split()
a, b = getprfx(n), getprfx(m)
mn = a[0] + b[0]
for i in a:
for j in b:
if i+j < mn:
mn = i+j
print(mn)
|
Title: Generate Login
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The preferred way to generate user login in Polygon is to concatenate a prefix of the user's first name and a prefix of their last name, in that order. Each prefix must be non-empty, and any of the prefixes can be the full name. Typically there are multiple possible logins for each person.
You are given the first and the last name of a user. Return the alphabetically earliest login they can get (regardless of other potential Polygon users).
As a reminder, a prefix of a string *s* is its substring which occurs at the beginning of *s*: "a", "ab", "abc" etc. are prefixes of string "{abcdef}" but "b" and 'bc" are not. A string *a* is alphabetically earlier than a string *b*, if *a* is a prefix of *b*, or *a* and *b* coincide up to some position, and then *a* has a letter that is alphabetically earlier than the corresponding letter in *b*: "a" and "ab" are alphabetically earlier than "ac" but "b" and "ba" are alphabetically later than "ac".
Input Specification:
The input consists of a single line containing two space-separated strings: the first and the last names. Each character of each string is a lowercase English letter. The length of each string is between 1 and 10, inclusive.
Output Specification:
Output a single stringΒ β alphabetically earliest possible login formed from these names. The output should be given in lowercase as well.
Demo Input:
['harry potter\n', 'tom riddle\n']
Demo Output:
['hap\n', 'tomr\n']
Note:
none
|
```python
def getprfx(s):
tab = [s[0]]
for i in range(1, len(s)):
x = tab[i-1] + s[i]
tab.append(x)
return tab
n, m = input().split()
a, b = getprfx(n), getprfx(m)
mn = a[0] + b[0]
for i in a:
for j in b:
if i+j < mn:
mn = i+j
print(mn)
```
| 3
|
|
507
|
B
|
Amr and Pins
|
PROGRAMMING
| 1,400
|
[
"geometry",
"math"
] | null | null |
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
|
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=β€<=*r*<=β€<=105, <=-<=105<=β€<=*x*,<=*y*,<=*x*',<=*y*'<=β€<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
|
Output a single integer β minimum number of steps required to move the center of the circle to the destination point.
|
[
"2 0 0 0 4\n",
"1 1 1 4 4\n",
"4 5 6 5 6\n"
] |
[
"1\n",
"3\n",
"0\n"
] |
In the first sample test the optimal way is to put a pin at point (0,β2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "2 0 0 0 4",
"output": "1"
},
{
"input": "1 1 1 4 4",
"output": "3"
},
{
"input": "4 5 6 5 6",
"output": "0"
},
{
"input": "10 20 0 40 0",
"output": "1"
},
{
"input": "9 20 0 40 0",
"output": "2"
},
{
"input": "5 -1 -6 -5 1",
"output": "1"
},
{
"input": "99125 26876 -21414 14176 17443",
"output": "1"
},
{
"input": "8066 7339 19155 -90534 -60666",
"output": "8"
},
{
"input": "100000 -100000 -100000 100000 100000",
"output": "2"
},
{
"input": "10 20 0 41 0",
"output": "2"
},
{
"input": "25 -64 -6 -56 64",
"output": "2"
},
{
"input": "125 455 450 439 721",
"output": "2"
},
{
"input": "5 6 3 7 2",
"output": "1"
},
{
"input": "24 130 14786 3147 2140",
"output": "271"
},
{
"input": "125 -363 176 93 330",
"output": "2"
},
{
"input": "1 14 30 30 14",
"output": "12"
},
{
"input": "25 96 13 7 2",
"output": "2"
},
{
"input": "4 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "1 3 4 2 5",
"output": "1"
},
{
"input": "1 -3 3 2 6",
"output": "3"
},
{
"input": "2 7 20 13 -5",
"output": "7"
},
{
"input": "1 1 1 1 4",
"output": "2"
},
{
"input": "249 -54242 -30537 -45023 -89682",
"output": "121"
},
{
"input": "4 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "97741 23818 78751 97583 26933",
"output": "1"
},
{
"input": "56767 -29030 51625 79823 -56297",
"output": "2"
},
{
"input": "98260 13729 74998 23701 9253",
"output": "1"
},
{
"input": "67377 -80131 -90254 -57320 14102",
"output": "1"
},
{
"input": "1 100000 100000 100000 -100000",
"output": "100000"
},
{
"input": "19312 19470 82059 58064 62231",
"output": "2"
},
{
"input": "67398 -68747 -79056 -34193 29400",
"output": "1"
},
{
"input": "91099 37184 -71137 75650 -3655",
"output": "1"
},
{
"input": "46456 -2621 -23623 -98302 -99305",
"output": "2"
},
{
"input": "100 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "1 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "8 0 0 0 32",
"output": "2"
},
{
"input": "100000 100000 1 -100000 0",
"output": "2"
}
] | 1,645,220,418
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 93
| 0
|
from math import *
r,x,y,a,b=map(int,input().split())
print(ceil((((x-a)**2+(y-b)**2)**0.5)/(r*2)))
|
Title: Amr and Pins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
Input Specification:
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=β€<=*r*<=β€<=105, <=-<=105<=β€<=*x*,<=*y*,<=*x*',<=*y*'<=β€<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output Specification:
Output a single integer β minimum number of steps required to move the center of the circle to the destination point.
Demo Input:
['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n']
Demo Output:
['1\n', '3\n', '0\n']
Note:
In the first sample test the optimal way is to put a pin at point (0,β2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
from math import *
r,x,y,a,b=map(int,input().split())
print(ceil((((x-a)**2+(y-b)**2)**0.5)/(r*2)))
```
| 3
|
|
112
|
A
|
Petya and Strings
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Petya and Strings
|
2
|
256
|
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
|
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
|
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
|
[
"aaaa\naaaA\n",
"abs\nAbz\n",
"abcdefg\nAbCdEfF\n"
] |
[
"0\n",
"-1\n",
"1\n"
] |
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
| 500
|
[
{
"input": "aaaa\naaaA",
"output": "0"
},
{
"input": "abs\nAbz",
"output": "-1"
},
{
"input": "abcdefg\nAbCdEfF",
"output": "1"
},
{
"input": "asadasdasd\nasdwasdawd",
"output": "-1"
},
{
"input": "aslkjlkasdd\nasdlkjdajwi",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp",
"output": "0"
},
{
"input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH",
"output": "-1"
},
{
"input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt",
"output": "1"
},
{
"input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL",
"output": "1"
},
{
"input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo",
"output": "1"
},
{
"input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja",
"output": "-1"
},
{
"input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy",
"output": "1"
},
{
"input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR",
"output": "1"
},
{
"input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd",
"output": "1"
},
{
"input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI",
"output": "-1"
},
{
"input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC",
"output": "-1"
},
{
"input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl",
"output": "-1"
},
{
"input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo",
"output": "-1"
},
{
"input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV",
"output": "-1"
},
{
"input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ",
"output": "-1"
},
{
"input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK",
"output": "-1"
},
{
"input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys",
"output": "1"
},
{
"input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy",
"output": "-1"
},
{
"input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK",
"output": "-1"
},
{
"input": "UG\nak",
"output": "1"
},
{
"input": "JZR\nVae",
"output": "-1"
},
{
"input": "a\nZ",
"output": "-1"
},
{
"input": "rk\nkv",
"output": "1"
},
{
"input": "RvuT\nbJzE",
"output": "1"
},
{
"input": "PPS\nydq",
"output": "-1"
},
{
"input": "q\nq",
"output": "0"
},
{
"input": "peOw\nIgSJ",
"output": "1"
},
{
"input": "PyK\noKN",
"output": "1"
},
{
"input": "O\ni",
"output": "1"
},
{
"input": "NmGY\npDlP",
"output": "-1"
},
{
"input": "nG\nZf",
"output": "-1"
},
{
"input": "m\na",
"output": "1"
},
{
"input": "MWyB\nWZEV",
"output": "-1"
},
{
"input": "Gre\nfxc",
"output": "1"
},
{
"input": "Ooq\nwap",
"output": "-1"
},
{
"input": "XId\nlbB",
"output": "1"
},
{
"input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF",
"output": "0"
},
{
"input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD",
"output": "0"
},
{
"input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA",
"output": "0"
},
{
"input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ",
"output": "0"
},
{
"input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG",
"output": "0"
},
{
"input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ",
"output": "0"
},
{
"input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ",
"output": "0"
},
{
"input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi",
"output": "0"
},
{
"input": "abac\nadaa",
"output": "-1"
},
{
"input": "Bbc\nabc",
"output": "1"
},
{
"input": "aaaba\naaaab",
"output": "1"
}
] | 1,695,295,819
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 53
| 92
| 0
|
s1 = input().lower()
s2 = input().lower()
if s1==s2:
print(0)
if s1<s2:
print(-1)
if s1>s2:
print(1)
|
Title: Petya and Strings
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Input Specification:
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
Output Specification:
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
Demo Input:
['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
|
```python
s1 = input().lower()
s2 = input().lower()
if s1==s2:
print(0)
if s1<s2:
print(-1)
if s1>s2:
print(1)
```
| 3.977
|
499
|
B
|
Lecture
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
|
The first line contains two integers, *n* and *m* (1<=β€<=*n*<=β€<=3000, 1<=β€<=*m*<=β€<=3000) β the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* β the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
|
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
|
[
"4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n",
"5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n"
] |
[
"codeforces round letter round\n",
"hbnyiyc joll joll un joll\n"
] |
none
| 500
|
[
{
"input": "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest",
"output": "codeforces round letter round"
},
{
"input": "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll",
"output": "hbnyiyc joll joll un joll"
},
{
"input": "5 5\nqueyqj f\nb vn\ntabzvk qpfzoqx\nytnyonoc hnxsd\njpggvr lchinjmt\nqueyqj jpggvr b ytnyonoc b",
"output": "f jpggvr b hnxsd b"
},
{
"input": "10 22\nazbrll oen\ngh vdyayei\njphveblohx vfglv\nmfyxib jepnvhcuwo\nrpikazqj uam\nl rx\nokjenof qpnyi\nj tixqrno\nod itozmfct\nikkdxmirx ev\nqexftojc p\nkdazb zjs\nmbk ykvqjrxaxu\nhbcwhouzq pwt\nmirpsz zfaegpl\nuhkkvcj rlvwj\nef iqnnwtolrc\npjzfcpmeag ecdayth\nsa qcthz\ncbfhfxi qrnbvdryz\nwqel tj\natx smkbid\nef hbcwhouzq cbfhfxi hbcwhouzq mirpsz cbfhfxi cbfhfxi okjenof pjzfcpmeag kdazb",
"output": "ef pwt cbfhfxi pwt mirpsz cbfhfxi cbfhfxi qpnyi ecdayth zjs"
},
{
"input": "1 1\namit am\namit",
"output": "am"
},
{
"input": "1 1\na c\na",
"output": "a"
}
] | 1,639,733,904
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 62
| 409,600
|
n , m = map(int, input().split(" "))
notes = {}
final = []
for i in range(m):
a,b = map(str, input().split())
notes[a]=b
c = list(map(str, input().split(" ")[:n]))
for i in c:
if len(notes[i])>=len(i):
final.append(i)
else:
final.append(notes[i])
print(" ".join(final))
|
Title: Lecture
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
Input Specification:
The first line contains two integers, *n* and *m* (1<=β€<=*n*<=β€<=3000, 1<=β€<=*m*<=β€<=3000) β the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* β the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
Output Specification:
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
Demo Input:
['4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n', '5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n']
Demo Output:
['codeforces round letter round\n', 'hbnyiyc joll joll un joll\n']
Note:
none
|
```python
n , m = map(int, input().split(" "))
notes = {}
final = []
for i in range(m):
a,b = map(str, input().split())
notes[a]=b
c = list(map(str, input().split(" ")[:n]))
for i in c:
if len(notes[i])>=len(i):
final.append(i)
else:
final.append(notes[i])
print(" ".join(final))
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=Γ<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=Γ<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=β€<=<=*n*,<=*m*,<=*a*<=β€<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,648,553,592
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 31
| 0
|
n, m, a = input().split()
n, m, a = int(n), int(m), int(a)
x = (n + a - 1) / a
y = (m + a - 1) / a
print(int(x)*int(y))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=Γ<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=Γ<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=β€<=<=*n*,<=*m*,<=*a*<=β€<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n, m, a = input().split()
n, m, a = int(n), int(m), int(a)
x = (n + a - 1) / a
y = (m + a - 1) / a
print(int(x)*int(y))
```
| 3.9845
|
535
|
B
|
Tavas and SaDDas
|
PROGRAMMING
| 1,100
|
[
"bitmasks",
"brute force",
"combinatorics",
"implementation"
] | null | null |
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
|
The first and only line of input contains a lucky number *n* (1<=β€<=*n*<=β€<=109).
|
Print the index of *n* among all lucky numbers.
|
[
"4\n",
"7\n",
"77\n"
] |
[
"1\n",
"2\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "4",
"output": "1"
},
{
"input": "7",
"output": "2"
},
{
"input": "77",
"output": "6"
},
{
"input": "4",
"output": "1"
},
{
"input": "474744",
"output": "83"
},
{
"input": "777774",
"output": "125"
},
{
"input": "447",
"output": "8"
},
{
"input": "774",
"output": "13"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447747",
"output": "140"
},
{
"input": "7747474",
"output": "233"
},
{
"input": "4444",
"output": "15"
},
{
"input": "4447",
"output": "16"
},
{
"input": "7",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447744",
"output": "139"
},
{
"input": "77474",
"output": "57"
},
{
"input": "7747",
"output": "28"
},
{
"input": "444",
"output": "7"
},
{
"input": "7",
"output": "2"
},
{
"input": "7774477",
"output": "242"
},
{
"input": "4477774",
"output": "157"
},
{
"input": "7444",
"output": "23"
},
{
"input": "7474747",
"output": "212"
},
{
"input": "77",
"output": "6"
},
{
"input": "774477",
"output": "114"
},
{
"input": "7",
"output": "2"
},
{
"input": "47",
"output": "4"
},
{
"input": "747777",
"output": "110"
},
{
"input": "444444444",
"output": "511"
},
{
"input": "777777777",
"output": "1022"
},
{
"input": "477477447",
"output": "728"
},
{
"input": "777744747",
"output": "996"
}
] | 1,592,690,410
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 33
| 155
| 0
|
import math
def fact(n):
ans = 1
for i in range(2, n+1):
ans*= i
return ans
def comb(n, c):
return fact(n)//(fact(n-c)*c)
n= int(input())
if(n==4):
print(1)
elif(n==7):
print(2)
else:
add = 2
ans = 0
n = str(n)
for i in range(len(n)):
ans+=(2**i)
pos = (2**len(n))
left = 1
right = pos
i = 0
while(left < right and i < len(n)):
mid = (left+right)//2
if(n[i]=='4'):
right = mid
else:
left = mid+1
i+=1
ans+=left-1
print(ans)
|
Title: Tavas and SaDDas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
Input Specification:
The first and only line of input contains a lucky number *n* (1<=β€<=*n*<=β€<=109).
Output Specification:
Print the index of *n* among all lucky numbers.
Demo Input:
['4\n', '7\n', '77\n']
Demo Output:
['1\n', '2\n', '6\n']
Note:
none
|
```python
import math
def fact(n):
ans = 1
for i in range(2, n+1):
ans*= i
return ans
def comb(n, c):
return fact(n)//(fact(n-c)*c)
n= int(input())
if(n==4):
print(1)
elif(n==7):
print(2)
else:
add = 2
ans = 0
n = str(n)
for i in range(len(n)):
ans+=(2**i)
pos = (2**len(n))
left = 1
right = pos
i = 0
while(left < right and i < len(n)):
mid = (left+right)//2
if(n[i]=='4'):
right = mid
else:
left = mid+1
i+=1
ans+=left-1
print(ans)
```
| 3
|
|
620
|
A
|
Professor GukiZ's Robot
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
|
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=β€<=*x*1,<=*y*1<=β€<=109) β the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=β€<=*x*2,<=*y*2<=β€<=109) β the finish position of the robot.
|
Print the only integer *d* β the minimal number of steps to get the finish position.
|
[
"0 0\n4 5\n",
"3 4\n6 1\n"
] |
[
"5\n",
"3\n"
] |
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4,β4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
| 0
|
[
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,453,615,685
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 75
| 62
| 0
|
x1, y1 = list(map(int, input().split()))
x2, y2 = list(map(int, input().split()))
print(max(abs(x1-x2), abs(y1-y2)))
|
Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=β€<=*x*1,<=*y*1<=β€<=109) β the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=β€<=*x*2,<=*y*2<=β€<=109) β the finish position of the robot.
Output Specification:
Print the only integer *d* β the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4,β4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
|
```python
x1, y1 = list(map(int, input().split()))
x2, y2 = list(map(int, input().split()))
print(max(abs(x1-x2), abs(y1-y2)))
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=β€<=*n*<=β€<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integerΒ β the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,594,393,783
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 109
| 6,963,200
|
inputStr = input()
comb = [0,0,0]
count = 0
for i in range(len(inputStr)):
if inputStr[i] == 'Q':
comb[0] == 1
for j in range(i, len(inputStr)):
if inputStr[j] == 'A':
comb[1] == 1
for k in range(j, len(inputStr)):
if inputStr[k] == 'Q':
comb[2] += 1
count += 1
print(count)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=β€<=*n*<=β€<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integerΒ β the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
inputStr = input()
comb = [0,0,0]
count = 0
for i in range(len(inputStr)):
if inputStr[i] == 'Q':
comb[0] == 1
for j in range(i, len(inputStr)):
if inputStr[j] == 'A':
comb[1] == 1
for k in range(j, len(inputStr)):
if inputStr[k] == 'Q':
comb[2] += 1
count += 1
print(count)
```
| 3
|
|
436
|
B
|
Om Nom and Spiders
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
Om Nom really likes candies and doesn't like spiders as they frequently steal candies. One day Om Nom fancied a walk in a park. Unfortunately, the park has some spiders and Om Nom doesn't want to see them at all.
The park can be represented as a rectangular *n*<=Γ<=*m* field. The park has *k* spiders, each spider at time 0 is at some cell of the field. The spiders move all the time, and each spider always moves in one of the four directions (left, right, down, up). In a unit of time, a spider crawls from his cell to the side-adjacent cell in the corresponding direction. If there is no cell in the given direction, then the spider leaves the park. The spiders do not interfere with each other as they move. Specifically, one cell can have multiple spiders at the same time.
Om Nom isn't yet sure where to start his walk from but he definitely wants:
- to start walking at time 0 at an upper row cell of the field (it is guaranteed that the cells in this row do not contain any spiders); - to walk by moving down the field towards the lowest row (the walk ends when Om Nom leaves the boundaries of the park).
We know that Om Nom moves by jumping. One jump takes one time unit and transports the little monster from his cell to either a side-adjacent cell on the lower row or outside the park boundaries.
Each time Om Nom lands in a cell he sees all the spiders that have come to that cell at this moment of time. Om Nom wants to choose the optimal cell to start the walk from. That's why he wonders: for each possible starting cell, how many spiders will he see during the walk if he starts from this cell? Help him and calculate the required value for each possible starting cell.
|
The first line contains three integers *n*,<=*m*,<=*k* (2<=β€<=*n*,<=*m*<=β€<=2000;Β 0<=β€<=*k*<=β€<=*m*(*n*<=-<=1)).
Each of the next *n* lines contains *m* characters β the description of the park. The characters in the *i*-th line describe the *i*-th row of the park field. If the character in the line equals ".", that means that the corresponding cell of the field is empty; otherwise, the character in the line will equal one of the four characters: "L" (meaning that this cell has a spider at time 0, moving left), "R" (a spider moving right), "U" (a spider moving up), "D" (a spider moving down).
It is guaranteed that the first row doesn't contain any spiders. It is guaranteed that the description of the field contains no extra characters. It is guaranteed that at time 0 the field contains exactly *k* spiders.
|
Print *m* integers: the *j*-th integer must show the number of spiders Om Nom will see if he starts his walk from the *j*-th cell of the first row. The cells in any row of the field are numbered from left to right.
|
[
"3 3 4\n...\nR.L\nR.U\n",
"2 2 2\n..\nRL\n",
"2 2 2\n..\nLR\n",
"3 4 8\n....\nRRLL\nUUUU\n",
"2 2 2\n..\nUU\n"
] |
[
"0 2 2 ",
"1 1 ",
"0 0 ",
"1 3 3 1 ",
"0 0 "
] |
Consider the first sample. The notes below show how the spider arrangement changes on the field over time:
Character "*" represents a cell that contains two spiders at the same time.
- If Om Nom starts from the first cell of the first row, he won't see any spiders. - If he starts from the second cell, he will see two spiders at time 1. - If he starts from the third cell, he will see two spiders: one at time 1, the other one at time 2.
| 1,000
|
[
{
"input": "3 3 4\n...\nR.L\nR.U",
"output": "0 2 2 "
},
{
"input": "2 2 2\n..\nRL",
"output": "1 1 "
},
{
"input": "2 2 2\n..\nLR",
"output": "0 0 "
},
{
"input": "3 4 8\n....\nRRLL\nUUUU",
"output": "1 3 3 1 "
},
{
"input": "2 2 2\n..\nUU",
"output": "0 0 "
},
{
"input": "2 2 0\n..\n..",
"output": "0 0 "
},
{
"input": "5 5 10\n.....\nRU.D.\n..DLL\n.D...\nRL..L",
"output": "1 2 1 0 1 "
},
{
"input": "5 6 20\n......\n.UURD.\nLUD.RR\nU.LDDD\nDDLDDU",
"output": "0 1 0 0 1 1 "
},
{
"input": "4 5 15\n.....\nDRRLR\nULDLD\nDLRRL",
"output": "1 2 2 1 0 "
},
{
"input": "3 7 14\n.......\nLDUDLLD\nDLRDDLD",
"output": "0 0 0 2 2 0 0 "
},
{
"input": "5 7 19\n.......\nRDLLLRL\nUUR..U.\n.D.DLLL\n..R..UU",
"output": "1 4 2 2 1 3 3 "
},
{
"input": "8 9 28\n.........\n.R.LDR.D.\n....UULU.\nR.D..DL.L\n.R..DLUDU\nR........\n.URU...UU\n.....D.L.",
"output": "1 2 2 3 2 4 2 2 3 "
},
{
"input": "2 100 59\n....................................................................................................\n.DR.D..DLLR.LDRR..L.LDRRRDLD.LDRR.LLR.R...DRLD.RRLL.L.D..R.LD.DL....LR.LR.DRLD.....L.D..RD...D.LL.R.",
"output": "0 0 0 1 0 0 0 1 1 0 0 2 0 0 0 1 1 1 0 1 0 0 0 1 1 2 0 0 1 0 0 0 1 2 1 0 0 1 0 1 0 0 0 1 1 0 0 0 2 2 0 1 0 0 0 0 0 0 2 0 0 0 1 0 0 0 0 1 0 0 2 0 0 1 0 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 0 0 1 "
},
{
"input": "100 2 45\n..\n.D\nU.\n..\nU.\n..\n..\n..\nU.\n..\n..\nD.\nU.\n..\n..\n.D\nDU\n..\nUD\n..\n..\n..\n..\n..\n..\nD.\nU.\n..\n..\nD.\nU.\n..\n..\n..\nU.\n..\n..\n.D\n..\n..\n.D\n..\n..\n.D\n.U\nD.\n..\n.D\n..\n..\nUD\n..\nU.\n..\nU.\n..\nUD\n..\nU.\n..\nU.\n..\n..\n..\nU.\n..\n..\nD.\n..\n..\nU.\n..\nU.\n..\nUU\n..\nU.\n..\nU.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n.D\n..\n..\nD.\nU.\n.D\n..\n..\nU.\n.D\nU.\n..",
"output": "23 3 "
}
] | 1,660,110,056
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 36
| 170
| 8,704,000
|
import sys
input = sys.stdin.readline
n, m, k = map(int, input().split())
g = [input()[:-1] for _ in range(n)]
d = [0]*m
for i in range(1, n):
for j in range(m):
if g[i][j] == 'R':
if j + i < m:
d[j+i] += 1
elif g[i][j] == 'L':
if j - i >= 0:
d[j-i] += 1
elif g[i][j] == 'U':
if i % 2 == 0:
d[j] += 1
print(' '.join(map(str, d)))
|
Title: Om Nom and Spiders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Om Nom really likes candies and doesn't like spiders as they frequently steal candies. One day Om Nom fancied a walk in a park. Unfortunately, the park has some spiders and Om Nom doesn't want to see them at all.
The park can be represented as a rectangular *n*<=Γ<=*m* field. The park has *k* spiders, each spider at time 0 is at some cell of the field. The spiders move all the time, and each spider always moves in one of the four directions (left, right, down, up). In a unit of time, a spider crawls from his cell to the side-adjacent cell in the corresponding direction. If there is no cell in the given direction, then the spider leaves the park. The spiders do not interfere with each other as they move. Specifically, one cell can have multiple spiders at the same time.
Om Nom isn't yet sure where to start his walk from but he definitely wants:
- to start walking at time 0 at an upper row cell of the field (it is guaranteed that the cells in this row do not contain any spiders); - to walk by moving down the field towards the lowest row (the walk ends when Om Nom leaves the boundaries of the park).
We know that Om Nom moves by jumping. One jump takes one time unit and transports the little monster from his cell to either a side-adjacent cell on the lower row or outside the park boundaries.
Each time Om Nom lands in a cell he sees all the spiders that have come to that cell at this moment of time. Om Nom wants to choose the optimal cell to start the walk from. That's why he wonders: for each possible starting cell, how many spiders will he see during the walk if he starts from this cell? Help him and calculate the required value for each possible starting cell.
Input Specification:
The first line contains three integers *n*,<=*m*,<=*k* (2<=β€<=*n*,<=*m*<=β€<=2000;Β 0<=β€<=*k*<=β€<=*m*(*n*<=-<=1)).
Each of the next *n* lines contains *m* characters β the description of the park. The characters in the *i*-th line describe the *i*-th row of the park field. If the character in the line equals ".", that means that the corresponding cell of the field is empty; otherwise, the character in the line will equal one of the four characters: "L" (meaning that this cell has a spider at time 0, moving left), "R" (a spider moving right), "U" (a spider moving up), "D" (a spider moving down).
It is guaranteed that the first row doesn't contain any spiders. It is guaranteed that the description of the field contains no extra characters. It is guaranteed that at time 0 the field contains exactly *k* spiders.
Output Specification:
Print *m* integers: the *j*-th integer must show the number of spiders Om Nom will see if he starts his walk from the *j*-th cell of the first row. The cells in any row of the field are numbered from left to right.
Demo Input:
['3 3 4\n...\nR.L\nR.U\n', '2 2 2\n..\nRL\n', '2 2 2\n..\nLR\n', '3 4 8\n....\nRRLL\nUUUU\n', '2 2 2\n..\nUU\n']
Demo Output:
['0 2 2 ', '1 1 ', '0 0 ', '1 3 3 1 ', '0 0 ']
Note:
Consider the first sample. The notes below show how the spider arrangement changes on the field over time:
Character "*" represents a cell that contains two spiders at the same time.
- If Om Nom starts from the first cell of the first row, he won't see any spiders. - If he starts from the second cell, he will see two spiders at time 1. - If he starts from the third cell, he will see two spiders: one at time 1, the other one at time 2.
|
```python
import sys
input = sys.stdin.readline
n, m, k = map(int, input().split())
g = [input()[:-1] for _ in range(n)]
d = [0]*m
for i in range(1, n):
for j in range(m):
if g[i][j] == 'R':
if j + i < m:
d[j+i] += 1
elif g[i][j] == 'L':
if j - i >= 0:
d[j-i] += 1
elif g[i][j] == 'U':
if i % 2 == 0:
d[j] += 1
print(' '.join(map(str, d)))
```
| 3
|
|
26
|
A
|
Almost Prime
|
PROGRAMMING
| 900
|
[
"number theory"
] |
A. Almost Prime
|
2
|
256
|
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
|
Input contains one integer number *n* (1<=β€<=*n*<=β€<=3000).
|
Output the amount of almost prime numbers between 1 and *n*, inclusive.
|
[
"10\n",
"21\n"
] |
[
"2\n",
"8\n"
] |
none
| 500
|
[
{
"input": "10",
"output": "2"
},
{
"input": "21",
"output": "8"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "19",
"output": "6"
},
{
"input": "40",
"output": "19"
},
{
"input": "77",
"output": "41"
},
{
"input": "222",
"output": "125"
},
{
"input": "987",
"output": "501"
},
{
"input": "1000",
"output": "508"
},
{
"input": "2000",
"output": "958"
},
{
"input": "3000",
"output": "1375"
},
{
"input": "2999",
"output": "1375"
},
{
"input": "2998",
"output": "1375"
},
{
"input": "2997",
"output": "1374"
},
{
"input": "1429",
"output": "706"
},
{
"input": "1673",
"output": "808"
},
{
"input": "1500",
"output": "732"
},
{
"input": "500",
"output": "266"
},
{
"input": "856",
"output": "439"
}
] | 1,680,276,075
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 23
| 186
| 3,174,400
|
def count_primes(num):
#does not consider num as a prime number
count = 0
for divisor in range(2, int(num**0.5)+1):
if num % divisor == 0: count += 1
while num % divisor == 0:
num /= divisor
if num > 1: count += 1 #num itself is prime
return count
def count_almost_primes(num):
count = 0
for num in range(1, num+1):
if count_primes(num) == 2: count += 1
return count
def main():
num = int(input())
print(count_almost_primes(num))
main()
|
Title: Almost Prime
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input Specification:
Input contains one integer number *n* (1<=β€<=*n*<=β€<=3000).
Output Specification:
Output the amount of almost prime numbers between 1 and *n*, inclusive.
Demo Input:
['10\n', '21\n']
Demo Output:
['2\n', '8\n']
Note:
none
|
```python
def count_primes(num):
#does not consider num as a prime number
count = 0
for divisor in range(2, int(num**0.5)+1):
if num % divisor == 0: count += 1
while num % divisor == 0:
num /= divisor
if num > 1: count += 1 #num itself is prime
return count
def count_almost_primes(num):
count = 0
for num in range(1, num+1):
if count_primes(num) == 2: count += 1
return count
def main():
num = int(input())
print(count_almost_primes(num))
main()
```
| 3.947587
|
492
|
C
|
Vanya and Exams
|
PROGRAMMING
| 1,400
|
[
"greedy",
"sortings"
] | null | null |
Vanya wants to pass *n* exams and get the academic scholarship. He will get the scholarship if the average grade mark for all the exams is at least *avg*. The exam grade cannot exceed *r*. Vanya has passed the exams and got grade *a**i* for the *i*-th exam. To increase the grade for the *i*-th exam by 1 point, Vanya must write *b**i* essays. He can raise the exam grade multiple times.
What is the minimum number of essays that Vanya needs to write to get scholarship?
|
The first line contains three integers *n*, *r*, *avg* (1<=β€<=*n*<=β€<=105, 1<=β€<=*r*<=β€<=109, 1<=β€<=*avg*<=β€<=*min*(*r*,<=106))Β β the number of exams, the maximum grade and the required grade point average, respectively.
Each of the following *n* lines contains space-separated integers *a**i* and *b**i* (1<=β€<=*a**i*<=β€<=*r*, 1<=β€<=*b**i*<=β€<=106).
|
In the first line print the minimum number of essays.
|
[
"5 5 4\n5 2\n4 7\n3 1\n3 2\n2 5\n",
"2 5 4\n5 2\n5 2\n"
] |
[
"4\n",
"0\n"
] |
In the first sample Vanya can write 2 essays for the 3rd exam to raise his grade by 2 points and 2 essays for the 4th exam to raise his grade by 1 point.
In the second sample, Vanya doesn't need to write any essays as his general point average already is above average.
| 1,500
|
[
{
"input": "5 5 4\n5 2\n4 7\n3 1\n3 2\n2 5",
"output": "4"
},
{
"input": "2 5 4\n5 2\n5 2",
"output": "0"
},
{
"input": "6 5 5\n1 7\n2 4\n3 5\n4 6\n5 6\n4 7",
"output": "63"
},
{
"input": "1 1000000000 1000000\n1 1000000",
"output": "999999000000"
},
{
"input": "10 10 7\n1 10\n2 9\n3 8\n4 7\n5 6\n6 5\n7 4\n8 3\n9 2\n10 1",
"output": "70"
},
{
"input": "3 5 2\n1 10\n1 7\n1 4",
"output": "12"
},
{
"input": "10 10 10\n9 8\n3 9\n3 6\n10 5\n5 5\n6 10\n10 3\n6 7\n2 3\n9 8",
"output": "238"
},
{
"input": "1 1 1\n1 1",
"output": "0"
},
{
"input": "1 100 10\n8 27",
"output": "54"
},
{
"input": "2 1000000000 1000000\n1000000 5\n999998 7",
"output": "10"
},
{
"input": "10 10 6\n1 10\n2 9\n3 8\n4 7\n5 6\n6 5\n7 4\n8 3\n9 2\n10 1",
"output": "16"
},
{
"input": "1 2 1\n2 2",
"output": "0"
},
{
"input": "9 846678 205000\n102282 593538\n246630 24854\n545346 409737\n334264 443193\n37717 191227\n154582 913095\n97105 345066\n65504 578960\n163348 394257",
"output": "2441209588"
},
{
"input": "2 100000 100000\n1 1000000\n1 1000000",
"output": "199998000000"
},
{
"input": "2 1000000 1000000\n1 1000000\n1 1000000",
"output": "1999998000000"
}
] | 1,694,713,457
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 39
| 702
| 14,643,200
|
def solve(a, b, r, avg):
diff = max(0, len(a) * avg - sum(a))
sorted_indices = sorted(range(len(a)), key=lambda i: b[i])
result = 0
index = 0
while diff != 0:
raise_num = min(diff, r - a[sorted_indices[index]])
result += raise_num * b[sorted_indices[index]]
diff -= raise_num
index += 1
return result
def main():
n, r, avg = map(int, input().split())
a = []
b = []
for i in range(n):
ai, bi = map(int, input().split())
a.append(ai)
b.append(bi)
print(solve(a, b, r, avg))
if __name__ == "__main__":
main()
|
Title: Vanya and Exams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya wants to pass *n* exams and get the academic scholarship. He will get the scholarship if the average grade mark for all the exams is at least *avg*. The exam grade cannot exceed *r*. Vanya has passed the exams and got grade *a**i* for the *i*-th exam. To increase the grade for the *i*-th exam by 1 point, Vanya must write *b**i* essays. He can raise the exam grade multiple times.
What is the minimum number of essays that Vanya needs to write to get scholarship?
Input Specification:
The first line contains three integers *n*, *r*, *avg* (1<=β€<=*n*<=β€<=105, 1<=β€<=*r*<=β€<=109, 1<=β€<=*avg*<=β€<=*min*(*r*,<=106))Β β the number of exams, the maximum grade and the required grade point average, respectively.
Each of the following *n* lines contains space-separated integers *a**i* and *b**i* (1<=β€<=*a**i*<=β€<=*r*, 1<=β€<=*b**i*<=β€<=106).
Output Specification:
In the first line print the minimum number of essays.
Demo Input:
['5 5 4\n5 2\n4 7\n3 1\n3 2\n2 5\n', '2 5 4\n5 2\n5 2\n']
Demo Output:
['4\n', '0\n']
Note:
In the first sample Vanya can write 2 essays for the 3rd exam to raise his grade by 2 points and 2 essays for the 4th exam to raise his grade by 1 point.
In the second sample, Vanya doesn't need to write any essays as his general point average already is above average.
|
```python
def solve(a, b, r, avg):
diff = max(0, len(a) * avg - sum(a))
sorted_indices = sorted(range(len(a)), key=lambda i: b[i])
result = 0
index = 0
while diff != 0:
raise_num = min(diff, r - a[sorted_indices[index]])
result += raise_num * b[sorted_indices[index]]
diff -= raise_num
index += 1
return result
def main():
n, r, avg = map(int, input().split())
a = []
b = []
for i in range(n):
ai, bi = map(int, input().split())
a.append(ai)
b.append(bi)
print(solve(a, b, r, avg))
if __name__ == "__main__":
main()
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championshipβs finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100) β the number of lines in the description. Then follow *n* lines β for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,610,574,421
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 218
| 0
|
n = int(input())
freq = {}
for _ in range(n):
s = input()
freq[s] = freq.get(s, 0) + 1
keys = list(freq.keys())
if len(keys) == 1:
print(keys[0])
else:
if freq[keys[0]] < freq[keys[1]]:
print(keys[1])
else:
print(keys[0])
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championshipβs finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100) β the number of lines in the description. Then follow *n* lines β for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input())
freq = {}
for _ in range(n):
s = input()
freq[s] = freq.get(s, 0) + 1
keys = list(freq.keys())
if len(keys) == 1:
print(keys[0])
else:
if freq[keys[0]] < freq[keys[1]]:
print(keys[1])
else:
print(keys[0])
```
| 3.9455
|
740
|
A
|
Alyona and copybooks
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation"
] | null | null |
Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase.
|
The only line contains 4 integers *n*, *a*, *b*, *c* (1<=β€<=*n*,<=*a*,<=*b*,<=*c*<=β€<=109).
|
Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4.
|
[
"1 1 3 4\n",
"6 2 1 1\n",
"4 4 4 4\n",
"999999999 1000000000 1000000000 1000000000\n"
] |
[
"3\n",
"1\n",
"0\n",
"1000000000\n"
] |
In the first example Alyona can buy 3 packs of 1 copybook for 3*a*β=β3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b*β=β1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook.
| 500
|
[
{
"input": "1 1 3 4",
"output": "3"
},
{
"input": "6 2 1 1",
"output": "1"
},
{
"input": "4 4 4 4",
"output": "0"
},
{
"input": "999999999 1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1016 3 2 1",
"output": "0"
},
{
"input": "17 100 100 1",
"output": "1"
},
{
"input": "17 2 3 100",
"output": "5"
},
{
"input": "18 1 3 3",
"output": "2"
},
{
"input": "19 1 1 1",
"output": "1"
},
{
"input": "999999997 999999990 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "999999998 1000000000 999999990 1000000000",
"output": "999999990"
},
{
"input": "634074578 336470888 481199252 167959139",
"output": "335918278"
},
{
"input": "999999999 1000000000 1000000000 999999990",
"output": "1000000000"
},
{
"input": "804928248 75475634 54748096 641009859",
"output": "0"
},
{
"input": "535590429 374288891 923264237 524125987",
"output": "524125987"
},
{
"input": "561219907 673102149 496813081 702209411",
"output": "673102149"
},
{
"input": "291882089 412106895 365329221 585325539",
"output": "585325539"
},
{
"input": "757703054 5887448 643910770 58376259",
"output": "11774896"
},
{
"input": "783332532 449924898 72235422 941492387",
"output": "0"
},
{
"input": "513994713 43705451 940751563 824608515",
"output": "131116353"
},
{
"input": "539624191 782710197 514300407 2691939",
"output": "8075817"
},
{
"input": "983359971 640274071 598196518 802030518",
"output": "640274071"
},
{
"input": "8989449 379278816 26521171 685146646",
"output": "405799987"
},
{
"input": "34618927 678092074 895037311 863230070",
"output": "678092074"
},
{
"input": "205472596 417096820 468586155 41313494",
"output": "0"
},
{
"input": "19 5 1 2",
"output": "3"
},
{
"input": "17 1 2 2",
"output": "2"
},
{
"input": "18 3 3 1",
"output": "2"
},
{
"input": "19 4 3 1",
"output": "3"
},
{
"input": "936134778 715910077 747167704 219396918",
"output": "438793836"
},
{
"input": "961764255 454914823 615683844 102513046",
"output": "307539138"
},
{
"input": "692426437 48695377 189232688 985629174",
"output": "146086131"
},
{
"input": "863280107 347508634 912524637 458679894",
"output": "347508634"
},
{
"input": "593942288 86513380 486073481 341796022",
"output": "0"
},
{
"input": "914539062 680293934 764655030 519879446",
"output": "764655030"
},
{
"input": "552472140 509061481 586588704 452405440",
"output": "0"
},
{
"input": "723325809 807874739 160137548 335521569",
"output": "335521569"
},
{
"input": "748955287 546879484 733686393 808572289",
"output": "546879484"
},
{
"input": "774584765 845692742 162011045 691688417",
"output": "691688417"
},
{
"input": "505246946 439473295 30527185 869771841",
"output": "30527185"
},
{
"input": "676100616 178478041 604076030 752887969",
"output": "0"
},
{
"input": "701730093 477291299 177624874 930971393",
"output": "654916173"
},
{
"input": "432392275 216296044 751173719 109054817",
"output": "216296044"
},
{
"input": "458021753 810076598 324722563 992170945",
"output": "992170945"
},
{
"input": "188683934 254114048 48014511 170254369",
"output": "48014511"
},
{
"input": "561775796 937657403 280013594 248004555",
"output": "0"
},
{
"input": "1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "3 10000 10000 3",
"output": "9"
},
{
"input": "3 12 3 4",
"output": "7"
},
{
"input": "3 10000 10000 1",
"output": "3"
},
{
"input": "3 1000 1000 1",
"output": "3"
},
{
"input": "3 10 10 1",
"output": "3"
},
{
"input": "3 100 100 1",
"output": "3"
},
{
"input": "3 100000 10000 1",
"output": "3"
},
{
"input": "7 10 2 3",
"output": "5"
},
{
"input": "3 1000 1000 2",
"output": "6"
},
{
"input": "1 100000 1 100000",
"output": "100000"
},
{
"input": "7 4 3 1",
"output": "3"
},
{
"input": "3 1000 1000 3",
"output": "9"
},
{
"input": "3 1000 1 1",
"output": "2"
},
{
"input": "3 10 1 1",
"output": "2"
},
{
"input": "3 100000 1 1",
"output": "2"
},
{
"input": "3 100 1 1",
"output": "2"
},
{
"input": "3 100000 100000 1",
"output": "3"
},
{
"input": "3 1000 1 100",
"output": "101"
},
{
"input": "3 1000000000 1 1000000000",
"output": "1000000000"
},
{
"input": "3 1000 1 10",
"output": "11"
},
{
"input": "3 200 1 100",
"output": "101"
},
{
"input": "7 4 1 1",
"output": "2"
},
{
"input": "7 4 12 1",
"output": "3"
},
{
"input": "3 9 1 1",
"output": "2"
},
{
"input": "3 10000000 1000000 1",
"output": "3"
},
{
"input": "7 1000 1000 1",
"output": "3"
},
{
"input": "3 10000 1 30",
"output": "31"
},
{
"input": "3 1000 1 2",
"output": "3"
},
{
"input": "7 12 6 1",
"output": "3"
},
{
"input": "3 100000 1 1000",
"output": "1001"
},
{
"input": "7 1000 1000 3",
"output": "9"
},
{
"input": "3 4 3 1",
"output": "3"
},
{
"input": "3 3000000 1 100000",
"output": "100001"
},
{
"input": "3 3 1 1",
"output": "2"
},
{
"input": "3 10 1 5",
"output": "6"
},
{
"input": "3 2000 2000 1",
"output": "3"
},
{
"input": "3 10000000 10000000 1",
"output": "3"
},
{
"input": "3 5 1 1",
"output": "2"
},
{
"input": "3 100 1 33",
"output": "34"
},
{
"input": "7 9 2 7",
"output": "9"
},
{
"input": "4448 2 3 6",
"output": "0"
},
{
"input": "2228 1 6 3",
"output": "0"
}
] | 1,480,249,146
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 89
| 77
| 0
|
n, a, b, c = map(int, input().split())
to_buy = (4 - (n % 4)) % 4
b = min(a * 2, b)
c = min(a * 3, a + b, c)
# possibilities:
if to_buy == 3:
print(min(3*a, a+b, c))
elif to_buy == 2:
print(min(2*a, b, 2*c))
elif to_buy == 1:
print(min(a, b+c, 3*c))
else:
print(0)
|
Title: Alyona and copybooks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase.
Input Specification:
The only line contains 4 integers *n*, *a*, *b*, *c* (1<=β€<=*n*,<=*a*,<=*b*,<=*c*<=β€<=109).
Output Specification:
Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4.
Demo Input:
['1 1 3 4\n', '6 2 1 1\n', '4 4 4 4\n', '999999999 1000000000 1000000000 1000000000\n']
Demo Output:
['3\n', '1\n', '0\n', '1000000000\n']
Note:
In the first example Alyona can buy 3 packs of 1 copybook for 3*a*β=β3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b*β=β1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook.
|
```python
n, a, b, c = map(int, input().split())
to_buy = (4 - (n % 4)) % 4
b = min(a * 2, b)
c = min(a * 3, a + b, c)
# possibilities:
if to_buy == 3:
print(min(3*a, a+b, c))
elif to_buy == 2:
print(min(2*a, b, 2*c))
elif to_buy == 1:
print(min(a, b+c, 3*c))
else:
print(0)
```
| 3
|
|
673
|
A
|
Bear and Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
|
The first line of the input contains one integer *n* (1<=β€<=*n*<=β€<=90)Β β the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=β€<=*t*1<=<<=*t*2<=<<=... *t**n*<=β€<=90), given in the increasing order.
|
Print the number of minutes Limak will watch the game.
|
[
"3\n7 20 88\n",
"9\n16 20 30 40 50 60 70 80 90\n",
"9\n15 20 30 40 50 60 70 80 90\n"
] |
[
"35\n",
"15\n",
"90\n"
] |
In the first sample, minutes 21,β22,β...,β35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
| 500
|
[
{
"input": "3\n7 20 88",
"output": "35"
},
{
"input": "9\n16 20 30 40 50 60 70 80 90",
"output": "15"
},
{
"input": "9\n15 20 30 40 50 60 70 80 90",
"output": "90"
},
{
"input": "30\n6 11 12 15 22 24 30 31 32 33 34 35 40 42 44 45 47 50 53 54 57 58 63 67 75 77 79 81 83 88",
"output": "90"
},
{
"input": "60\n1 2 4 5 6 7 11 14 16 18 20 21 22 23 24 25 26 33 34 35 36 37 38 39 41 42 43 44 46 47 48 49 52 55 56 57 58 59 60 61 63 64 65 67 68 70 71 72 73 74 75 77 78 80 82 83 84 85 86 88",
"output": "90"
},
{
"input": "90\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n1",
"output": "16"
},
{
"input": "5\n15 30 45 60 75",
"output": "90"
},
{
"input": "6\n14 29 43 59 70 74",
"output": "58"
},
{
"input": "1\n15",
"output": "30"
},
{
"input": "1\n16",
"output": "15"
},
{
"input": "14\n14 22 27 31 35 44 46 61 62 69 74 79 88 89",
"output": "90"
},
{
"input": "76\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n90",
"output": "15"
},
{
"input": "6\n13 17 32 47 60 66",
"output": "81"
},
{
"input": "84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84",
"output": "90"
},
{
"input": "9\n6 20 27 28 40 53 59 70 85",
"output": "90"
},
{
"input": "12\n14 22 27 31 35 44 62 69 74 79 88 89",
"output": "59"
},
{
"input": "5\n15 30 45 60 74",
"output": "89"
},
{
"input": "72\n3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89",
"output": "54"
},
{
"input": "8\n1 16 30 31 32 33 34 50",
"output": "49"
},
{
"input": "12\n1 3 6 10 15 21 28 36 45 55 66 78",
"output": "90"
},
{
"input": "25\n1 2 3 4 5 6 7 8 9 10 11 23 36 50 65 81 82 83 84 85 86 87 88 89 90",
"output": "80"
},
{
"input": "8\n5 17 20 35 42 53 67 76",
"output": "90"
},
{
"input": "9\n15 28 39 48 55 60 63 64 74",
"output": "89"
},
{
"input": "10\n15 28 39 48 55 60 63 64 74 82",
"output": "90"
},
{
"input": "2\n1 18",
"output": "16"
},
{
"input": "9\n10 20 30 40 50 60 70 80 84",
"output": "90"
},
{
"input": "2\n16 50",
"output": "15"
},
{
"input": "6\n15 30 45 60 75 84",
"output": "90"
},
{
"input": "8\n15 20 30 40 50 60 73 83",
"output": "90"
},
{
"input": "8\n10 20 30 40 50 60 70 80",
"output": "90"
},
{
"input": "3\n1 20 90",
"output": "16"
},
{
"input": "6\n15 30 45 60 74 89",
"output": "90"
}
] | 1,472,091,580
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 62
| 4,608,000
|
n=int(input())
tl = list(map(int, input().split()))
time=cnt=0
while cnt <15 and time<90:
time+=1
if tl.count(time)>0:
cnt=0
else:
cnt+=1
print(time)
|
Title: Bear and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
Input Specification:
The first line of the input contains one integer *n* (1<=β€<=*n*<=β€<=90)Β β the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=β€<=*t*1<=<<=*t*2<=<<=... *t**n*<=β€<=90), given in the increasing order.
Output Specification:
Print the number of minutes Limak will watch the game.
Demo Input:
['3\n7 20 88\n', '9\n16 20 30 40 50 60 70 80 90\n', '9\n15 20 30 40 50 60 70 80 90\n']
Demo Output:
['35\n', '15\n', '90\n']
Note:
In the first sample, minutes 21,β22,β...,β35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
|
```python
n=int(input())
tl = list(map(int, input().split()))
time=cnt=0
while cnt <15 and time<90:
time+=1
if tl.count(time)>0:
cnt=0
else:
cnt+=1
print(time)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
|
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
|
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print Β«-1Β» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=β₯<=0)Β β the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
|
[
"helloworld\nehoolwlroz\n",
"hastalavistababy\nhastalavistababy\n",
"merrychristmas\nchristmasmerry\n"
] |
[
"3\nh e\nl o\nd z\n",
"0\n",
"-1\n"
] |
none
| 0
|
[
{
"input": "helloworld\nehoolwlroz",
"output": "3\nh e\nl o\nd z"
},
{
"input": "hastalavistababy\nhastalavistababy",
"output": "0"
},
{
"input": "merrychristmas\nchristmasmerry",
"output": "-1"
},
{
"input": "kusyvdgccw\nkusyvdgccw",
"output": "0"
},
{
"input": "bbbbbabbab\naaaaabaaba",
"output": "1\nb a"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx",
"output": "-1"
},
{
"input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc",
"output": "1\nd b"
},
{
"input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd",
"output": "0"
},
{
"input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak",
"output": "5\ng f\nn i\nd h\ne o\nb k"
},
{
"input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc",
"output": "0"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "zz\nzy",
"output": "-1"
},
{
"input": "as\ndf",
"output": "2\na d\ns f"
},
{
"input": "abc\nbca",
"output": "-1"
},
{
"input": "rtfg\nrftg",
"output": "1\nt f"
},
{
"input": "y\ny",
"output": "0"
},
{
"input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm",
"output": "-1"
},
{
"input": "aaaaaa\nabcdef",
"output": "-1"
},
{
"input": "qwerty\nffffff",
"output": "-1"
},
{
"input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh",
"output": "0"
},
{
"input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe",
"output": "-1"
},
{
"input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba",
"output": "0"
},
{
"input": "dbadbddddb\nacbacaaaac",
"output": "-1"
},
{
"input": "dacbdbbbdd\nadbdadddaa",
"output": "-1"
},
{
"input": "bbbbcbcbbc\ndaddbabddb",
"output": "-1"
},
{
"input": "dddddbcdbd\nbcbbbdacdb",
"output": "-1"
},
{
"input": "cbadcbcdaa\nabbbababbb",
"output": "-1"
},
{
"input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk",
"output": "-1"
},
{
"input": "acbbccabaa\nabbbbbabaa",
"output": "-1"
},
{
"input": "ccccaccccc\naaaabaaaac",
"output": "-1"
},
{
"input": "acbacacbbb\nacbacacbbb",
"output": "0"
},
{
"input": "abbababbcc\nccccccccbb",
"output": "-1"
},
{
"input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh",
"output": "-1"
},
{
"input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage",
"output": "-1"
},
{
"input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai",
"output": "-1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "z\na",
"output": "1\nz a"
},
{
"input": "aa\nzz",
"output": "1\na z"
},
{
"input": "az\nza",
"output": "1\na z"
},
{
"input": "aa\nza",
"output": "-1"
},
{
"input": "za\nzz",
"output": "-1"
},
{
"input": "aa\nab",
"output": "-1"
},
{
"input": "hehe\nheeh",
"output": "-1"
},
{
"input": "bd\ncc",
"output": "-1"
},
{
"input": "he\nhh",
"output": "-1"
},
{
"input": "hee\nheh",
"output": "-1"
},
{
"input": "aa\nac",
"output": "-1"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "hello\nehlol",
"output": "-1"
},
{
"input": "ac\naa",
"output": "-1"
},
{
"input": "aaabbb\nbbbaab",
"output": "-1"
},
{
"input": "aa\nfa",
"output": "-1"
},
{
"input": "hg\nee",
"output": "-1"
},
{
"input": "helloworld\nehoolwlrow",
"output": "-1"
},
{
"input": "abb\nbab",
"output": "-1"
},
{
"input": "aaa\naae",
"output": "-1"
},
{
"input": "aba\nbaa",
"output": "-1"
},
{
"input": "aa\nba",
"output": "-1"
},
{
"input": "da\naa",
"output": "-1"
},
{
"input": "aaa\naab",
"output": "-1"
},
{
"input": "xy\nzz",
"output": "-1"
}
] | 1,557,816,320
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 86
| 124
| 0
|
s = input()
t = input()
d, u = set(), set()
for i in range(len(s)):
mn, mx = min(s[i], t[i]), max(s[i], t[i])
if (s[i] in u or t[i] in u) and (mn, mx) not in d:
print(-1)
exit()
u.add(s[i])
u.add(t[i])
d.add((mn, mx))
res = [x for x in d if x[0] != x[1]]
print(len(res))
for i in res:
print(*i)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
Input Specification:
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
Output Specification:
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print Β«-1Β» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=β₯<=0)Β β the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
Demo Input:
['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n']
Demo Output:
['3\nh e\nl o\nd z\n', '0\n', '-1\n']
Note:
none
|
```python
s = input()
t = input()
d, u = set(), set()
for i in range(len(s)):
mn, mx = min(s[i], t[i]), max(s[i], t[i])
if (s[i] in u or t[i] in u) and (mn, mx) not in d:
print(-1)
exit()
u.add(s[i])
u.add(t[i])
d.add((mn, mx))
res = [x for x in d if x[0] != x[1]]
print(len(res))
for i in res:
print(*i)
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,481,699,666
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 124
| 0
|
a=int(input())
b=input().split()
s=0
t=0
for i in range(a):
b[i]=int(b[i])%2
for i in range(a):
if b[i]==0:
s=s+1
else:
t=t+1
if s>t:
for i in range(a):
if b[i]==1:
print(i+1)
else:
for i in range(a):
if b[i]==0:
print(i+1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
a=int(input())
b=input().split()
s=0
t=0
for i in range(a):
b[i]=int(b[i])%2
for i in range(a):
if b[i]==0:
s=s+1
else:
t=t+1
if s>t:
for i in range(a):
if b[i]==1:
print(i+1)
else:
for i in range(a):
if b[i]==0:
print(i+1)
```
| 3.969
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave ViΔkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town ViΔkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1Β·2Β·3Β·...Β·(*x*<=-<=1)Β·*x*. For example 4!<==<=1Β·2Β·3Β·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=β€<=*A*,<=*B*<=β€<=109,<=*min*(*A*,<=*B*)<=β€<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4!β=β1Β·2Β·3Β·4β=β24. 3!β=β1Β·2Β·3β=β6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,632,994,508
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 62
| 6,758,400
|
import math
a,b=map(int,input().split())
c=min(a,b)
print(math.factorial(c))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave ViΔkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town ViΔkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1Β·2Β·3Β·...Β·(*x*<=-<=1)Β·*x*. For example 4!<==<=1Β·2Β·3Β·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=β€<=*A*,<=*B*<=β€<=109,<=*min*(*A*,<=*B*)<=β€<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4!β=β1Β·2Β·3Β·4β=β24. 3!β=β1Β·2Β·3β=β6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math
a,b=map(int,input().split())
c=min(a,b)
print(math.factorial(c))
```
| 3
|
|
305
|
B
|
Continued Fractions
|
PROGRAMMING
| 1,700
|
[
"brute force",
"implementation",
"math"
] | null | null |
A continued fraction of height *n* is a fraction of form . You are given two rational numbers, one is represented as and the other one is represented as a finite fraction of height *n*. Check if they are equal.
|
The first line contains two space-separated integers *p*,<=*q* (1<=β€<=*q*<=β€<=*p*<=β€<=1018) β the numerator and the denominator of the first fraction.
The second line contains integer *n* (1<=β€<=*n*<=β€<=90) β the height of the second fraction. The third line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=1018) β the continued fraction.
Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
Print "YES" if these fractions are equal and "NO" otherwise.
|
[
"9 4\n2\n2 4\n",
"9 4\n3\n2 3 1\n",
"9 4\n3\n1 2 4\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5ff92f27aebea2560d99ad61202d20bab5ee5390.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/221368c79c05fc0ecad4e5f7a64f30b832fd99f5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4fb4b411afc0fbad27a1c8fdd08ba88ec3830ef5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 1,000
|
[
{
"input": "9 4\n2\n2 4",
"output": "YES"
},
{
"input": "9 4\n3\n2 3 1",
"output": "YES"
},
{
"input": "9 4\n3\n1 2 4",
"output": "NO"
},
{
"input": "39088169 24157817\n36\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "YES"
},
{
"input": "39088169 24157817\n36\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4",
"output": "NO"
},
{
"input": "61305790721611591 37889062373143906\n80\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4",
"output": "NO"
},
{
"input": "61305790721611591 37889062373143906\n80\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "YES"
},
{
"input": "565049485241691020 228217260073568804\n40\n2 2 9 1 7 1 2 1 2 1 1 1 9 1 2 1 9 1 3 2 3 10 13 2 1 2 7 1 1 2 2 2 1 1 2 1 6 5 3 2",
"output": "YES"
},
{
"input": "2 1\n4\n2 1 1 1",
"output": "NO"
},
{
"input": "4 1\n2\n3 1",
"output": "YES"
},
{
"input": "72723460248141 1597\n1\n45537545554",
"output": "NO"
},
{
"input": "14930352 13\n6\n1148488 1 1 1 1 2",
"output": "YES"
},
{
"input": "86267571272 102334155\n6\n842 1 841 1 842 145",
"output": "NO"
},
{
"input": "72723460248141 121393\n7\n599074578 122 1 122 2 1 2",
"output": "YES"
},
{
"input": "168455988218483660 53310571951833359\n32\n3 6 3 1 14 1 48 1 3 2 1 1 39 2 1 3 13 23 4 1 11 1 1 23 1 3 3 2 1 1 1 3",
"output": "NO"
},
{
"input": "382460255113156464 275525972692563593\n37\n1 2 1 1 2 1 3 4 5 5 1 4 2 1 1 1 4 2 2 1 2 1 1 2 3 3 1 2 2 50 4 1 4 2 5 109 8",
"output": "YES"
},
{
"input": "1000000000000000000 1\n1\n1000000000000000000",
"output": "YES"
},
{
"input": "362912509915545727 266073193475139553\n30\n1 2 1 2 1 25 75 1 14 6 6 9 1 1 1 1 210 2 2 2 5 2 1 3 1 1 13 3 14 3",
"output": "NO"
},
{
"input": "933329105990871495 607249523603826772\n33\n1 1 1 6 3 1 5 24 3 55 1 15 2 2 1 12 2 2 3 109 1 1 4 1 4 1 7 2 4 1 3 3 2",
"output": "YES"
},
{
"input": "790637895857383456 679586240913926415\n40\n1 6 8 2 1 2 1 7 2 4 1 1 1 10 1 10 1 4 1 4 41 1 1 7 1 1 2 1 2 4 1 2 1 63 1 2 1 1 4 3",
"output": "NO"
},
{
"input": "525403371166594848 423455864168639615\n38\n1 4 6 1 1 32 3 1 14 1 3 1 2 4 5 4 1 2 1 5 8 1 3 1 2 1 46 1 1 1 3 1 4 1 11 1 2 4",
"output": "YES"
},
{
"input": "1 1\n1\n1",
"output": "YES"
},
{
"input": "2 1\n2\n1 2",
"output": "NO"
},
{
"input": "531983955813463755 371380136962341468\n38\n1 2 3 4 1 37 1 12 1 3 2 1 6 3 1 7 3 2 8 1 2 1 1 7 1 1 1 7 1 47 2 1 3 1 1 5 1 2",
"output": "YES"
},
{
"input": "32951280099 987\n7\n33385288 1 5 1 5 1 6",
"output": "YES"
},
{
"input": "6557470319842 86267571272\n6\n76 76 76 76 76 76",
"output": "YES"
},
{
"input": "934648630114363087 6565775686518446\n31\n142 2 1 5 2 2 1 1 3 1 2 8 1 3 12 2 1 23 5 1 10 1 863 1 1 1 2 1 14 2 3",
"output": "YES"
},
{
"input": "61305790721611591 37889062373143906\n81\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "4 1\n1\n4",
"output": "YES"
},
{
"input": "500000000000000001 5\n2\n100000000000000000 5",
"output": "YES"
},
{
"input": "1000000000000000000 3\n3\n3 4 5",
"output": "NO"
},
{
"input": "822981258385599125 28316248989464296\n39\n29 15 1 1 1 4 4 4 1 3 1 5 12 1 1 1 1 1 6 5 2 1 11 1 1 26 1 2 2 2 14 1 1 1 3 2 4 1 1",
"output": "NO"
},
{
"input": "823443107025550834 331822464812968648\n42\n2 2 13 14 4 4 1 1 1 1 2 1 1 1 1 113 1 1 8 1 1 1 1 2 2 1 15 1 5 1 1 2 1 1 1 14 4 3 1 5 1 1",
"output": "NO"
},
{
"input": "226137305050296073 27076290603746056\n30\n8 2 1 5 3 67 2 1 6 1 2 1 5 1 11 8 43 2 1 7 1 95 2 3 1 11 5 2 1 1",
"output": "NO"
},
{
"input": "524928871965838747 313083111434773473\n35\n1 1 2 10 1 4 12 3 28 1 23 1 1 1 4 1 4 3 1 3 2 3 1 4 3 1 3 2 3 11 21 1 35 1 1",
"output": "NO"
},
{
"input": "633468529243155234 4\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "742143496299253703 2\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "550736960584023286 3\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "2 1\n10\n99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999",
"output": "NO"
},
{
"input": "262882295792523313 105000000000078855\n1\n105000000000078855",
"output": "NO"
},
{
"input": "990130967049151695 166430169817556175\n1\n564668656008429569",
"output": "NO"
},
{
"input": "9 4\n2\n2 3",
"output": "NO"
},
{
"input": "529824479480396864 4705882352941177\n2\n80000000000000007 80000000000000009",
"output": "NO"
},
{
"input": "985625905209512860 565433601688714177\n10\n6423 24947 27507 13031 16414 29169 901 32592 18763 1656",
"output": "NO"
},
{
"input": "913255926290448385 4400000000\n2\n4400000000 4400000000",
"output": "NO"
},
{
"input": "7 2\n2\n2 1",
"output": "NO"
},
{
"input": "10 3\n1\n3",
"output": "NO"
},
{
"input": "4 2\n1\n2",
"output": "YES"
},
{
"input": "1337 42\n1\n31",
"output": "NO"
}
] | 1,515,788,728
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 216
| 6,860,800
|
from fractions import gcd
p,q=map(int,input().split())
gc=gcd(p,q)
p//=gc
q//=gc
n=int(input())
a=list(map(int,input().split()))
def add(a,b):
res=[]
a[0]*=b[1]
b[0]*=a[1]
temp=b[1]*a[1]
top=a[0]+b[0]
gc=gcd(top,temp)
temp//=gc
top//=gc;
res.append(top)
res.append(temp)
return res
def go(i):
res=[]
if i==n-1:
res.append(a[i])
res.append(1)
return res;
temp=list(go(i+1))
temp=temp[::-1]
ta=[]
ta.append(a[i])
ta.append(1)
temp=add(ta,temp)
return temp
res=go(0)
if(res[0]==p and res[1]==q): print("YES")
else:
print("NO")
|
Title: Continued Fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A continued fraction of height *n* is a fraction of form . You are given two rational numbers, one is represented as and the other one is represented as a finite fraction of height *n*. Check if they are equal.
Input Specification:
The first line contains two space-separated integers *p*,<=*q* (1<=β€<=*q*<=β€<=*p*<=β€<=1018) β the numerator and the denominator of the first fraction.
The second line contains integer *n* (1<=β€<=*n*<=β€<=90) β the height of the second fraction. The third line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=1018) β the continued fraction.
Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print "YES" if these fractions are equal and "NO" otherwise.
Demo Input:
['9 4\n2\n2 4\n', '9 4\n3\n2 3 1\n', '9 4\n3\n1 2 4\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5ff92f27aebea2560d99ad61202d20bab5ee5390.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/221368c79c05fc0ecad4e5f7a64f30b832fd99f5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4fb4b411afc0fbad27a1c8fdd08ba88ec3830ef5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
from fractions import gcd
p,q=map(int,input().split())
gc=gcd(p,q)
p//=gc
q//=gc
n=int(input())
a=list(map(int,input().split()))
def add(a,b):
res=[]
a[0]*=b[1]
b[0]*=a[1]
temp=b[1]*a[1]
top=a[0]+b[0]
gc=gcd(top,temp)
temp//=gc
top//=gc;
res.append(top)
res.append(temp)
return res
def go(i):
res=[]
if i==n-1:
res.append(a[i])
res.append(1)
return res;
temp=list(go(i+1))
temp=temp[::-1]
ta=[]
ta.append(a[i])
ta.append(1)
temp=add(ta,temp)
return temp
res=go(0)
if(res[0]==p and res[1]==q): print("YES")
else:
print("NO")
```
| 3
|
|
665
|
C
|
Simple Strings
|
PROGRAMMING
| 1,300
|
[
"dp",
"greedy",
"strings"
] | null | null |
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
|
The only line contains the string *s* (1<=β€<=|*s*|<=β€<=2Β·105) β the string given to zscoder. The string *s* consists of only lowercase English letters.
|
Print the simple string *s*' β the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
|
[
"aab\n",
"caaab\n",
"zscoder\n"
] |
[
"bab\n",
"cabab\n",
"zscoder\n"
] |
none
| 0
|
[
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,652,869,198
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 139
| 43,520,000
|
s=list(input()+'a')
for i in range(len(s)-2):
if s[i]==s[i+1]:
s[i+1]=list({'a', 'b', 'c'}-{s[i]}-{s[i+2]})[0]
print(''.join(s[:-1]))
|
Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=β€<=|*s*|<=β€<=2Β·105) β the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' β the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none
|
```python
s=list(input()+'a')
for i in range(len(s)-2):
if s[i]==s[i+1]:
s[i+1]=list({'a', 'b', 'c'}-{s[i]}-{s[i+2]})[0]
print(''.join(s[:-1]))
```
| 3
|
|
689
|
A
|
Mike and Cellphone
|
PROGRAMMING
| 1,400
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
While swimming at the beach, Mike has accidentally dropped his cellphone into the water. There was no worry as he bought a cheap replacement phone with an old-fashioned keyboard. The keyboard has only ten digital equal-sized keys, located in the following way:
Together with his old phone, he lost all his contacts and now he can only remember the way his fingers moved when he put some number in. One can formally consider finger movements as a sequence of vectors connecting centers of keys pressed consecutively to put in a number. For example, the finger movements for number "586" are the same as finger movements for number "253":
Mike has already put in a number by his "finger memory" and started calling it, so he is now worrying, can he be sure that he is calling the correct number? In other words, is there any other number, that has the same finger movements?
|
The first line of the input contains the only integer *n* (1<=β€<=*n*<=β€<=9)Β β the number of digits in the phone number that Mike put in.
The second line contains the string consisting of *n* digits (characters from '0' to '9') representing the number that Mike put in.
|
If there is no other phone number with the same finger movements and Mike can be sure he is calling the correct number, print "YES" (without quotes) in the only line.
Otherwise print "NO" (without quotes) in the first line.
|
[
"3\n586\n",
"2\n09\n",
"9\n123456789\n",
"3\n911\n"
] |
[
"NO\n",
"NO\n",
"YES\n",
"YES\n"
] |
You can find the picture clarifying the first sample case in the statement above.
| 500
|
[
{
"input": "3\n586",
"output": "NO"
},
{
"input": "2\n09",
"output": "NO"
},
{
"input": "9\n123456789",
"output": "YES"
},
{
"input": "3\n911",
"output": "YES"
},
{
"input": "3\n089",
"output": "NO"
},
{
"input": "3\n159",
"output": "YES"
},
{
"input": "9\n000000000",
"output": "NO"
},
{
"input": "4\n0874",
"output": "NO"
},
{
"input": "6\n235689",
"output": "NO"
},
{
"input": "2\n10",
"output": "YES"
},
{
"input": "3\n358",
"output": "NO"
},
{
"input": "6\n123456",
"output": "NO"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "4\n0068",
"output": "NO"
},
{
"input": "6\n021149",
"output": "YES"
},
{
"input": "5\n04918",
"output": "YES"
},
{
"input": "2\n05",
"output": "NO"
},
{
"input": "4\n0585",
"output": "NO"
},
{
"input": "4\n0755",
"output": "NO"
},
{
"input": "2\n08",
"output": "NO"
},
{
"input": "4\n0840",
"output": "NO"
},
{
"input": "9\n103481226",
"output": "YES"
},
{
"input": "4\n1468",
"output": "NO"
},
{
"input": "7\n1588216",
"output": "NO"
},
{
"input": "9\n188758557",
"output": "NO"
},
{
"input": "1\n2",
"output": "NO"
},
{
"input": "2\n22",
"output": "NO"
},
{
"input": "8\n23482375",
"output": "YES"
},
{
"input": "9\n246112056",
"output": "YES"
},
{
"input": "9\n256859223",
"output": "NO"
},
{
"input": "6\n287245",
"output": "NO"
},
{
"input": "8\n28959869",
"output": "NO"
},
{
"input": "9\n289887167",
"output": "YES"
},
{
"input": "4\n3418",
"output": "NO"
},
{
"input": "4\n3553",
"output": "NO"
},
{
"input": "2\n38",
"output": "NO"
},
{
"input": "6\n386126",
"output": "NO"
},
{
"input": "6\n392965",
"output": "NO"
},
{
"input": "1\n4",
"output": "NO"
},
{
"input": "6\n423463",
"output": "NO"
},
{
"input": "4\n4256",
"output": "NO"
},
{
"input": "8\n42937903",
"output": "YES"
},
{
"input": "1\n5",
"output": "NO"
},
{
"input": "8\n50725390",
"output": "YES"
},
{
"input": "9\n515821866",
"output": "NO"
},
{
"input": "2\n56",
"output": "NO"
},
{
"input": "2\n57",
"output": "NO"
},
{
"input": "7\n5740799",
"output": "NO"
},
{
"input": "9\n582526521",
"output": "NO"
},
{
"input": "9\n585284126",
"output": "NO"
},
{
"input": "1\n6",
"output": "NO"
},
{
"input": "3\n609",
"output": "NO"
},
{
"input": "2\n63",
"output": "NO"
},
{
"input": "3\n633",
"output": "NO"
},
{
"input": "7\n6668940",
"output": "NO"
},
{
"input": "5\n66883",
"output": "NO"
},
{
"input": "2\n68",
"output": "NO"
},
{
"input": "5\n69873",
"output": "YES"
},
{
"input": "1\n7",
"output": "NO"
},
{
"input": "4\n7191",
"output": "YES"
},
{
"input": "9\n722403540",
"output": "YES"
},
{
"input": "9\n769554547",
"output": "NO"
},
{
"input": "3\n780",
"output": "NO"
},
{
"input": "5\n78248",
"output": "NO"
},
{
"input": "4\n7844",
"output": "NO"
},
{
"input": "4\n7868",
"output": "NO"
},
{
"input": "1\n8",
"output": "NO"
},
{
"input": "6\n817332",
"output": "YES"
},
{
"input": "7\n8465393",
"output": "YES"
},
{
"input": "7\n8526828",
"output": "NO"
},
{
"input": "8\n85812664",
"output": "NO"
},
{
"input": "8\n93008225",
"output": "YES"
},
{
"input": "7\n9454566",
"output": "NO"
},
{
"input": "4\n9625",
"output": "NO"
},
{
"input": "8\n97862407",
"output": "YES"
},
{
"input": "3\n993",
"output": "NO"
},
{
"input": "3\n267",
"output": "YES"
},
{
"input": "3\n249",
"output": "YES"
},
{
"input": "3\n672",
"output": "YES"
},
{
"input": "3\n176",
"output": "YES"
},
{
"input": "3\n123",
"output": "NO"
},
{
"input": "3\n367",
"output": "YES"
},
{
"input": "2\n12",
"output": "NO"
},
{
"input": "4\n2580",
"output": "YES"
},
{
"input": "2\n20",
"output": "YES"
},
{
"input": "3\n492",
"output": "YES"
},
{
"input": "3\n167",
"output": "YES"
},
{
"input": "3\n970",
"output": "NO"
},
{
"input": "3\n460",
"output": "NO"
},
{
"input": "4\n4268",
"output": "NO"
},
{
"input": "4\n9394",
"output": "YES"
},
{
"input": "2\n13",
"output": "NO"
},
{
"input": "3\n729",
"output": "YES"
},
{
"input": "6\n456893",
"output": "YES"
}
] | 1,468,074,376
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 94
| 140
| 0
|
n = input()
s = set(map(int,input()))
if all(map(lambda x: x&s!=set(),({1,4,7,0},{3,6,9,0},{7,0,9},{1,2,3}))):
print("YES")
else:
print("NO")
|
Title: Mike and Cellphone
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While swimming at the beach, Mike has accidentally dropped his cellphone into the water. There was no worry as he bought a cheap replacement phone with an old-fashioned keyboard. The keyboard has only ten digital equal-sized keys, located in the following way:
Together with his old phone, he lost all his contacts and now he can only remember the way his fingers moved when he put some number in. One can formally consider finger movements as a sequence of vectors connecting centers of keys pressed consecutively to put in a number. For example, the finger movements for number "586" are the same as finger movements for number "253":
Mike has already put in a number by his "finger memory" and started calling it, so he is now worrying, can he be sure that he is calling the correct number? In other words, is there any other number, that has the same finger movements?
Input Specification:
The first line of the input contains the only integer *n* (1<=β€<=*n*<=β€<=9)Β β the number of digits in the phone number that Mike put in.
The second line contains the string consisting of *n* digits (characters from '0' to '9') representing the number that Mike put in.
Output Specification:
If there is no other phone number with the same finger movements and Mike can be sure he is calling the correct number, print "YES" (without quotes) in the only line.
Otherwise print "NO" (without quotes) in the first line.
Demo Input:
['3\n586\n', '2\n09\n', '9\n123456789\n', '3\n911\n']
Demo Output:
['NO\n', 'NO\n', 'YES\n', 'YES\n']
Note:
You can find the picture clarifying the first sample case in the statement above.
|
```python
n = input()
s = set(map(int,input()))
if all(map(lambda x: x&s!=set(),({1,4,7,0},{3,6,9,0},{7,0,9},{1,2,3}))):
print("YES")
else:
print("NO")
```
| 3
|
|
255
|
A
|
Greg's Workout
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=25) β the number of times Greg repeats the exercises.
|
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
|
[
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] |
[
"biceps\n",
"back\n",
"chest\n"
] |
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
| 500
|
[
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,650,824,920
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 61
| 92
| 0
|
n=int(input())
a=list(map(int,input().split(" ")))
chest=0
biceps=0
back=0
for i in range(n):
if(i%3==0):
chest+=a[i]
elif(i%3==1):
biceps+=a[i]
elif(i%3==2):
back+=a[i]
if(chest>biceps and chest>back):
print("chest")
elif(biceps>chest and biceps>back):
print("biceps")
else:
if(back>chest and back>biceps):
print("back")
|
Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=25) β the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
|
```python
n=int(input())
a=list(map(int,input().split(" ")))
chest=0
biceps=0
back=0
for i in range(n):
if(i%3==0):
chest+=a[i]
elif(i%3==1):
biceps+=a[i]
elif(i%3==2):
back+=a[i]
if(chest>biceps and chest>back):
print("chest")
elif(biceps>chest and biceps>back):
print("biceps")
else:
if(back>chest and back>biceps):
print("back")
```
| 3
|
|
39
|
F
|
Pacifist frogs
|
PROGRAMMING
| 1,300
|
[
"implementation"
] |
F. Pacifist frogs
|
2
|
64
|
Thumbelina has had an accident. She has found herself on a little island in the middle of a swamp and wants to get to the shore very much.
One can get to the shore only by hills that are situated along a straight line that connects the little island with the shore. Let us assume that the hills are numbered from 1 to *n* and the number of a hill is equal to the distance in meters between it and the island. The distance between the *n*-th hill and the shore is also 1 meter.
Thumbelina is too small to make such jumps. Fortunately, a family of frogs living in the swamp suggests to help her. Each frog agrees to give Thumbelina a ride but Thumbelina should choose only one frog. Each frog has a certain jump length. If Thumbelina agrees to accept help from a frog whose jump length is *d*, the frog will jump from the island on the hill *d*, then β on the hill 2*d*, then 3*d* and so on until they get to the shore (i.e. find itself beyond the hill *n*).
However, there is one more problem: mosquitoes also live in the swamp. At the moment they have a siesta, and they are having a nap on some hills. If the frog jumps on a hill with a mosquito the frog will smash it. The frogs Thumbelina has met are pacifists, so they will find the death of each mosquito very much sad. Help Thumbelina choose a frog that will bring her to the shore and smash as small number of mosquitoes as possible.
|
The first line contains three integers *n*, *m* and *k* (1<=β€<=*n*<=β€<=109, 1<=β€<=*m*,<=*k*<=β€<=100) β the number of hills, frogs and mosquitoes respectively. The second line contains *m* integers *d**i* (1<=β€<=*d**i*<=β€<=109) β the lengths of the frogsβ jumps. The third line contains *k* integers β the numbers of the hills on which each mosquito is sleeping. No more than one mosquito can sleep on each hill. The numbers in the lines are separated by single spaces.
|
In the first line output the number of frogs that smash the minimal number of mosquitoes, in the second line β their numbers in increasing order separated by spaces. The frogs are numbered from 1 to *m* in the order of the jump length given in the input data.
|
[
"5 3 5\n2 3 4\n1 2 3 4 5\n",
"1000000000 2 3\n2 5\n999999995 999999998 999999996\n"
] |
[
"2\n2 3\n",
"1\n2\n"
] |
none
| 0
|
[
{
"input": "5 3 5\n2 3 4\n1 2 3 4 5",
"output": "2\n2 3"
},
{
"input": "1000000000 2 3\n2 5\n999999995 999999998 999999996",
"output": "1\n2"
},
{
"input": "1 1 1\n1\n1",
"output": "1\n1"
},
{
"input": "2 2 1\n2 1\n1",
"output": "1\n1"
},
{
"input": "3 2 2\n2 4\n3 2",
"output": "1\n2"
},
{
"input": "10 3 6\n5 2 8\n5 6 7 8 9 10",
"output": "1\n3"
},
{
"input": "10 10 9\n10 9 8 7 6 5 4 3 2 1\n10 9 8 7 5 4 3 2 1",
"output": "1\n5"
},
{
"input": "20 3 5\n2 3 5\n2 5 6 10 15",
"output": "1\n2"
},
{
"input": "20 4 8\n1 2 3 4\n2 4 6 8 10 12 14 16",
"output": "1\n3"
},
{
"input": "10 5 5\n1 5 3 5 1\n1 6 5 7 2",
"output": "3\n2 3 4"
},
{
"input": "20 10 5\n1 12 6 11 9 21 15 16 8 9\n11 13 15 2 1",
"output": "7\n2 3 5 6 8 9 10"
},
{
"input": "20 10 10\n9 8 21 8 7 2 13 17 20 18\n7 16 20 3 6 1 11 18 15 17",
"output": "2\n3 7"
},
{
"input": "20 10 10\n6 17 14 12 13 15 6 14 16 17\n1 6 16 14 7 8 9 12 10 2",
"output": "4\n2 5 6 10"
},
{
"input": "100 30 30\n25 34 81 32 96 79 36 21 53 15 51 69 78 99 60 2 80 37 61 70 32 31 31 6 7 38 95 70 81 39\n1 50 75 8 90 69 13 57 6 4 60 19 94 52 45 42 95 88 21 22 96 2 56 61 31 78 7 62 68 72",
"output": "11\n3 6 9 11 14 17 18 20 26 28 29"
},
{
"input": "200 35 67\n152 112 102 46 54 189 56 76 10 39 157 6 84 188 122 117 51 163 6 50 195 34 44 178 28 32 100 67 74 48 88 100 91 50 91\n126 68 138 157 92 128 183 36 175 49 168 198 116 20 31 88 61 46 12 179 137 130 185 5 171 96 184 85 37 147 50 75 93 103 160 10 120 140 59 98 131 124 121 190 169 141 165 39 47 28 90 139 148 119 73 6 51 94 21 52 89 35 97 79 3 13 142",
"output": "17\n1 2 3 5 6 8 14 15 16 18 21 24 27 28 32 33 35"
},
{
"input": "200 72 29\n201 145 169 163 32 126 131 71 26 130 2 61 110 17 179 114 79 30 192 91 141 70 101 119 185 66 72 76 164 144 106 162 122 146 119 181 184 61 131 131 140 152 60 65 183 154 32 33 108 77 29 102 67 5 125 26 126 104 20 89 183 21 126 195 198 24 123 173 135 164 141 32\n160 65 136 22 194 110 155 138 92 118 87 40 49 191 190 99 157 3 23 17 34 123 31 81 67 86 196 45 109",
"output": "59\n1 2 3 4 6 7 8 9 10 12 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 46 49 50 52 55 56 57 58 60 61 62 63 64 65 66 68 69 70 71"
},
{
"input": "500 46 46\n363 441 170 289 389 394 488 72 332 285 445 185 221 183 397 175 98 192 202 16 123 436 336 260 212 229 459 473 66 19 445 153 476 234 396 159 289 137 331 18 268 224 71 133 196 7\n454 64 417 129 95 162 496 300 234 359 224 354 334 155 191 82 35 319 244 126 292 108 321 93 77 311 107 487 121 431 235 100 445 68 338 467 133 307 4 220 245 84 468 141 436 363",
"output": "35\n2 3 4 5 6 7 8 9 10 12 13 14 15 16 17 18 19 21 23 24 25 26 27 28 29 32 33 35 36 37 38 39 41 43 45"
},
{
"input": "1000 19 27\n656 162 264 790 579 786 877 998 516 247 650 150 858 281 279 549 354 353 533\n349 411 1 248 22 649 726 382 423 832 172 864 17 658 840 572 564 287 800 919 500 575 461 40 1000 383 624",
"output": "19\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19"
}
] | 1,578,281,796
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 218
| 307,200
|
n, m, k = map(int, input().split())
x, y = n, []
a = map(int, input().split())
b = list(map(int, input().split()))
for i, d in enumerate(a):
c = 0
for t in b:
if 0 == t % d:
c += 1
if c < x:
x = c
y = [i + 1]
elif c == x:
y += i + 1,
print(len(y))
print(' '.join(map(str, y)))
|
Title: Pacifist frogs
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Thumbelina has had an accident. She has found herself on a little island in the middle of a swamp and wants to get to the shore very much.
One can get to the shore only by hills that are situated along a straight line that connects the little island with the shore. Let us assume that the hills are numbered from 1 to *n* and the number of a hill is equal to the distance in meters between it and the island. The distance between the *n*-th hill and the shore is also 1 meter.
Thumbelina is too small to make such jumps. Fortunately, a family of frogs living in the swamp suggests to help her. Each frog agrees to give Thumbelina a ride but Thumbelina should choose only one frog. Each frog has a certain jump length. If Thumbelina agrees to accept help from a frog whose jump length is *d*, the frog will jump from the island on the hill *d*, then β on the hill 2*d*, then 3*d* and so on until they get to the shore (i.e. find itself beyond the hill *n*).
However, there is one more problem: mosquitoes also live in the swamp. At the moment they have a siesta, and they are having a nap on some hills. If the frog jumps on a hill with a mosquito the frog will smash it. The frogs Thumbelina has met are pacifists, so they will find the death of each mosquito very much sad. Help Thumbelina choose a frog that will bring her to the shore and smash as small number of mosquitoes as possible.
Input Specification:
The first line contains three integers *n*, *m* and *k* (1<=β€<=*n*<=β€<=109, 1<=β€<=*m*,<=*k*<=β€<=100) β the number of hills, frogs and mosquitoes respectively. The second line contains *m* integers *d**i* (1<=β€<=*d**i*<=β€<=109) β the lengths of the frogsβ jumps. The third line contains *k* integers β the numbers of the hills on which each mosquito is sleeping. No more than one mosquito can sleep on each hill. The numbers in the lines are separated by single spaces.
Output Specification:
In the first line output the number of frogs that smash the minimal number of mosquitoes, in the second line β their numbers in increasing order separated by spaces. The frogs are numbered from 1 to *m* in the order of the jump length given in the input data.
Demo Input:
['5 3 5\n2 3 4\n1 2 3 4 5\n', '1000000000 2 3\n2 5\n999999995 999999998 999999996\n']
Demo Output:
['2\n2 3\n', '1\n2\n']
Note:
none
|
```python
n, m, k = map(int, input().split())
x, y = n, []
a = map(int, input().split())
b = list(map(int, input().split()))
for i, d in enumerate(a):
c = 0
for t in b:
if 0 == t % d:
c += 1
if c < x:
x = c
y = [i + 1]
elif c == x:
y += i + 1,
print(len(y))
print(' '.join(map(str, y)))
```
| 3.943211
|
612
|
A
|
The Text Splitting
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
|
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=β€<=*p*,<=*q*<=β€<=*n*<=β€<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
|
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* β the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* β from left to right.
If there are several solutions print any of them.
|
[
"5 2 3\nHello\n",
"10 9 5\nCodeforces\n",
"6 4 5\nPrivet\n",
"8 1 1\nabacabac\n"
] |
[
"2\nHe\nllo\n",
"2\nCodef\norces\n",
"-1\n",
"8\na\nb\na\nc\na\nb\na\nc\n"
] |
none
| 0
|
[
{
"input": "5 2 3\nHello",
"output": "2\nHe\nllo"
},
{
"input": "10 9 5\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "6 4 5\nPrivet",
"output": "-1"
},
{
"input": "8 1 1\nabacabac",
"output": "8\na\nb\na\nc\na\nb\na\nc"
},
{
"input": "1 1 1\n1",
"output": "1\n1"
},
{
"input": "10 8 1\nuTl9w4lcdo",
"output": "10\nu\nT\nl\n9\nw\n4\nl\nc\nd\no"
},
{
"input": "20 6 4\nfmFRpk2NrzSvnQC9gB61",
"output": "5\nfmFR\npk2N\nrzSv\nnQC9\ngB61"
},
{
"input": "30 23 6\nWXDjl9kitaDTY673R5xyTlbL9gqeQ6",
"output": "5\nWXDjl9\nkitaDT\nY673R5\nxyTlbL\n9gqeQ6"
},
{
"input": "40 14 3\nSOHBIkWEv7ScrkHgMtFFxP9G7JQLYXFoH1sJDAde",
"output": "6\nSOHBIkWEv7Scrk\nHgMtFFxP9G7JQL\nYXF\noH1\nsJD\nAde"
},
{
"input": "50 16 3\nXCgVJUu4aMQ7HMxZjNxe3XARNiahK303g9y7NV8oN6tWdyXrlu",
"output": "8\nXCgVJUu4aMQ7HMxZ\njNxe3XARNiahK303\ng9y\n7NV\n8oN\n6tW\ndyX\nrlu"
},
{
"input": "60 52 8\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4hCKogONj",
"output": "2\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4\nhCKogONj"
},
{
"input": "70 50 5\n1BH1ECq7hjzooQOZdbiYHTAgATcP5mxI7kLI9rqA9AriWc9kE5KoLa1zmuTDFsd2ClAPPY",
"output": "14\n1BH1E\nCq7hj\nzooQO\nZdbiY\nHTAgA\nTcP5m\nxI7kL\nI9rqA\n9AriW\nc9kE5\nKoLa1\nzmuTD\nFsd2C\nlAPPY"
},
{
"input": "80 51 8\no2mpu1FCofuiLQb472qczCNHfVzz5TfJtVMrzgN3ff7FwlAY0fQ0ROhWmIX2bggodORNA76bHMjA5yyc",
"output": "10\no2mpu1FC\nofuiLQb4\n72qczCNH\nfVzz5TfJ\ntVMrzgN3\nff7FwlAY\n0fQ0ROhW\nmIX2bggo\ndORNA76b\nHMjA5yyc"
},
{
"input": "90 12 7\nclcImtsw176FFOA6OHGFxtEfEyhFh5bH4iktV0Y8onIcn0soTwiiHUFRWC6Ow36tT5bsQjgrVSTcB8fAVoe7dJIWkE",
"output": "10\nclcImtsw176F\nFOA6OHGFxtEf\nEyhFh5bH4ikt\nV0Y8onIcn0so\nTwiiHUF\nRWC6Ow3\n6tT5bsQ\njgrVSTc\nB8fAVoe\n7dJIWkE"
},
{
"input": "100 25 5\n2SRB9mRpXMRND5zQjeRxc4GhUBlEQSmLgnUtB9xTKoC5QM9uptc8dKwB88XRJy02r7edEtN2C6D60EjzK1EHPJcWNj6fbF8kECeB",
"output": "20\n2SRB9\nmRpXM\nRND5z\nQjeRx\nc4GhU\nBlEQS\nmLgnU\ntB9xT\nKoC5Q\nM9upt\nc8dKw\nB88XR\nJy02r\n7edEt\nN2C6D\n60Ejz\nK1EHP\nJcWNj\n6fbF8\nkECeB"
},
{
"input": "100 97 74\nxL8yd8lENYnXZs28xleyci4SxqsjZqkYzkEbQXfLQ4l4gKf9QQ9xjBjeZ0f9xQySf5psDUDkJEtPLsa62n4CLc6lF6E2yEqvt4EJ",
"output": "-1"
},
{
"input": "51 25 11\nwpk5wqrB6d3qE1slUrzJwMFafnnOu8aESlvTEb7Pp42FDG2iGQn",
"output": "-1"
},
{
"input": "70 13 37\nfzL91QIJvNoZRP4A9aNRT2GTksd8jEb1713pnWFaCGKHQ1oYvlTHXIl95lqyZRKJ1UPYvT",
"output": "-1"
},
{
"input": "10 3 1\nXQ2vXLPShy",
"output": "10\nX\nQ\n2\nv\nX\nL\nP\nS\nh\ny"
},
{
"input": "4 2 3\naaaa",
"output": "2\naa\naa"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb"
},
{
"input": "99 2 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 2 3\nhavanahavan",
"output": "4\nha\nvan\naha\nvan"
},
{
"input": "100 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "50\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa"
},
{
"input": "17 3 5\ngopstopmipodoshli",
"output": "5\ngop\nsto\npmi\npod\noshli"
},
{
"input": "5 4 3\nfoyku",
"output": "-1"
},
{
"input": "99 2 2\n123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789",
"output": "-1"
},
{
"input": "99 2 2\nrecursionishellrecursionishellrecursionishellrecursionishellrecursionishellrecursionishelldontuseit",
"output": "-1"
},
{
"input": "11 2 3\nqibwnnvqqgo",
"output": "4\nqi\nbwn\nnvq\nqgo"
},
{
"input": "4 4 3\nhhhh",
"output": "1\nhhhh"
},
{
"input": "99 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "99 2 5\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "21\nhh\nhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh"
},
{
"input": "10 5 9\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "10 5 9\naaaaaaaaaa",
"output": "2\naaaaa\naaaaa"
},
{
"input": "11 3 2\nmlmqpohwtsf",
"output": "5\nmlm\nqp\noh\nwt\nsf"
},
{
"input": "3 3 2\nzyx",
"output": "1\nzyx"
},
{
"input": "100 3 3\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "4 2 3\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "3 2 3\nejt",
"output": "1\nejt"
},
{
"input": "5 2 4\nzyxwv",
"output": "-1"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na"
},
{
"input": "100 5 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa"
},
{
"input": "3 2 2\nzyx",
"output": "-1"
},
{
"input": "99 2 2\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "-1"
},
{
"input": "26 8 9\nabcabcabcabcabcabcabcabcab",
"output": "3\nabcabcab\ncabcabcab\ncabcabcab"
},
{
"input": "6 3 5\naaaaaa",
"output": "2\naaa\naaa"
},
{
"input": "3 2 3\nzyx",
"output": "1\nzyx"
},
{
"input": "5 5 2\naaaaa",
"output": "1\naaaaa"
},
{
"input": "4 3 2\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "5 4 3\nzyxwv",
"output": "-1"
},
{
"input": "95 3 29\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "23\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabcabcabcabcabcabcabcabcabcab"
},
{
"input": "3 2 2\naaa",
"output": "-1"
},
{
"input": "91 62 3\nfjzhkfwzoabaauvbkuzaahkozofaophaafhfpuhobufawkzbavaazwavwppfwapkapaofbfjwaavajojgjguahphofj",
"output": "-1"
},
{
"input": "99 2 2\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc",
"output": "-1"
},
{
"input": "56 13 5\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "8\nabcabcabcabca\nbcabcabcabcab\ncabca\nbcabc\nabcab\ncabca\nbcabc\nabcab"
},
{
"input": "79 7 31\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca",
"output": "-1"
},
{
"input": "92 79 6\nxlvplpckwnhmctoethhslkcyashqtsoeltriddglfwtgkfvkvgytygbcyohrvcxvosdioqvackxiuifmkgdngvbbudcb",
"output": "-1"
},
{
"input": "48 16 13\nibhfinipihcbsqnvtgsbkobepmwymlyfmlfgblvhlfhyojsy",
"output": "3\nibhfinipihcbsqnv\ntgsbkobepmwymlyf\nmlfgblvhlfhyojsy"
},
{
"input": "16 3 7\naaaaaaaaaaaaaaaa",
"output": "4\naaa\naaa\naaa\naaaaaaa"
},
{
"input": "11 10 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 8 8\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 7 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "41 3 4\nabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "11\nabc\nabc\nabc\nabca\nbcab\ncabc\nabca\nbcab\ncabc\nabca\nbcab"
},
{
"input": "11 3 2\naaaaaaaaaaa",
"output": "5\naaa\naa\naa\naa\naa"
},
{
"input": "14 9 4\nabcdefghijklmn",
"output": "-1"
},
{
"input": "9 9 5\n123456789",
"output": "1\n123456789"
},
{
"input": "92 10 41\nmeotryyfneonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlgeftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw",
"output": "3\nmeotryyfne\nonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlg\neftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw"
},
{
"input": "17 16 3\ndxyhgtsxtuyljmclj",
"output": "-1"
},
{
"input": "82 13 30\nfmtwumakkejtolxqxrnydhqoufwtdwldfxcfjrndauqcarhbwmdwxsxfbqjsfspuxobywhcrvlndsdmkqd",
"output": "5\nfmtwumakkejto\nlxqxrnydhqouf\nwtdwldfxcfjrn\ndauqcarhbwmdw\nxsxfbqjsfspuxobywhcrvlndsdmkqd"
},
{
"input": "95 3 3\nihnfqcswushyoirjxlxxnwqtwtaowounkumxukwpacxwatimhhhoggqwkkspcplvyndfukbxickcixidgxkjtnpkoeiwlor",
"output": "-1"
},
{
"input": "7 5 3\nzyxwvut",
"output": "-1"
},
{
"input": "17 16 4\nctvfhkiakagcilrdw",
"output": "-1"
}
] | 1,588,871,796
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 72
| 124
| 6,963,200
|
n, p, q = map(int, input().split())
s = input()
if p > q:
p, q = q, p
for i in range(0, n + 1, q):
if (n - i) % p == 0:
print(i // q + (n - i) // p)
for j in range(0, i, q):
print(s[j:j + q])
for j in range(i, n, p):
print(s[j:j + p])
exit(0)
print(-1)
|
Title: The Text Splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
Input Specification:
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=β€<=*p*,<=*q*<=β€<=*n*<=β€<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
Output Specification:
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* β the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* β from left to right.
If there are several solutions print any of them.
Demo Input:
['5 2 3\nHello\n', '10 9 5\nCodeforces\n', '6 4 5\nPrivet\n', '8 1 1\nabacabac\n']
Demo Output:
['2\nHe\nllo\n', '2\nCodef\norces\n', '-1\n', '8\na\nb\na\nc\na\nb\na\nc\n']
Note:
none
|
```python
n, p, q = map(int, input().split())
s = input()
if p > q:
p, q = q, p
for i in range(0, n + 1, q):
if (n - i) % p == 0:
print(i // q + (n - i) // p)
for j in range(0, i, q):
print(s[j:j + q])
for j in range(i, n, p):
print(s[j:j + p])
exit(0)
print(-1)
```
| 3
|
|
542
|
C
|
Idempotent functions
|
PROGRAMMING
| 2,000
|
[
"constructive algorithms",
"graphs",
"math"
] | null | null |
Some time ago Leonid have known about idempotent functions. Idempotent function defined on a set {1,<=2,<=...,<=*n*} is such function , that for any the formula *g*(*g*(*x*))<==<=*g*(*x*) holds.
Let's denote as *f*(*k*)(*x*) the function *f* applied *k* times to the value *x*. More formally, *f*(1)(*x*)<==<=*f*(*x*), *f*(*k*)(*x*)<==<=*f*(*f*(*k*<=-<=1)(*x*)) for each *k*<=><=1.
You are given some function . Your task is to find minimum positive integer *k* such that function *f*(*k*)(*x*) is idempotent.
|
In the first line of the input there is a single integer *n* (1<=β€<=*n*<=β€<=200) β the size of function *f* domain.
In the second line follow *f*(1),<=*f*(2),<=...,<=*f*(*n*) (1<=β€<=*f*(*i*)<=β€<=*n* for each 1<=β€<=*i*<=β€<=*n*), the values of a function.
|
Output minimum *k* such that function *f*(*k*)(*x*) is idempotent.
|
[
"4\n1 2 2 4\n",
"3\n2 3 3\n",
"3\n2 3 1\n"
] |
[
"1\n",
"2\n",
"3\n"
] |
In the first sample test function *f*(*x*)β=β*f*<sup class="upper-index">(1)</sup>(*x*) is already idempotent since *f*(*f*(1))β=β*f*(1)β=β1, *f*(*f*(2))β=β*f*(2)β=β2, *f*(*f*(3))β=β*f*(3)β=β2, *f*(*f*(4))β=β*f*(4)β=β4.
In the second sample test:
- function *f*(*x*)β=β*f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1))β=β3 but *f*(1)β=β2; - function *f*(*x*)β=β*f*<sup class="upper-index">(2)</sup>(*x*) is idempotent since for any *x* it is true that *f*<sup class="upper-index">(2)</sup>(*x*)β=β3, so it is also true that *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(*x*))β=β3.
In the third sample test:
- function *f*(*x*)β=β*f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1))β=β3 but *f*(1)β=β2; - function *f*(*f*(*x*))β=β*f*<sup class="upper-index">(2)</sup>(*x*) isn't idempotent because *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(1))β=β2 but *f*<sup class="upper-index">(2)</sup>(1)β=β3; - function *f*(*f*(*f*(*x*)))β=β*f*<sup class="upper-index">(3)</sup>(*x*) is idempotent since it is identity function: *f*<sup class="upper-index">(3)</sup>(*x*)β=β*x* for any <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/46a8c73444c646004dfde04451775e7af924d108.png" style="max-width: 100.0%;max-height: 100.0%;"/> meaning that the formula *f*<sup class="upper-index">(3)</sup>(*f*<sup class="upper-index">(3)</sup>(*x*))β=β*f*<sup class="upper-index">(3)</sup>(*x*) also holds.
| 750
|
[
{
"input": "4\n1 2 2 4",
"output": "1"
},
{
"input": "3\n2 3 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "3"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "16\n1 4 13 9 11 16 14 6 5 12 7 8 15 2 3 10",
"output": "105"
},
{
"input": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20",
"output": "1"
},
{
"input": "20\n11 14 2 10 17 5 9 6 18 3 17 7 4 15 17 1 4 14 10 11",
"output": "7"
},
{
"input": "100\n46 7 63 48 75 82 85 90 65 23 36 96 96 29 76 67 26 2 72 76 18 30 48 98 100 61 55 74 18 28 36 89 4 65 94 48 53 19 66 77 91 35 94 97 19 45 82 56 11 23 24 51 62 85 25 11 68 19 57 92 53 31 36 28 70 36 62 78 19 10 12 35 46 74 31 79 15 98 15 80 24 59 98 96 92 1 92 16 13 73 99 100 76 52 52 40 85 54 49 89",
"output": "24"
},
{
"input": "100\n61 41 85 52 22 82 98 25 60 35 67 78 65 69 55 86 34 91 92 36 24 2 26 15 76 99 4 95 79 31 13 16 100 83 21 90 73 32 19 33 77 40 72 62 88 43 84 14 10 9 46 70 23 45 42 96 94 38 97 58 47 93 59 51 57 7 27 74 1 30 64 3 63 49 50 54 5 37 48 11 81 44 12 17 75 71 89 39 56 20 6 8 53 28 80 66 29 87 18 68",
"output": "14549535"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "2\n2 1",
"output": "2"
},
{
"input": "5\n2 1 2 3 4",
"output": "4"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "4\n2 1 2 3",
"output": "2"
},
{
"input": "6\n2 1 2 3 4 5",
"output": "4"
},
{
"input": "4\n2 3 1 1",
"output": "3"
},
{
"input": "5\n2 3 1 1 4",
"output": "3"
},
{
"input": "6\n2 3 1 1 4 5",
"output": "3"
},
{
"input": "7\n2 3 1 1 4 5 6",
"output": "6"
},
{
"input": "8\n2 3 1 1 4 5 6 7",
"output": "6"
},
{
"input": "142\n131 32 130 139 5 11 36 2 39 92 111 91 8 14 65 82 90 72 140 80 26 124 97 15 43 77 58 132 21 68 31 45 6 69 70 79 141 27 125 78 93 88 115 104 17 55 86 28 56 117 121 136 12 59 85 95 74 18 87 22 106 112 60 119 81 66 52 14 25 127 29 103 24 48 126 30 120 107 51 47 133 129 96 138 113 37 64 114 53 73 108 62 1 123 63 57 142 76 16 4 35 54 19 110 42 116 7 10 118 9 71 49 75 23 89 99 3 137 38 98 61 128 102 13 122 33 50 94 100 105 109 134 40 20 135 46 34 41 83 67 44 84",
"output": "137"
},
{
"input": "142\n34 88 88 88 88 88 131 53 88 130 131 88 88 130 88 131 53 130 130 34 88 88 131 130 53 88 88 34 131 130 88 131 130 34 130 53 53 34 53 34 130 34 88 88 130 88 131 130 34 53 88 34 53 88 130 53 34 53 88 131 130 34 88 88 130 88 130 130 131 131 130 53 131 130 131 130 53 34 131 34 88 53 88 53 34 130 88 88 130 53 130 34 131 130 53 131 130 88 130 131 53 130 34 130 88 53 88 88 53 88 34 131 88 131 130 53 130 130 53 130 88 88 131 53 88 53 53 34 53 130 131 130 34 131 34 53 130 88 34 34 53 34",
"output": "1"
},
{
"input": "142\n25 46 7 30 112 34 76 5 130 122 7 132 54 82 139 97 79 112 79 79 112 43 25 50 118 112 87 11 51 30 90 56 119 46 9 81 5 103 78 18 49 37 43 129 124 90 109 6 31 50 90 20 79 99 130 31 131 62 50 84 5 34 6 41 79 112 9 30 141 114 34 11 46 92 97 30 95 112 24 24 74 121 65 31 127 28 140 30 79 90 9 10 56 88 9 65 128 79 56 37 109 37 30 95 37 105 3 102 120 18 28 90 107 29 128 137 59 62 62 77 34 43 26 5 99 97 44 130 115 130 130 47 83 53 77 80 131 79 28 98 10 52",
"output": "8"
},
{
"input": "142\n138 102 2 111 17 64 25 11 3 90 118 120 46 33 131 87 119 9 72 141 62 116 44 136 81 122 93 106 123 62 35 17 98 49 46 124 32 67 93 90 91 99 36 46 138 5 52 73 139 2 11 97 6 9 47 56 134 134 112 90 94 55 97 98 118 37 109 31 132 58 95 98 76 76 63 7 110 28 133 50 46 136 115 57 113 55 4 96 63 66 9 52 107 17 95 78 95 118 69 105 18 10 52 94 29 36 113 86 132 39 77 42 113 116 135 93 136 39 48 119 124 35 10 133 138 45 78 107 132 130 49 28 73 85 135 4 119 38 78 116 108 125",
"output": "20"
},
{
"input": "9\n7 3 8 9 9 3 5 3 2",
"output": "6"
},
{
"input": "5\n2 1 4 5 3",
"output": "6"
},
{
"input": "7\n2 3 4 5 6 7 6",
"output": "6"
},
{
"input": "129\n2 1 4 5 3 7 8 9 10 6 12 13 14 15 16 17 11 19 20 21 22 23 24 25 26 27 28 18 30 31 32 33 34 35 36 37 38 39 40 41 29 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 42 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 59 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 78 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 101",
"output": "6469693230"
},
{
"input": "4\n2 3 4 1",
"output": "4"
}
] | 1,430,670,997
| 2,197
|
Python 3
|
OK
|
TESTS
| 65
| 93
| 0
|
N =int(input())
inp =input().split()
F =[0 for i in range(N)]
for i in range(N): F[i] =int(inp[i])-1
ans_small =[0 for i in range(N+1)]
for i in range(N):
x =i
y =i
for j in range(N):
x =F[x]
y =F[F[y]]
if x == y:
ans_small[j+1] +=1
ans =-1
for i in range(1,N+1):
if ans == -1:
if ans_small[i] == N:
ans =i
#dlhe
pw =[0 for i in range(500)]
for i in range(N):
vis =[False for j in range(N)]
vis[i] =True
x =F[i]
while vis[x] == False:
vis[x] =True
x =F[x]
vis2 =[False for j in range(N)]
vis2[x] =True
x =F[x]
while vis2[x] == False:
vis2[x] =True
x =F[x]
c =0
for j in range(N):
if vis2[j]: c +=1
j =2
while j <= c:
p =0
while c%j == 0:
c //=j
p +=1
pw[j] =max(pw[j],p)
j +=1
if ans == -1:
ans =1
for i in range(1,500):
for j in range(pw[i]):
ans *=i
ans0 =ans
while ans <= N:
ans +=ans0
print(ans)
|
Title: Idempotent functions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some time ago Leonid have known about idempotent functions. Idempotent function defined on a set {1,<=2,<=...,<=*n*} is such function , that for any the formula *g*(*g*(*x*))<==<=*g*(*x*) holds.
Let's denote as *f*(*k*)(*x*) the function *f* applied *k* times to the value *x*. More formally, *f*(1)(*x*)<==<=*f*(*x*), *f*(*k*)(*x*)<==<=*f*(*f*(*k*<=-<=1)(*x*)) for each *k*<=><=1.
You are given some function . Your task is to find minimum positive integer *k* such that function *f*(*k*)(*x*) is idempotent.
Input Specification:
In the first line of the input there is a single integer *n* (1<=β€<=*n*<=β€<=200) β the size of function *f* domain.
In the second line follow *f*(1),<=*f*(2),<=...,<=*f*(*n*) (1<=β€<=*f*(*i*)<=β€<=*n* for each 1<=β€<=*i*<=β€<=*n*), the values of a function.
Output Specification:
Output minimum *k* such that function *f*(*k*)(*x*) is idempotent.
Demo Input:
['4\n1 2 2 4\n', '3\n2 3 3\n', '3\n2 3 1\n']
Demo Output:
['1\n', '2\n', '3\n']
Note:
In the first sample test function *f*(*x*)β=β*f*<sup class="upper-index">(1)</sup>(*x*) is already idempotent since *f*(*f*(1))β=β*f*(1)β=β1, *f*(*f*(2))β=β*f*(2)β=β2, *f*(*f*(3))β=β*f*(3)β=β2, *f*(*f*(4))β=β*f*(4)β=β4.
In the second sample test:
- function *f*(*x*)β=β*f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1))β=β3 but *f*(1)β=β2; - function *f*(*x*)β=β*f*<sup class="upper-index">(2)</sup>(*x*) is idempotent since for any *x* it is true that *f*<sup class="upper-index">(2)</sup>(*x*)β=β3, so it is also true that *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(*x*))β=β3.
In the third sample test:
- function *f*(*x*)β=β*f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1))β=β3 but *f*(1)β=β2; - function *f*(*f*(*x*))β=β*f*<sup class="upper-index">(2)</sup>(*x*) isn't idempotent because *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(1))β=β2 but *f*<sup class="upper-index">(2)</sup>(1)β=β3; - function *f*(*f*(*f*(*x*)))β=β*f*<sup class="upper-index">(3)</sup>(*x*) is idempotent since it is identity function: *f*<sup class="upper-index">(3)</sup>(*x*)β=β*x* for any <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/46a8c73444c646004dfde04451775e7af924d108.png" style="max-width: 100.0%;max-height: 100.0%;"/> meaning that the formula *f*<sup class="upper-index">(3)</sup>(*f*<sup class="upper-index">(3)</sup>(*x*))β=β*f*<sup class="upper-index">(3)</sup>(*x*) also holds.
|
```python
N =int(input())
inp =input().split()
F =[0 for i in range(N)]
for i in range(N): F[i] =int(inp[i])-1
ans_small =[0 for i in range(N+1)]
for i in range(N):
x =i
y =i
for j in range(N):
x =F[x]
y =F[F[y]]
if x == y:
ans_small[j+1] +=1
ans =-1
for i in range(1,N+1):
if ans == -1:
if ans_small[i] == N:
ans =i
#dlhe
pw =[0 for i in range(500)]
for i in range(N):
vis =[False for j in range(N)]
vis[i] =True
x =F[i]
while vis[x] == False:
vis[x] =True
x =F[x]
vis2 =[False for j in range(N)]
vis2[x] =True
x =F[x]
while vis2[x] == False:
vis2[x] =True
x =F[x]
c =0
for j in range(N):
if vis2[j]: c +=1
j =2
while j <= c:
p =0
while c%j == 0:
c //=j
p +=1
pw[j] =max(pw[j],p)
j +=1
if ans == -1:
ans =1
for i in range(1,500):
for j in range(pw[i]):
ans *=i
ans0 =ans
while ans <= N:
ans +=ans0
print(ans)
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=β€<=*x*1,<=*x*2,<=*x*3<=β€<=100)Β β the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integerΒ β the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,673,244,117
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
a = list(map(int, input().split()))
print(max(a)-min(a))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=β€<=*x*1,<=*x*2,<=*x*3<=β€<=100)Β β the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integerΒ β the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
a = list(map(int, input().split()))
print(max(a)-min(a))
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,592,142,233
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 218
| 0
|
s = input()
n = len(s)
lower = 0
upper = 0
for i in s:
if i.islower():
lower+=1
elif i.isupper():
upper+=1
if lower >= upper:
s = s.lower()
else:
s= s.upper()
print(s)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s = input()
n = len(s)
lower = 0
upper = 0
for i in s:
if i.islower():
lower+=1
elif i.isupper():
upper+=1
if lower >= upper:
s = s.lower()
else:
s= s.upper()
print(s)
```
| 3.9455
|
455
|
A
|
Boredom
|
PROGRAMMING
| 1,500
|
[
"dp"
] | null | null |
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=105).
|
Print a single integer β the maximum number of points that Alex can earn.
|
[
"2\n1 2\n",
"3\n1 2 3\n",
"9\n1 2 1 3 2 2 2 2 3\n"
] |
[
"2\n",
"4\n",
"10\n"
] |
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2,β2,β2,β2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
| 500
|
[
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 2 3",
"output": "4"
},
{
"input": "9\n1 2 1 3 2 2 2 2 3",
"output": "10"
},
{
"input": "5\n3 3 4 5 4",
"output": "11"
},
{
"input": "5\n5 3 5 3 4",
"output": "16"
},
{
"input": "5\n4 2 3 2 5",
"output": "9"
},
{
"input": "10\n10 5 8 9 5 6 8 7 2 8",
"output": "46"
},
{
"input": "10\n1 1 1 1 1 1 2 3 4 4",
"output": "14"
},
{
"input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4",
"output": "296"
},
{
"input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2",
"output": "313"
},
{
"input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9",
"output": "298"
},
{
"input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5",
"output": "312"
},
{
"input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2",
"output": "287"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2",
"output": "265"
},
{
"input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9",
"output": "328"
},
{
"input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9",
"output": "324"
},
{
"input": "10\n7 4 5 3 9 1 10 3 4 5",
"output": "34"
},
{
"input": "10\n8 9 6 5 6 4 10 9 1 4",
"output": "39"
},
{
"input": "10\n1 7 1 4 9 10 8 2 9 9",
"output": "40"
},
{
"input": "1\n100000",
"output": "100000"
}
] | 1,669,053,157
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 140
| 7,065,600
|
# -*- coding: utf-8 -*-
"""
Created on Tue Nov 22 01:12:17 2022
@author: thinkpad
"""
n = int(input())
a = [int(i) for i in input().split()]
s = [0]*100002
for i in a:
s[i]+=i
res,b=0,0
for d in s:
res,b = max(res,b),res+d
print(res)
|
Title: Boredom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=105).
Output Specification:
Print a single integer β the maximum number of points that Alex can earn.
Demo Input:
['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n']
Demo Output:
['2\n', '4\n', '10\n']
Note:
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2,β2,β2,β2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
|
```python
# -*- coding: utf-8 -*-
"""
Created on Tue Nov 22 01:12:17 2022
@author: thinkpad
"""
n = int(input())
a = [int(i) for i in input().split()]
s = [0]*100002
for i in a:
s[i]+=i
res,b=0,0
for d in s:
res,b = max(res,b),res+d
print(res)
```
| 3
|
|
637
|
A
|
Voting for Photos
|
PROGRAMMING
| 1,000
|
[
"*special",
"constructive algorithms",
"implementation"
] | null | null |
After celebrating the midcourse the students of one of the faculties of the Berland State University decided to conduct a vote for the best photo. They published the photos in the social network and agreed on the rules to choose a winner: the photo which gets most likes wins. If multiple photoes get most likes, the winner is the photo that gets this number first.
Help guys determine the winner photo by the records of likes.
|
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=1000) β the total likes to the published photoes.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=1<=000<=000), where *a**i* is the identifier of the photo which got the *i*-th like.
|
Print the identifier of the photo which won the elections.
|
[
"5\n1 3 2 2 1\n",
"9\n100 200 300 200 100 300 300 100 200\n"
] |
[
"2\n",
"300\n"
] |
In the first test sample the photo with id 1 got two likes (first and fifth), photo with id 2 got two likes (third and fourth), and photo with id 3 got one like (second).
Thus, the winner is the photo with identifier 2, as it got:
- more likes than the photo with id 3; - as many likes as the photo with id 1, but the photo with the identifier 2 got its second like earlier.
| 500
|
[
{
"input": "5\n1 3 2 2 1",
"output": "2"
},
{
"input": "9\n100 200 300 200 100 300 300 100 200",
"output": "300"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n1000000",
"output": "1000000"
},
{
"input": "5\n1 3 4 2 2",
"output": "2"
},
{
"input": "10\n2 1 2 3 1 5 8 7 4 8",
"output": "2"
},
{
"input": "7\n1 1 2 2 2 3 3",
"output": "2"
},
{
"input": "12\n2 3 1 2 3 3 3 2 1 1 2 1",
"output": "3"
},
{
"input": "15\n7 6 8 4 9 8 7 3 4 6 7 5 4 2 8",
"output": "7"
},
{
"input": "15\n100 200 300 500 300 400 600 300 100 200 400 300 600 200 100",
"output": "300"
},
{
"input": "10\n677171 677171 677171 677171 672280 677171 677171 672280 672280 677171",
"output": "677171"
},
{
"input": "15\n137419 137419 531977 438949 137419 438949 438949 137419 438949 531977 531977 531977 438949 438949 438949",
"output": "438949"
},
{
"input": "20\n474463 517819 640039 640039 640039 640039 474463 474463 474463 640039 640039 474463 474463 425567 474463 517819 640039 474463 517819 517819",
"output": "474463"
},
{
"input": "40\n119631 119631 772776 119631 658661 119631 108862 524470 125132 700668 69196 844949 154577 108862 108862 108862 597344 940938 989698 108862 154577 69196 125132 687080 940938 125132 69196 69196 125132 566152 953083 406319 380068 119631 154577 125132 413984 69196 154577 154577",
"output": "108862"
},
{
"input": "5\n1 1 1000000 1000000 1000000",
"output": "1000000"
},
{
"input": "5\n1000000 1 1 1000000 1",
"output": "1"
},
{
"input": "10\n1 1 1000000 1000000 1000000 1 1000000 1 1 1000000",
"output": "1"
},
{
"input": "8\n1000000 1000000 1 1 1 1000000 1000000 1",
"output": "1000000"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1000000 1",
"output": "1000000"
},
{
"input": "2\n1 1000000",
"output": "1"
},
{
"input": "2\n1000000 1000000",
"output": "1000000"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "4\n1 1000000 1000000 1",
"output": "1000000"
}
] | 1,457,897,193
| 26,793
|
Python 3
|
OK
|
TESTS
| 65
| 77
| 819,200
|
# -*- coding: utf-8 -*-
"""
Created on Sun Mar 13 19:40:03 2016
@author: Kostya S.
"""
from functools import cmp_to_key
n = int(input())
d = {}
a = [int(i) for i in input().split()]
for i,e in enumerate(a):
d[e] = (i+1,1,e) if d.get(e) == None else (i+1,d[e][1] + 1,e)
t1 = sorted(list(d.values()),key = lambda x: x[1])
t2 = list(filter(lambda x: x[1] == t1[-1][1],t1))
t2 = sorted(t2,key = lambda x: x[0])
print(t2[0][-1])
|
Title: Voting for Photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After celebrating the midcourse the students of one of the faculties of the Berland State University decided to conduct a vote for the best photo. They published the photos in the social network and agreed on the rules to choose a winner: the photo which gets most likes wins. If multiple photoes get most likes, the winner is the photo that gets this number first.
Help guys determine the winner photo by the records of likes.
Input Specification:
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=1000) β the total likes to the published photoes.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=1<=000<=000), where *a**i* is the identifier of the photo which got the *i*-th like.
Output Specification:
Print the identifier of the photo which won the elections.
Demo Input:
['5\n1 3 2 2 1\n', '9\n100 200 300 200 100 300 300 100 200\n']
Demo Output:
['2\n', '300\n']
Note:
In the first test sample the photo with id 1 got two likes (first and fifth), photo with id 2 got two likes (third and fourth), and photo with id 3 got one like (second).
Thus, the winner is the photo with identifier 2, as it got:
- more likes than the photo with id 3; - as many likes as the photo with id 1, but the photo with the identifier 2 got its second like earlier.
|
```python
# -*- coding: utf-8 -*-
"""
Created on Sun Mar 13 19:40:03 2016
@author: Kostya S.
"""
from functools import cmp_to_key
n = int(input())
d = {}
a = [int(i) for i in input().split()]
for i,e in enumerate(a):
d[e] = (i+1,1,e) if d.get(e) == None else (i+1,d[e][1] + 1,e)
t1 = sorted(list(d.values()),key = lambda x: x[1])
t2 = list(filter(lambda x: x[1] == t1[-1][1],t1))
t2 = sorted(t2,key = lambda x: x[0])
print(t2[0][-1])
```
| 3
|
|
908
|
A
|
New Year and Counting Cards
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
|
The first and only line of input will contain a string *s* (1<=β€<=|*s*|<=β€<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
|
Print a single integer, the minimum number of cards you must turn over to verify your claim.
|
[
"ee\n",
"z\n",
"0ay1\n"
] |
[
"2\n",
"0\n",
"2\n"
] |
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards.
| 500
|
[
{
"input": "ee",
"output": "2"
},
{
"input": "z",
"output": "0"
},
{
"input": "0ay1",
"output": "2"
},
{
"input": "0abcdefghijklmnopqrstuvwxyz1234567896",
"output": "10"
},
{
"input": "0a0a9e9e2i2i9o9o6u6u9z9z4x4x9b9b",
"output": "18"
},
{
"input": "01234567890123456789012345678901234567890123456789",
"output": "25"
},
{
"input": "qwertyuioplkjhgfdsazxcvbnmqwertyuioplkjhgfdsazxcvb",
"output": "10"
},
{
"input": "cjw2dwmr10pku4yxohe0wglktd",
"output": "4"
},
{
"input": "6z2tx805jie8cfybwtfqvmlveec3iak5z5u3lu62vbxyqht6",
"output": "13"
},
{
"input": "kaq7jyialrfp4ilkni90eq8v3amcbygon7py0hb8z26fbl8ss1",
"output": "13"
},
{
"input": "hpwn50zgbmct80k9rizjqg40nycgs0acwikjqt11nr6m61krfs",
"output": "8"
},
{
"input": "l3rw91a4m25l8iytxyeuixsegzcbm4h41ornf3pixkrmwznrzc",
"output": "14"
},
{
"input": "2222",
"output": "0"
},
{
"input": "13579",
"output": "5"
},
{
"input": "1",
"output": "1"
},
{
"input": "0",
"output": "0"
},
{
"input": "a",
"output": "1"
},
{
"input": "y",
"output": "0"
},
{
"input": "w",
"output": "0"
},
{
"input": "oo",
"output": "2"
},
{
"input": "oy",
"output": "1"
},
{
"input": "yo",
"output": "1"
},
{
"input": "yy",
"output": "0"
},
{
"input": "a0",
"output": "1"
},
{
"input": "a9",
"output": "2"
},
{
"input": "y0",
"output": "0"
},
{
"input": "y7",
"output": "1"
},
{
"input": "0a",
"output": "1"
},
{
"input": "3a",
"output": "2"
},
{
"input": "06",
"output": "0"
},
{
"input": "07",
"output": "1"
},
{
"input": "70",
"output": "1"
},
{
"input": "77",
"output": "2"
},
{
"input": "13570",
"output": "4"
},
{
"input": "0000000000011111",
"output": "5"
},
{
"input": "1357",
"output": "4"
},
{
"input": "uuuuuuuuuuuuuuuuuu",
"output": "18"
},
{
"input": "gabieurat",
"output": "5"
}
] | 1,599,229,810
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 109
| 0
|
from sys import stdin, stdout
def need_to_check(card, vowels=['a','e','i','o','u']):
return (ord(card) >= ord('0') and ord(card) <= ord('9') and int(card) % 2 == 1) or (card in vowels)
def number_of_reveals(cards):
count = 0
for card in cards:
count = count+1 if need_to_check(card) else count
return count
stdout.write( str(number_of_reveals(stdin.readline())) +'\n')
|
Title: New Year and Counting Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
Input Specification:
The first and only line of input will contain a string *s* (1<=β€<=|*s*|<=β€<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
Output Specification:
Print a single integer, the minimum number of cards you must turn over to verify your claim.
Demo Input:
['ee\n', 'z\n', '0ay1\n']
Demo Output:
['2\n', '0\n', '2\n']
Note:
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards.
|
```python
from sys import stdin, stdout
def need_to_check(card, vowels=['a','e','i','o','u']):
return (ord(card) >= ord('0') and ord(card) <= ord('9') and int(card) % 2 == 1) or (card in vowels)
def number_of_reveals(cards):
count = 0
for card in cards:
count = count+1 if need_to_check(card) else count
return count
stdout.write( str(number_of_reveals(stdin.readline())) +'\n')
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,602,371,164
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 218
| 0
|
n=int(input())
a=[int(x) for x in input().split()]
b=[]
for i in range(n):
b.append(a[i]%2)
if b.count(1)>b.count(0):
c=[1]*n
else:
c=[0]*n
for i in range(n):
if b[i]-c[i]!=0:
print(i+1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n=int(input())
a=[int(x) for x in input().split()]
b=[]
for i in range(n):
b.append(a[i]%2)
if b.count(1)>b.count(0):
c=[1]*n
else:
c=[0]*n
for i in range(n):
if b[i]-c[i]!=0:
print(i+1)
```
| 3.9455
|
625
|
B
|
War of the Corporations
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"greedy",
"strings"
] | null | null |
A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000.
This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence.
Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring.
Substring is a continuous subsequence of a string.
|
The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters.
|
Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring.
|
[
"intellect\ntell\n",
"google\napple\n",
"sirisiri\nsir\n"
] |
[
"1",
"0",
"2"
] |
In the first sample AI's name may be replaced with "int#llect".
In the second sample Gogol can just keep things as they are.
In the third sample one of the new possible names of AI may be "s#ris#ri".
| 750
|
[
{
"input": "intellect\ntell",
"output": "1"
},
{
"input": "google\napple",
"output": "0"
},
{
"input": "sirisiri\nsir",
"output": "2"
},
{
"input": "sirisiri\nsiri",
"output": "2"
},
{
"input": "aaaaaaa\naaaa",
"output": "1"
},
{
"input": "bbbbbb\nbb",
"output": "3"
},
{
"input": "abc\nabcabc",
"output": "0"
},
{
"input": "kek\nkekekek",
"output": "0"
},
{
"input": "aaaaa\naaa",
"output": "1"
},
{
"input": "abcdabcv\nabcd",
"output": "1"
},
{
"input": "abcabcabczabcabcabcz\ncab",
"output": "4"
},
{
"input": "aatopotopotopotaa\ntopot",
"output": "2"
},
{
"input": "abcabcabcabcabcabcabcabcabcabc\nabcabcabcabcabcabcabcabcabcabc",
"output": "1"
},
{
"input": "sosossosos\nsos",
"output": "2"
},
{
"input": "sosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosos\nsos",
"output": "20"
},
{
"input": "tatatx\ntatx",
"output": "1"
},
{
"input": "sxxsxxsxxd\nsxxsxxd",
"output": "1"
}
] | 1,498,085,255
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 140
| 5,632,000
|
# Description of the problem can be found at http://codeforces.com/problemset/problem/625/B
x = input()
s = input()
print(x.count(s))
|
Title: War of the Corporations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000.
This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence.
Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring.
Substring is a continuous subsequence of a string.
Input Specification:
The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters.
Output Specification:
Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring.
Demo Input:
['intellect\ntell\n', 'google\napple\n', 'sirisiri\nsir\n']
Demo Output:
['1', '0', '2']
Note:
In the first sample AI's name may be replaced with "int#llect".
In the second sample Gogol can just keep things as they are.
In the third sample one of the new possible names of AI may be "s#ris#ri".
|
```python
# Description of the problem can be found at http://codeforces.com/problemset/problem/625/B
x = input()
s = input()
print(x.count(s))
```
| 3
|
|
776
|
A
|
A Serial Killer
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern.
|
First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=β€<=*n*<=β€<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters.
|
Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order.
|
[
"ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n",
"icm codeforces\n1\ncodeforces technex\n"
] |
[
"ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n",
"icm codeforces\nicm technex\n"
] |
In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears.
| 500
|
[
{
"input": "ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler",
"output": "ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler"
},
{
"input": "icm codeforces\n1\ncodeforces technex",
"output": "icm codeforces\nicm technex"
},
{
"input": "a b\n3\na c\nb d\nd e",
"output": "a b\nc b\nc d\nc e"
},
{
"input": "ze udggmyop\n4\nze szhrbmft\nudggmyop mjorab\nszhrbmft ojdtfnzxj\nojdtfnzxj yjlkg",
"output": "ze udggmyop\nszhrbmft udggmyop\nszhrbmft mjorab\nojdtfnzxj mjorab\nyjlkg mjorab"
},
{
"input": "q s\n10\nq b\nb j\ns g\nj f\nf m\ng c\nc a\nm d\nd z\nz o",
"output": "q s\nb s\nj s\nj g\nf g\nm g\nm c\nm a\nd a\nz a\no a"
},
{
"input": "iii iiiiii\n7\niii iiiiiiiiii\niiiiiiiiii iiii\niiii i\niiiiii iiiiiiii\niiiiiiii iiiiiiiii\ni iiiii\niiiii ii",
"output": "iii iiiiii\niiiiiiiiii iiiiii\niiii iiiiii\ni iiiiii\ni iiiiiiii\ni iiiiiiiii\niiiii iiiiiiiii\nii iiiiiiiii"
},
{
"input": "bwyplnjn zkms\n26\nzkms nzmcsytxh\nnzmcsytxh yujsb\nbwyplnjn gtbzhudpb\ngtbzhudpb hpk\nyujsb xvy\nhpk wrwnfokml\nwrwnfokml ndouuikw\nndouuikw ucgrja\nucgrja tgfmpldz\nxvy nycrfphn\nnycrfphn quvs\nquvs htdy\nhtdy k\ntgfmpldz xtdpkxm\nxtdpkxm suwqxs\nk fv\nsuwqxs qckllwy\nqckllwy diun\nfv lefa\nlefa gdoqjysx\ndiun dhpz\ngdoqjysx bdmqdyt\ndhpz dgz\ndgz v\nbdmqdyt aswy\naswy ydkayhlrnm",
"output": "bwyplnjn zkms\nbwyplnjn nzmcsytxh\nbwyplnjn yujsb\ngtbzhudpb yujsb\nhpk yujsb\nhpk xvy\nwrwnfokml xvy\nndouuikw xvy\nucgrja xvy\ntgfmpldz xvy\ntgfmpldz nycrfphn\ntgfmpldz quvs\ntgfmpldz htdy\ntgfmpldz k\nxtdpkxm k\nsuwqxs k\nsuwqxs fv\nqckllwy fv\ndiun fv\ndiun lefa\ndiun gdoqjysx\ndhpz gdoqjysx\ndhpz bdmqdyt\ndgz bdmqdyt\nv bdmqdyt\nv aswy\nv ydkayhlrnm"
},
{
"input": "wxz hbeqwqp\n7\nhbeqwqp cpieghnszh\ncpieghnszh tlqrpd\ntlqrpd ttwrtio\nttwrtio xapvds\nxapvds zk\nwxz yryk\nzk b",
"output": "wxz hbeqwqp\nwxz cpieghnszh\nwxz tlqrpd\nwxz ttwrtio\nwxz xapvds\nwxz zk\nyryk zk\nyryk b"
},
{
"input": "wced gnsgv\n23\ngnsgv japawpaf\njapawpaf nnvpeu\nnnvpeu a\na ddupputljq\nddupputljq qyhnvbh\nqyhnvbh pqwijl\nwced khuvs\nkhuvs bjkh\npqwijl ysacmboc\nbjkh srf\nsrf jknoz\njknoz hodf\nysacmboc xqtkoyh\nhodf rfp\nxqtkoyh bivgnwqvoe\nbivgnwqvoe nknf\nnknf wuig\nrfp e\ne bqqknq\nwuig sznhhhu\nbqqknq dhrtdld\ndhrtdld n\nsznhhhu bguylf",
"output": "wced gnsgv\nwced japawpaf\nwced nnvpeu\nwced a\nwced ddupputljq\nwced qyhnvbh\nwced pqwijl\nkhuvs pqwijl\nbjkh pqwijl\nbjkh ysacmboc\nsrf ysacmboc\njknoz ysacmboc\nhodf ysacmboc\nhodf xqtkoyh\nrfp xqtkoyh\nrfp bivgnwqvoe\nrfp nknf\nrfp wuig\ne wuig\nbqqknq wuig\nbqqknq sznhhhu\ndhrtdld sznhhhu\nn sznhhhu\nn bguylf"
},
{
"input": "qqqqqqqqqq qqqqqqqq\n3\nqqqqqqqq qqqqqqqqq\nqqqqqqqqq qqqqq\nqqqqq q",
"output": "qqqqqqqqqq qqqqqqqq\nqqqqqqqqqq qqqqqqqqq\nqqqqqqqqqq qqqqq\nqqqqqqqqqq q"
},
{
"input": "wwwww w\n8\nwwwww wwwwwwww\nwwwwwwww wwwwwwwww\nwwwwwwwww wwwwwwwwww\nw www\nwwwwwwwwww wwww\nwwww ww\nwww wwwwww\nwwwwww wwwwwww",
"output": "wwwww w\nwwwwwwww w\nwwwwwwwww w\nwwwwwwwwww w\nwwwwwwwwww www\nwwww www\nww www\nww wwwwww\nww wwwwwww"
},
{
"input": "k d\n17\nk l\nd v\nv z\nl r\nz i\nr s\ns p\np w\nw j\nj h\ni c\nh m\nm q\nc o\no g\nq x\nx n",
"output": "k d\nl d\nl v\nl z\nr z\nr i\ns i\np i\nw i\nj i\nh i\nh c\nm c\nq c\nq o\nq g\nx g\nn g"
}
] | 1,593,521,808
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 57
| 202
| 3,276,800
|
n,m= input().split()
print(n,m)
num = int(input())
for i in range(num):
a,b=input().split()
if(a==n):
print(b,m)
n=b
else:
print(b,n)
m=b
|
Title: A Serial Killer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern.
Input Specification:
First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=β€<=*n*<=β€<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters.
Output Specification:
Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order.
Demo Input:
['ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n', 'icm codeforces\n1\ncodeforces technex\n']
Demo Output:
['ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n', 'icm codeforces\nicm technex\n']
Note:
In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears.
|
```python
n,m= input().split()
print(n,m)
num = int(input())
for i in range(num):
a,b=input().split()
if(a==n):
print(b,m)
n=b
else:
print(b,n)
m=b
```
| 3
|
|
785
|
A
|
Anton and Polyhedrons
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
|
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=200<=000)Β β the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i*Β β the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
|
Output one numberΒ β the total number of faces in all the polyhedrons in Anton's collection.
|
[
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
] |
[
"42\n",
"28\n"
] |
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20β+β6β+β4β+β12β=β42 faces.
| 500
|
[
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
] | 1,679,367,714
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 265
| 0
|
s = {"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20}
t = int(input())
add = 0
for i in range(t):
add += s[input()]
print(add)
|
Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=200<=000)Β β the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i*Β β the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one numberΒ β the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20β+β6β+β4β+β12β=β42 faces.
|
```python
s = {"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20}
t = int(input())
add = 0
for i in range(t):
add += s[input()]
print(add)
```
| 3
|
|
227
|
A
|
Where do I Turn?
|
PROGRAMMING
| 1,300
|
[
"geometry"
] | null | null |
Trouble came from the overseas lands: a three-headed dragon Gorynych arrived. The dragon settled at point *C* and began to terrorize the residents of the surrounding villages.
A brave hero decided to put an end to the dragon. He moved from point *A* to fight with Gorynych. The hero rode from point *A* along a straight road and met point *B* on his way. The hero knows that in this land for every pair of roads it is true that they are either parallel to each other, or lie on a straight line, or are perpendicular to each other. He also knows well that points *B* and *C* are connected by a road. So the hero must either turn 90 degrees to the left or continue riding straight ahead or turn 90 degrees to the right. But he forgot where the point *C* is located.
Fortunately, a Brave Falcon flew right by. It can see all three points from the sky. The hero asked him what way to go to get to the dragon's lair.
If you have not got it, you are the falcon. Help the hero and tell him how to get him to point *C*: turn left, go straight or turn right.
At this moment the hero is believed to stand at point *B*, turning his back to point *A*.
|
The first input line contains two space-separated integers *x**a*,<=*y**a* (|*x**a*|,<=|*y**a*|<=β€<=109) β the coordinates of point *A*. The second line contains the coordinates of point *B* in the same form, the third line contains the coordinates of point *C*.
It is guaranteed that all points are pairwise different. It is also guaranteed that either point *B* lies on segment *AC*, or angle *ABC* is right.
|
Print a single line. If a hero must turn left, print "LEFT" (without the quotes); If he must go straight ahead, print "TOWARDS" (without the quotes); if he should turn right, print "RIGHT" (without the quotes).
|
[
"0 0\n0 1\n1 1\n",
"-1 -1\n-3 -3\n-4 -4\n",
"-4 -6\n-3 -7\n-2 -6\n"
] |
[
"RIGHT\n",
"TOWARDS\n",
"LEFT\n"
] |
The picture to the first sample:
The red color shows points A, B and C. The blue arrow shows the hero's direction. The green color shows the hero's trajectory.
The picture to the second sample:
| 500
|
[
{
"input": "0 0\n0 1\n1 1",
"output": "RIGHT"
},
{
"input": "-1 -1\n-3 -3\n-4 -4",
"output": "TOWARDS"
},
{
"input": "-4 -6\n-3 -7\n-2 -6",
"output": "LEFT"
},
{
"input": "-44 57\n-118 -41\n-216 33",
"output": "RIGHT"
},
{
"input": "39 100\n90 85\n105 136",
"output": "LEFT"
},
{
"input": "71 43\n96 -15\n171 -189",
"output": "TOWARDS"
},
{
"input": "-22 -84\n-117 8\n-25 103",
"output": "RIGHT"
},
{
"input": "28 -81\n49 -85\n45 -106",
"output": "RIGHT"
},
{
"input": "-20 -60\n-39 -45\n-24 -26",
"output": "RIGHT"
},
{
"input": "-61 -24\n-61 35\n-120 35",
"output": "LEFT"
},
{
"input": "-19 27\n-115 -63\n-25 -159",
"output": "LEFT"
},
{
"input": "53 69\n147 114\n102 208",
"output": "LEFT"
},
{
"input": "22 -38\n22 -128\n22 -398",
"output": "TOWARDS"
},
{
"input": "47 16\n-13 -52\n-253 -324",
"output": "TOWARDS"
},
{
"input": "71 -22\n10 -1\n-417 146",
"output": "TOWARDS"
},
{
"input": "-783785 244379\n-827111 1135071\n63581 1178397",
"output": "RIGHT"
},
{
"input": "3609 -639705\n294730 -1024276\n-89841 -1315397",
"output": "RIGHT"
},
{
"input": "47715 -171800\n-228153 -358383\n-414736 -82515",
"output": "RIGHT"
},
{
"input": "-702371 875896\n-1445450 1767452\n-2337006 1024373",
"output": "LEFT"
},
{
"input": "-508160 -332418\n-1151137 415692\n-1899247 -227285",
"output": "LEFT"
},
{
"input": "-756864 833019\n-105276 568688\n159055 1220276",
"output": "LEFT"
},
{
"input": "635167 -889045\n1429362 -1770135\n2223557 -2651225",
"output": "TOWARDS"
},
{
"input": "-897142 527212\n-313890 206605\n2019118 -1075823",
"output": "TOWARDS"
},
{
"input": "8662 -907734\n-73417 -1195869\n-401733 -2348409",
"output": "TOWARDS"
},
{
"input": "-752889181 -922273353\n-495897323 -117405233\n308970797 -374397091",
"output": "RIGHT"
},
{
"input": "-143491154 -462477108\n173292223 111677574\n747446905 -205105803",
"output": "RIGHT"
},
{
"input": "419299232 564945785\n960228923 -229158901\n166124237 -770088592",
"output": "RIGHT"
},
{
"input": "85768877 -347290108\n332919696 -655546541\n641176129 -408395722",
"output": "LEFT"
},
{
"input": "708149426 502573762\n-210552252 335164034\n-43142524 -583537644",
"output": "LEFT"
},
{
"input": "640934661 -321662897\n-332613133 326172546\n-980448576 -647375248",
"output": "LEFT"
},
{
"input": "-951852504 776750379\n-698326409 275687363\n-191274219 -726438669",
"output": "TOWARDS"
},
{
"input": "507851078 -147339692\n440808462 -4699564\n373765846 137940564",
"output": "TOWARDS"
},
{
"input": "579796456 -149651968\n516495557 -133472697\n-369717029 93037097",
"output": "TOWARDS"
},
{
"input": "0 -1800000\n0 0\n10000000 0",
"output": "RIGHT"
},
{
"input": "0 994599799\n0 0\n-999999928 0",
"output": "RIGHT"
},
{
"input": "-1000000000 0\n0 0\n0 1000000000",
"output": "LEFT"
},
{
"input": "1000000000 1000000000\n-1000000000 1000000000\n-1000000000 -1000000000",
"output": "LEFT"
},
{
"input": "0 0\n1 0\n1 1",
"output": "LEFT"
},
{
"input": "0 0\n0 1000000000\n1000000000 1000000000",
"output": "RIGHT"
},
{
"input": "998000000 999000000\n999000000 1000000000\n1000000000 999000000",
"output": "RIGHT"
},
{
"input": "0 0\n1000000000 0\n1000000000 1000000000",
"output": "LEFT"
},
{
"input": "0 0\n1111111 1111111\n2222222 0",
"output": "RIGHT"
},
{
"input": "0 0\n100000007 0\n100000007 -999999999",
"output": "RIGHT"
},
{
"input": "-1000000000 1000000000\n-1000000000 -1000000000\n1000000000 -1000000000",
"output": "LEFT"
},
{
"input": "0 1000000000\n0 -99999999\n-99999999 -99999999",
"output": "RIGHT"
},
{
"input": "1000000000 1000000000\n1000000000 0\n0 0",
"output": "RIGHT"
},
{
"input": "0 0\n100000000 100000000\n1000000000 1000000000",
"output": "TOWARDS"
},
{
"input": "0 -1000000000\n0 0\n1000000000 0",
"output": "RIGHT"
}
] | 1,630,951,047
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 124
| 6,963,200
|
xa,ya = input().split()
xa = int(xa)
ya = int(ya)
xb,yb = input().split()
xb = int(xb)
yb = int(yb)
xc,yc = input().split()
xc = int(xc)
yc = int(yc)
vab_x = xb-xa
vab_y = yb-ya
vbc_x = xc - xb
vbc_y = yc - yb
produto_vetorial = (vab_x * vbc_y) - (vab_y * vbc_x)
if(produto_vetorial == 0):
print("TOWARDS")
elif(produto_vetorial < 0):
print("RIGHT")
else:
print("LEFT")
|
Title: Where do I Turn?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Trouble came from the overseas lands: a three-headed dragon Gorynych arrived. The dragon settled at point *C* and began to terrorize the residents of the surrounding villages.
A brave hero decided to put an end to the dragon. He moved from point *A* to fight with Gorynych. The hero rode from point *A* along a straight road and met point *B* on his way. The hero knows that in this land for every pair of roads it is true that they are either parallel to each other, or lie on a straight line, or are perpendicular to each other. He also knows well that points *B* and *C* are connected by a road. So the hero must either turn 90 degrees to the left or continue riding straight ahead or turn 90 degrees to the right. But he forgot where the point *C* is located.
Fortunately, a Brave Falcon flew right by. It can see all three points from the sky. The hero asked him what way to go to get to the dragon's lair.
If you have not got it, you are the falcon. Help the hero and tell him how to get him to point *C*: turn left, go straight or turn right.
At this moment the hero is believed to stand at point *B*, turning his back to point *A*.
Input Specification:
The first input line contains two space-separated integers *x**a*,<=*y**a* (|*x**a*|,<=|*y**a*|<=β€<=109) β the coordinates of point *A*. The second line contains the coordinates of point *B* in the same form, the third line contains the coordinates of point *C*.
It is guaranteed that all points are pairwise different. It is also guaranteed that either point *B* lies on segment *AC*, or angle *ABC* is right.
Output Specification:
Print a single line. If a hero must turn left, print "LEFT" (without the quotes); If he must go straight ahead, print "TOWARDS" (without the quotes); if he should turn right, print "RIGHT" (without the quotes).
Demo Input:
['0 0\n0 1\n1 1\n', '-1 -1\n-3 -3\n-4 -4\n', '-4 -6\n-3 -7\n-2 -6\n']
Demo Output:
['RIGHT\n', 'TOWARDS\n', 'LEFT\n']
Note:
The picture to the first sample:
The red color shows points A, B and C. The blue arrow shows the hero's direction. The green color shows the hero's trajectory.
The picture to the second sample:
|
```python
xa,ya = input().split()
xa = int(xa)
ya = int(ya)
xb,yb = input().split()
xb = int(xb)
yb = int(yb)
xc,yc = input().split()
xc = int(xc)
yc = int(yc)
vab_x = xb-xa
vab_y = yb-ya
vbc_x = xc - xb
vbc_y = yc - yb
produto_vetorial = (vab_x * vbc_y) - (vab_y * vbc_x)
if(produto_vetorial == 0):
print("TOWARDS")
elif(produto_vetorial < 0):
print("RIGHT")
else:
print("LEFT")
```
| 3
|
|
884
|
A
|
Book Reading
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can.
But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading.
Help Luba to determine the minimum number of day when she finishes reading.
It is guaranteed that the answer doesn't exceed *n*.
Remember that there are 86400 seconds in a day.
|
The first line contains two integers *n* and *t* (1<=β€<=*n*<=β€<=100, 1<=β€<=*t*<=β€<=106) β the number of days and the time required to read the book.
The second line contains *n* integers *a**i* (0<=β€<=*a**i*<=β€<=86400) β the time Luba has to spend on her work during *i*-th day.
|
Print the minimum day Luba can finish reading the book.
It is guaranteed that answer doesn't exceed *n*.
|
[
"2 2\n86400 86398\n",
"2 86400\n0 86400\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "2 2\n86400 86398",
"output": "2"
},
{
"input": "2 86400\n0 86400",
"output": "1"
},
{
"input": "2 86400\n1 86399",
"output": "2"
},
{
"input": "100 1000000\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "12"
},
{
"input": "1 1\n86399",
"output": "1"
},
{
"input": "6 1200\n86400 86400 86000 86000 86000 86400",
"output": "5"
},
{
"input": "6 1200\n86400 86400 86000 86000 86001 86399",
"output": "6"
},
{
"input": "4 172799\n1 1 86400 0",
"output": "4"
},
{
"input": "4 172799\n0 86400 86399 0",
"output": "4"
},
{
"input": "6 1\n1 1 86400 1 86399 1",
"output": "1"
},
{
"input": "4 1\n86400 86399 86400 86400",
"output": "2"
},
{
"input": "4 1\n86400 86400 0 86400",
"output": "3"
}
] | 1,509,113,739
| 639
|
Python 3
|
OK
|
TESTS
| 16
| 61
| 0
|
a=input().split(' ')
n=int(a[0])
t=int(a[1])
a=input().split(' ')
a=[int(i) for i in a]
for i in range(n):
if t<=0:
print(i)
break
t=t-(86400-a[i])
else:
print(n)
|
Title: Book Reading
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can.
But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading.
Help Luba to determine the minimum number of day when she finishes reading.
It is guaranteed that the answer doesn't exceed *n*.
Remember that there are 86400 seconds in a day.
Input Specification:
The first line contains two integers *n* and *t* (1<=β€<=*n*<=β€<=100, 1<=β€<=*t*<=β€<=106) β the number of days and the time required to read the book.
The second line contains *n* integers *a**i* (0<=β€<=*a**i*<=β€<=86400) β the time Luba has to spend on her work during *i*-th day.
Output Specification:
Print the minimum day Luba can finish reading the book.
It is guaranteed that answer doesn't exceed *n*.
Demo Input:
['2 2\n86400 86398\n', '2 86400\n0 86400\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
a=input().split(' ')
n=int(a[0])
t=int(a[1])
a=input().split(' ')
a=[int(i) for i in a]
for i in range(n):
if t<=0:
print(i)
break
t=t-(86400-a[i])
else:
print(n)
```
| 3
|
|
855
|
A
|
Tom Riddle's Diary
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
|
First line of input contains an integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
|
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
|
[
"6\ntom\nlucius\nginny\nharry\nginny\nharry\n",
"3\na\na\na\n"
] |
[
"NO\nNO\nNO\nNO\nYES\nYES\n",
"NO\nYES\nYES\n"
] |
In test case 1, for *i*β=β5 there exists *j*β=β3 such that *s*<sub class="lower-index">*i*</sub>β=β*s*<sub class="lower-index">*j*</sub> and *j*β<β*i*, which means that answer for *i*β=β5 is "YES".
| 500
|
[
{
"input": "6\ntom\nlucius\nginny\nharry\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nYES\nYES"
},
{
"input": "3\na\na\na",
"output": "NO\nYES\nYES"
},
{
"input": "1\nzn",
"output": "NO"
},
{
"input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth",
"output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "1\nz",
"output": "NO"
},
{
"input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO"
},
{
"input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr",
"output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES"
},
{
"input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES"
},
{
"input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO\nNO\nNO"
},
{
"input": "2\nab\nba",
"output": "NO\nNO"
},
{
"input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde",
"output": "NO\nYES"
},
{
"input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,692,610,152
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 46
| 0
|
#all those moments will be lost in time , like tears in rain "D
a=[]
n=int(input())
for _ in range(n):
b=input()
if b in a:
print('YES')
else:
print('NO')
a.append(b);
|
Title: Tom Riddle's Diary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
Input Specification:
First line of input contains an integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output Specification:
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
Demo Input:
['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n']
Demo Output:
['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n']
Note:
In test case 1, for *i*β=β5 there exists *j*β=β3 such that *s*<sub class="lower-index">*i*</sub>β=β*s*<sub class="lower-index">*j*</sub> and *j*β<β*i*, which means that answer for *i*β=β5 is "YES".
|
```python
#all those moments will be lost in time , like tears in rain "D
a=[]
n=int(input())
for _ in range(n):
b=input()
if b in a:
print('YES')
else:
print('NO')
a.append(b);
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
On the way to school, Karen became fixated on the puzzle game on her phone!
The game is played as follows. In each level, you have a grid with *n* rows and *m* columns. Each cell originally contains the number 0.
One move consists of choosing one row or column, and adding 1 to all of the cells in that row or column.
To win the level, after all the moves, the number in the cell at the *i*-th row and *j*-th column should be equal to *g**i*,<=*j*.
Karen is stuck on one level, and wants to know a way to beat this level using the minimum number of moves. Please, help her with this task!
|
The first line of input contains two integers, *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100), the number of rows and the number of columns in the grid, respectively.
The next *n* lines each contain *m* integers. In particular, the *j*-th integer in the *i*-th of these rows contains *g**i*,<=*j* (0<=β€<=*g**i*,<=*j*<=β€<=500).
|
If there is an error and it is actually not possible to beat the level, output a single integer -1.
Otherwise, on the first line, output a single integer *k*, the minimum number of moves necessary to beat the level.
The next *k* lines should each contain one of the following, describing the moves in the order they must be done:
- row *x*, (1<=β€<=*x*<=β€<=*n*) describing a move of the form "choose the *x*-th row". - col *x*, (1<=β€<=*x*<=β€<=*m*) describing a move of the form "choose the *x*-th column".
If there are multiple optimal solutions, output any one of them.
|
[
"3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1\n",
"3 3\n0 0 0\n0 1 0\n0 0 0\n",
"3 3\n1 1 1\n1 1 1\n1 1 1\n"
] |
[
"4\nrow 1\nrow 1\ncol 4\nrow 3\n",
"-1\n",
"3\nrow 1\nrow 2\nrow 3\n"
] |
In the first test case, Karen has a grid with 3 rows and 5 columns. She can perform the following 4 moves to beat the level:
In the second test case, Karen has a grid with 3 rows and 3 columns. It is clear that it is impossible to beat the level; performing any move will create three 1s on the grid, but it is required to only have one 1 in the center.
In the third test case, Karen has a grid with 3 rows and 3 columns. She can perform the following 3 moves to beat the level:
Note that this is not the only solution; another solution, among others, is col 1, col 2, col 3.
| 0
|
[
{
"input": "3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1",
"output": "4\nrow 1\nrow 1\ncol 4\nrow 3"
},
{
"input": "3 3\n0 0 0\n0 1 0\n0 0 0",
"output": "-1"
},
{
"input": "3 3\n1 1 1\n1 1 1\n1 1 1",
"output": "3\nrow 1\nrow 2\nrow 3"
},
{
"input": "3 5\n2 4 2 2 3\n0 2 0 0 1\n1 3 1 1 2",
"output": "6\nrow 1\nrow 1\ncol 2\ncol 2\ncol 5\nrow 3"
},
{
"input": "3 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "-1"
},
{
"input": "9 10\n14 5 6 4 8 9 4 14 14 13\n13 4 5 3 7 8 3 13 13 12\n16 7 8 6 10 11 6 16 16 15\n10 1 2 0 4 5 0 10 10 9\n11 2 3 1 5 6 1 11 11 10\n10 1 2 0 4 5 0 10 10 9\n12 3 4 2 6 7 2 12 12 11\n13 4 5 3 7 8 3 13 13 12\n13 4 5 3 7 8 3 13 13 12",
"output": "73\nrow 1\nrow 1\nrow 1\nrow 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 2\ncol 3\ncol 3\ncol 5\ncol 5\ncol 5\ncol 5\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\nrow 2\nrow 2\nrow 2\nrow 3\nrow 3\nrow 3\nrow 3\nrow 3\nrow 3\nrow 5\nrow 7\nrow 7\nrow 8\nrow 8\nrow 8\nrow 9\nr..."
},
{
"input": "10 10\n30 30 30 33 30 33 30 33 30 33\n431 431 431 434 431 434 431 434 431 434\n19 19 19 22 19 22 19 22 19 22\n24 24 24 27 24 27 24 27 24 27\n5 5 5 8 5 8 5 8 5 8\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3",
"output": "521\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\ncol 4\ncol 4\ncol 4\ncol 6\ncol 6\ncol 6\ncol 8\ncol 8\ncol 8\ncol 10\ncol 10\ncol 10\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\n..."
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n500",
"output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "10 10\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1",
"output": "9\nrow 1\nrow 2\nrow 3\nrow 4\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10"
},
{
"input": "10 10\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1",
"output": "9\ncol 1\ncol 2\ncol 3\ncol 4\ncol 5\ncol 6\ncol 8\ncol 9\ncol 10"
},
{
"input": "10 11\n8 7 10 15 5 13 12 9 14 11 6\n6 5 8 13 3 11 10 7 12 9 4\n10 9 12 17 7 15 14 11 16 13 8\n9 8 11 16 6 14 13 10 15 12 7\n12 11 14 19 9 17 16 13 18 15 10\n14 13 16 21 11 19 18 15 20 17 12\n7 6 9 14 4 12 11 8 13 10 5\n5 4 7 12 2 10 9 6 11 8 3\n11 10 13 18 8 16 15 12 17 14 9\n13 12 15 20 10 18 17 14 19 16 11",
"output": "120\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 1\nrow 1\ncol 1\ncol 1\ncol 1\ncol 2\ncol 2\ncol 3\ncol 3\ncol 3\ncol 3\ncol 3\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 8\ncol 8\ncol 8\ncol 8\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 10\n..."
},
{
"input": "5 3\n2 2 2\n2 2 2\n2 2 2\n1 1 1\n2 2 2",
"output": "7\ncol 1\ncol 2\ncol 3\nrow 1\nrow 2\nrow 3\nrow 5"
},
{
"input": "3 5\n2 2 2 1 2\n2 2 2 1 2\n2 2 2 1 2",
"output": "7\nrow 1\nrow 2\nrow 3\ncol 1\ncol 2\ncol 3\ncol 5"
},
{
"input": "1 100\n396 314 350 362 287 349 266 289 297 305 235 226 256 385 302 304 253 192 298 238 360 366 163 340 247 395 318 260 252 281 178 188 252 379 212 187 354 232 225 159 290 335 387 234 383 215 356 182 323 280 195 209 263 215 322 262 334 157 189 214 195 386 220 209 177 193 368 174 270 329 388 237 260 343 230 173 254 371 327 266 193 178 161 209 335 310 323 323 353 172 368 307 329 234 363 264 334 266 305 209",
"output": "11960\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\n..."
},
{
"input": "100 1\n173\n164\n99\n114\n255\n223\n280\n235\n207\n190\n136\n204\n206\n282\n253\n335\n267\n184\n288\n299\n263\n243\n341\n111\n278\n111\n214\n133\n125\n245\n99\n144\n232\n203\n131\n204\n117\n315\n269\n206\n262\n125\n212\n95\n220\n243\n141\n163\n311\n171\n222\n266\n141\n314\n329\n138\n187\n342\n272\n181\n300\n261\n339\n110\n194\n187\n183\n129\n151\n187\n129\n185\n322\n167\n99\n340\n285\n99\n176\n175\n272\n126\n220\n164\n237\n214\n96\n162\n129\n141\n144\n135\n172\n191\n155\n333\n186\n324\n237\n318",
"output": "11282\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\n..."
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "0"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1\nrow 1"
},
{
"input": "100 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "1 100\n500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500",
"output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "100 1\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500",
"output": "500\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\nco..."
},
{
"input": "2 1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "4 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3\ncol 1\ncol 2\ncol 3"
},
{
"input": "2 1\n2\n2",
"output": "2\ncol 1\ncol 1"
},
{
"input": "3 2\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "2 1\n1\n2",
"output": "2\ncol 1\nrow 2"
},
{
"input": "2 3\n1 1 1\n1 1 1",
"output": "2\nrow 1\nrow 2"
},
{
"input": "1 2\n1 1",
"output": "1\nrow 1"
},
{
"input": "5 1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "10 3\n101 201 301\n102 202 302\n103 203 303\n104 204 304\n105 205 305\n106 206 306\n107 207 307\n108 208 308\n109 209 309\n111 211 311",
"output": "649\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\nco..."
},
{
"input": "2 1\n10\n10",
"output": "10\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1"
},
{
"input": "4 3\n2 2 2\n2 2 2\n2 2 2\n2 2 2",
"output": "6\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "3 1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "8 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "1 2\n2 2",
"output": "2\nrow 1\nrow 1"
},
{
"input": "3 2\n2 3\n2 3\n2 3",
"output": "5\ncol 1\ncol 2\ncol 1\ncol 2\ncol 2"
},
{
"input": "2 1\n3\n3",
"output": "3\ncol 1\ncol 1\ncol 1"
},
{
"input": "6 2\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "4 1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "2 5\n1 1 1 1 1\n1 1 1 1 1",
"output": "2\nrow 1\nrow 2"
},
{
"input": "3 1\n500\n500\n500",
"output": "500\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\nco..."
},
{
"input": "5 2\n1 1\n2 2\n2 2\n2 2\n2 2",
"output": "6\ncol 1\ncol 2\nrow 2\nrow 3\nrow 4\nrow 5"
},
{
"input": "4 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3",
"output": "9\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "1 4\n1 1 1 1",
"output": "1\nrow 1"
},
{
"input": "3 1\n2\n3\n2",
"output": "3\ncol 1\ncol 1\nrow 2"
},
{
"input": "1 5\n1 1 1 1 1",
"output": "1\nrow 1"
},
{
"input": "2 4\n3 1 1 1\n3 1 1 1",
"output": "4\nrow 1\nrow 2\ncol 1\ncol 1"
},
{
"input": "3 3\n1 1 1\n0 1 0\n0 0 0",
"output": "-1"
},
{
"input": "3 2\n2 2\n1 1\n2 2",
"output": "4\ncol 1\ncol 2\nrow 1\nrow 3"
},
{
"input": "2 1\n9\n9",
"output": "9\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1"
},
{
"input": "1 7\n3 3 3 3 3 3 3",
"output": "3\nrow 1\nrow 1\nrow 1"
},
{
"input": "5 2\n3 3\n3 3\n3 3\n3 3\n3 3",
"output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "10 11\n250 198 192 182 85 239 295 91 318 216 249\n290 238 232 222 125 279 335 131 358 256 289\n409 357 351 341 244 398 454 250 477 375 408\n362 310 304 294 197 351 407 203 430 328 361\n352 300 294 284 187 341 397 193 420 318 351\n409 357 351 341 244 398 454 250 477 375 408\n209 157 151 141 44 198 254 50 277 175 208\n313 261 255 245 148 302 358 154 381 279 312\n171 119 113 103 6 160 216 12 239 137 170\n275 223 217 207 110 264 320 116 343 241 274",
"output": "2770\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "7 1\n1\n1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "5 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3\ncol 1\ncol 2\ncol 3"
},
{
"input": "5 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3",
"output": "9\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "2 1\n4\n5",
"output": "5\ncol 1\ncol 1\ncol 1\ncol 1\nrow 2"
},
{
"input": "4 2\n3 3\n3 3\n3 3\n3 3",
"output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "6 3\n2 2 2\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "4\ncol 1\ncol 2\ncol 3\nrow 1"
},
{
"input": "5 1\n1\n2\n3\n4\n5",
"output": "11\ncol 1\nrow 2\nrow 3\nrow 3\nrow 4\nrow 4\nrow 4\nrow 5\nrow 5\nrow 5\nrow 5"
},
{
"input": "2 1\n1\n3",
"output": "3\ncol 1\nrow 2\nrow 2"
},
{
"input": "3 2\n1 500\n1 500\n1 500",
"output": "501\ncol 1\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\nco..."
},
{
"input": "10 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "6 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "3 5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1",
"output": "3\nrow 1\nrow 2\nrow 3"
},
{
"input": "2 3\n2 1 2\n2 1 2",
"output": "4\nrow 1\nrow 2\ncol 1\ncol 3"
},
{
"input": "5 2\n2 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "1 2\n1 3",
"output": "3\nrow 1\ncol 2\ncol 2"
},
{
"input": "4 3\n2 2 2\n1 1 1\n1 1 1\n1 1 1",
"output": "4\ncol 1\ncol 2\ncol 3\nrow 1"
},
{
"input": "3 2\n1 1\n2 2\n3 3",
"output": "5\ncol 1\ncol 2\nrow 2\nrow 3\nrow 3"
},
{
"input": "4 2\n1 1\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "3 4\n1 1 1 1\n1 1 1 1\n1 1 1 1",
"output": "3\nrow 1\nrow 2\nrow 3"
},
{
"input": "2 1\n2\n3",
"output": "3\ncol 1\ncol 1\nrow 2"
},
{
"input": "5 3\n2 2 2\n2 2 2\n2 2 2\n2 2 2\n2 2 2",
"output": "6\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "3 2\n1 0\n2 1\n2 1",
"output": "3\ncol 1\nrow 2\nrow 3"
},
{
"input": "3 2\n1 2\n2 3\n3 4",
"output": "6\ncol 1\ncol 2\ncol 2\nrow 2\nrow 3\nrow 3"
},
{
"input": "3 3\n1 1 1\n1 2 1\n1 1 1",
"output": "-1"
},
{
"input": "4 3\n2 1 1\n2 1 1\n2 1 1\n2 1 1",
"output": "4\ncol 1\ncol 2\ncol 3\ncol 1"
},
{
"input": "4 1\n3\n3\n3\n3",
"output": "3\ncol 1\ncol 1\ncol 1"
},
{
"input": "1 3\n2 3 2",
"output": "3\nrow 1\nrow 1\ncol 2"
},
{
"input": "1 2\n1 2",
"output": "2\nrow 1\ncol 2"
},
{
"input": "3 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "1 3\n1 1 1",
"output": "1\nrow 1"
},
{
"input": "6 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3\ncol 1\ncol 2\ncol 3"
},
{
"input": "3 1\n2\n2\n2",
"output": "2\ncol 1\ncol 1"
},
{
"input": "3 1\n3\n3\n3",
"output": "3\ncol 1\ncol 1\ncol 1"
},
{
"input": "3 2\n2 2\n1 1\n1 1",
"output": "3\ncol 1\ncol 2\nrow 1"
},
{
"input": "5 3\n1 1 2\n1 1 2\n1 1 2\n1 1 2\n1 1 2",
"output": "4\ncol 1\ncol 2\ncol 3\ncol 3"
},
{
"input": "1 2\n2 3",
"output": "3\nrow 1\nrow 1\ncol 2"
},
{
"input": "5 1\n2\n2\n2\n2\n2",
"output": "2\ncol 1\ncol 1"
},
{
"input": "3 2\n1 1\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\nrow 2\nrow 3"
},
{
"input": "3 3\n1 1 1\n2 3 3\n4 4 4",
"output": "-1"
},
{
"input": "2 1\n5\n2",
"output": "5\ncol 1\ncol 1\nrow 1\nrow 1\nrow 1"
},
{
"input": "4 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "3 2\n5 10\n5 10\n5 10",
"output": "15\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2"
},
{
"input": "4 3\n3 4 3\n5 6 5\n3 4 3\n3 4 3",
"output": "12\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 2\nrow 2\nrow 2"
},
{
"input": "4 2\n1 1\n1 1\n1 1\n2 2",
"output": "3\ncol 1\ncol 2\nrow 4"
},
{
"input": "2 3\n1 1 1\n500 500 500",
"output": "501\nrow 1\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nro..."
},
{
"input": "4 1\n4\n4\n4\n4",
"output": "4\ncol 1\ncol 1\ncol 1\ncol 1"
},
{
"input": "3 2\n1 1\n1 1\n2 2",
"output": "3\ncol 1\ncol 2\nrow 3"
},
{
"input": "2 3\n2 2 2\n2 2 2",
"output": "4\nrow 1\nrow 2\nrow 1\nrow 2"
},
{
"input": "3 2\n3 3\n3 3\n3 3",
"output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "2 3\n10 10 10\n5 5 5",
"output": "15\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1"
},
{
"input": "5 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "3\ncol 1\ncol 2\ncol 2"
},
{
"input": "1 2\n500 500",
"output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "2 1\n5\n5",
"output": "5\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1"
}
] | 1,530,962,458
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 177
| 374
| 819,200
|
n,m=map(int,input().split())
a=[];row=[];col=[]
for i in range(n):
a.append(list(map(int,input().split())))
if m>n:
for i in range(n):
row.append(min(a[i]))
for i in range(m):
col.append(a[0][i]-row[0])
else:
for i in range(m):
r=1000
for j in range(n):
r=min(r,a[j][i])
col.append(r)
for i in range(n):
row.append(a[i][0]-col[0])
for i in range(n):
for j in range(m):
if a[i][j]!=row[i]+col[j]:
exit(print(-1))
print(sum(row)+sum(col))
for i in range(n):
for j in range(row[i]):
print('row',i+1)
for i in range(m):
for j in range(col[i]):
print('col',i+1)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On the way to school, Karen became fixated on the puzzle game on her phone!
The game is played as follows. In each level, you have a grid with *n* rows and *m* columns. Each cell originally contains the number 0.
One move consists of choosing one row or column, and adding 1 to all of the cells in that row or column.
To win the level, after all the moves, the number in the cell at the *i*-th row and *j*-th column should be equal to *g**i*,<=*j*.
Karen is stuck on one level, and wants to know a way to beat this level using the minimum number of moves. Please, help her with this task!
Input Specification:
The first line of input contains two integers, *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100), the number of rows and the number of columns in the grid, respectively.
The next *n* lines each contain *m* integers. In particular, the *j*-th integer in the *i*-th of these rows contains *g**i*,<=*j* (0<=β€<=*g**i*,<=*j*<=β€<=500).
Output Specification:
If there is an error and it is actually not possible to beat the level, output a single integer -1.
Otherwise, on the first line, output a single integer *k*, the minimum number of moves necessary to beat the level.
The next *k* lines should each contain one of the following, describing the moves in the order they must be done:
- row *x*, (1<=β€<=*x*<=β€<=*n*) describing a move of the form "choose the *x*-th row". - col *x*, (1<=β€<=*x*<=β€<=*m*) describing a move of the form "choose the *x*-th column".
If there are multiple optimal solutions, output any one of them.
Demo Input:
['3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1\n', '3 3\n0 0 0\n0 1 0\n0 0 0\n', '3 3\n1 1 1\n1 1 1\n1 1 1\n']
Demo Output:
['4\nrow 1\nrow 1\ncol 4\nrow 3\n', '-1\n', '3\nrow 1\nrow 2\nrow 3\n']
Note:
In the first test case, Karen has a grid with 3 rows and 5 columns. She can perform the following 4 moves to beat the level:
In the second test case, Karen has a grid with 3 rows and 3 columns. It is clear that it is impossible to beat the level; performing any move will create three 1s on the grid, but it is required to only have one 1 in the center.
In the third test case, Karen has a grid with 3 rows and 3 columns. She can perform the following 3 moves to beat the level:
Note that this is not the only solution; another solution, among others, is col 1, col 2, col 3.
|
```python
n,m=map(int,input().split())
a=[];row=[];col=[]
for i in range(n):
a.append(list(map(int,input().split())))
if m>n:
for i in range(n):
row.append(min(a[i]))
for i in range(m):
col.append(a[0][i]-row[0])
else:
for i in range(m):
r=1000
for j in range(n):
r=min(r,a[j][i])
col.append(r)
for i in range(n):
row.append(a[i][0]-col[0])
for i in range(n):
for j in range(m):
if a[i][j]!=row[i]+col[j]:
exit(print(-1))
print(sum(row)+sum(col))
for i in range(n):
for j in range(row[i]):
print('row',i+1)
for i in range(m):
for j in range(col[i]):
print('col',i+1)
```
| 3
|
|
1,008
|
A
|
Romaji
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
|
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
|
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
|
[
"sumimasen\n",
"ninja\n",
"codeforces\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
| 500
|
[
{
"input": "sumimasen",
"output": "YES"
},
{
"input": "ninja",
"output": "YES"
},
{
"input": "codeforces",
"output": "NO"
},
{
"input": "auuaoonntanonnuewannnnpuuinniwoonennyolonnnvienonpoujinndinunnenannmuveoiuuhikucuziuhunnnmunzancenen",
"output": "YES"
},
{
"input": "n",
"output": "YES"
},
{
"input": "necnei",
"output": "NO"
},
{
"input": "nternn",
"output": "NO"
},
{
"input": "aucunuohja",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "b",
"output": "NO"
},
{
"input": "nn",
"output": "YES"
},
{
"input": "nnnzaaa",
"output": "YES"
},
{
"input": "zn",
"output": "NO"
},
{
"input": "ab",
"output": "NO"
},
{
"input": "aaaaaaaaaa",
"output": "YES"
},
{
"input": "aaaaaaaaab",
"output": "NO"
},
{
"input": "aaaaaaaaan",
"output": "YES"
},
{
"input": "baaaaaaaaa",
"output": "YES"
},
{
"input": "naaaaaaaaa",
"output": "YES"
},
{
"input": "nbaaaaaaaa",
"output": "YES"
},
{
"input": "bbaaaaaaaa",
"output": "NO"
},
{
"input": "bnaaaaaaaa",
"output": "NO"
},
{
"input": "eonwonojannonnufimiiniewuqaienokacevecinfuqihatenhunliquuyebayiaenifuexuanenuaounnboancaeowonu",
"output": "YES"
},
{
"input": "uixinnepnlinqaingieianndeakuniooudidonnnqeaituioeneiroionxuowudiooonayenfeonuino",
"output": "NO"
},
{
"input": "nnnnnyigaveteononnnnxaalenxuiiwannntoxonyoqonlejuoxuoconnnentoinnul",
"output": "NO"
},
{
"input": "ndonneasoiunhomuunnhuitonnntunntoanerekonoupunanuauenu",
"output": "YES"
},
{
"input": "anujemogawautiedoneobninnibonuunaoennnyoorufonxionntinimiboonununnnnnleenqunminzayoutanlalo",
"output": "NO"
},
{
"input": "y",
"output": "NO"
},
{
"input": "by",
"output": "NO"
},
{
"input": "yy",
"output": "NO"
},
{
"input": "nbn",
"output": "NO"
},
{
"input": "nz",
"output": "NO"
},
{
"input": "king",
"output": "NO"
},
{
"input": "g",
"output": "NO"
},
{
"input": "az",
"output": "NO"
},
{
"input": "x",
"output": "NO"
},
{
"input": "z",
"output": "NO"
},
{
"input": "yn",
"output": "NO"
},
{
"input": "aeo",
"output": "YES"
},
{
"input": "nb",
"output": "NO"
},
{
"input": "npn",
"output": "NO"
},
{
"input": "kini",
"output": "YES"
},
{
"input": "pya",
"output": "NO"
},
{
"input": "m",
"output": "NO"
},
{
"input": "p",
"output": "NO"
},
{
"input": "aaaaaaaak",
"output": "NO"
},
{
"input": "aab",
"output": "NO"
},
{
"input": "d",
"output": "NO"
},
{
"input": "at",
"output": "NO"
},
{
"input": "aaaaaak",
"output": "NO"
},
{
"input": "aaz",
"output": "NO"
},
{
"input": "aaab",
"output": "NO"
},
{
"input": "s",
"output": "NO"
},
{
"input": "nzzen",
"output": "NO"
},
{
"input": "aeionnhhhn",
"output": "NO"
},
{
"input": "h",
"output": "NO"
},
{
"input": "ny",
"output": "NO"
}
] | 1,638,315,578
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 62
| 0
|
string=input().lower()
consonants=['b','c','d','f','g','h','j','k','l','m','p','q','r','s','t','v','w','x','y','z']
vowels=['a','e','i','o','u']
ber='YES'
for n in range(len(string)-1):
if string[n] in consonants:
if string[n+1] not in vowels:
ber='NO'
if string[-1] in consonants:
ber='NO'
print(ber)
|
Title: Romaji
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
Input Specification:
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
Output Specification:
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
Demo Input:
['sumimasen\n', 'ninja\n', 'codeforces\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
|
```python
string=input().lower()
consonants=['b','c','d','f','g','h','j','k','l','m','p','q','r','s','t','v','w','x','y','z']
vowels=['a','e','i','o','u']
ber='YES'
for n in range(len(string)-1):
if string[n] in consonants:
if string[n+1] not in vowels:
ber='NO'
if string[-1] in consonants:
ber='NO'
print(ber)
```
| 3
|
|
282
|
A
|
Bit++
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
|
The first line contains a single integer *n* (1<=β€<=*n*<=β€<=150) β the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter Β«XΒ»). Thus, there are no empty statements. The operation and the variable can be written in any order.
|
Print a single integer β the final value of *x*.
|
[
"1\n++X\n",
"2\nX++\n--X\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "1\n++X",
"output": "1"
},
{
"input": "2\nX++\n--X",
"output": "0"
},
{
"input": "3\n++X\n++X\n++X",
"output": "3"
},
{
"input": "2\n--X\n--X",
"output": "-2"
},
{
"input": "5\n++X\n--X\n++X\n--X\n--X",
"output": "-1"
},
{
"input": "28\nX--\n++X\nX++\nX++\nX++\n--X\n--X\nX++\nX--\n++X\nX++\n--X\nX--\nX++\nX--\n++X\n++X\nX++\nX++\nX++\nX++\n--X\n++X\n--X\n--X\n--X\n--X\nX++",
"output": "4"
},
{
"input": "94\nX++\nX++\n++X\n++X\nX--\n--X\nX++\n--X\nX++\n++X\nX++\n++X\n--X\n--X\n++X\nX++\n--X\nX--\nX--\n--X\nX--\nX--\n--X\n++X\n--X\nX--\nX--\nX++\n++X\n--X\nX--\n++X\n--X\n--X\nX--\nX--\nX++\nX++\nX--\nX++\nX--\nX--\nX--\n--X\nX--\nX--\nX--\nX++\n++X\nX--\n++X\nX++\n--X\n--X\n--X\n--X\n++X\nX--\n--X\n--X\n++X\nX--\nX--\nX++\n++X\nX++\n++X\n--X\n--X\nX--\n++X\nX--\nX--\n++X\n++X\n++X\n++X\nX++\n++X\n--X\nX++\n--X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\nX--\nX--\n--X\n++X\nX++",
"output": "-10"
},
{
"input": "56\n--X\nX--\n--X\n--X\nX--\nX--\n--X\nX++\n++X\n--X\nX++\nX--\n--X\n++X\n--X\nX--\nX--\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\n++X\nX++\nX++\n--X\nX++\nX--\n--X\nX--\n--X\nX++\n++X\n--X\n++X\nX++\nX--\n--X\n--X\n++X\nX--\nX--\n--X\nX--\n--X\nX++\n--X\n++X\n--X",
"output": "-14"
},
{
"input": "59\nX--\n--X\nX++\n++X\nX--\n--X\n--X\n++X\n++X\n++X\n++X\nX++\n++X\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX++\n--X\n++X\nX++\n--X\n--X\nX++\nX++\n--X\nX++\nX++\nX++\nX--\nX--\n--X\nX++\nX--\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\nX--\n++X\n--X\nX++\nX++\nX--\nX++\n++X\nX--\nX++\nX--\nX--\n++X",
"output": "3"
},
{
"input": "87\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\nX--\n++X\n--X\n--X\nX++\n--X\nX--\nX++\n++X\n--X\n++X\n++X\n--X\n++X\n--X\nX--\n++X\n++X\nX--\nX++\nX++\n--X\n--X\n++X\nX--\n--X\n++X\n--X\nX++\n--X\n--X\nX--\n++X\n++X\n--X\nX--\nX--\nX--\nX--\nX--\nX++\n--X\n++X\n--X\nX++\n++X\nX++\n++X\n--X\nX++\n++X\nX--\n--X\nX++\n++X\nX++\nX++\n--X\n--X\n++X\n--X\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX--\n--X\n++X\n++X",
"output": "-5"
},
{
"input": "101\nX++\nX++\nX++\n++X\n--X\nX--\nX++\nX--\nX--\n--X\n--X\n++X\nX++\n++X\n++X\nX--\n--X\n++X\nX++\nX--\n++X\n--X\n--X\n--X\n++X\n--X\n++X\nX++\nX++\n++X\n--X\nX++\nX--\nX++\n++X\n++X\nX--\nX--\nX--\nX++\nX++\nX--\nX--\nX++\n++X\n++X\n++X\n--X\n--X\n++X\nX--\nX--\n--X\n++X\nX--\n++X\nX++\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n++X\n--X\nX++\n++X\nX--\n++X\nX--\n++X\nX++\nX--\n++X\nX++\n--X\nX++\nX++\n++X\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\n++X\n++X\n--X\nX--\nX--\nX--\nX--\n--X\n--X\n--X\n++X\n--X\n--X",
"output": "1"
},
{
"input": "63\n--X\nX--\n++X\n--X\n++X\nX++\n--X\n--X\nX++\n--X\n--X\nX++\nX--\nX--\n--X\n++X\nX--\nX--\nX++\n++X\nX++\nX++\n--X\n--X\n++X\nX--\nX--\nX--\n++X\nX++\nX--\n--X\nX--\n++X\n++X\nX++\n++X\nX++\nX++\n--X\nX--\n++X\nX--\n--X\nX--\nX--\nX--\n++X\n++X\n++X\n++X\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n++X\nX--\n++X\n++X\nX--",
"output": "1"
},
{
"input": "45\n--X\n++X\nX--\n++X\n++X\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX++\n++X\nX--\n++X\n++X\nX--\nX++\nX--\n--X\nX--\n++X\n++X\n--X\n--X\nX--\nX--\n--X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\nX--\n++X\n++X\nX++\nX++\n++X\n++X\nX++",
"output": "-3"
},
{
"input": "21\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX--\nX++\nX--\nX--\nX--\nX++\n++X\nX++\n++X\n--X\nX--\n--X\nX++\n++X",
"output": "1"
},
{
"input": "100\n--X\n++X\nX++\n++X\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\n++X\nX--\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n++X\nX++\n++X\nX--\n--X\n++X\nX--\n--X\n++X\n++X\nX--\nX++\nX++\nX++\n++X\n--X\n++X\nX++\nX--\n++X\n++X\n--X\n++X\nX--\nX--\nX--\nX++\nX--\nX--\nX++\nX++\n--X\nX++\nX++\n--X\nX--\n--X\n++X\n--X\n++X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\n++X\nX++\nX--\nX++\nX--\nX++\nX++\n--X\nX--\nX--\n++X\nX--\n--X\n--X\nX++\n--X\n--X\nX--\nX--\n++X\n++X\nX--\n++X\nX++\n--X\n++X\n++X\nX++\n--X\n--X\nX++",
"output": "8"
},
{
"input": "17\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n--X\nX--\nX++\nX--\n--X\n--X\nX--\n++X\nX--\nX++",
"output": "-1"
},
{
"input": "77\n++X\nX++\n--X\nX--\n--X\n--X\nX--\nX++\nX--\nX++\nX--\n++X\n--X\n--X\n--X\n--X\n++X\nX--\nX++\nX--\n--X\nX--\n--X\nX--\n++X\n--X\n++X\n++X\nX++\nX++\nX--\n--X\nX--\nX--\nX++\n--X\n--X\n++X\nX--\nX--\n++X\nX++\nX--\n++X\n--X\nX++\nX--\n++X\n++X\n++X\nX--\nX--\nX--\n--X\n++X\n++X\n++X\nX++\n--X\n--X\n++X\n--X\nX--\nX++\n++X\nX++\n++X\nX--\nX++\nX++\n--X\nX++\nX++\nX++\n--X\nX++\nX--",
"output": "-5"
},
{
"input": "21\nX--\n++X\n--X\nX--\n++X\nX--\n++X\nX--\n--X\n++X\nX++\n++X\nX++\n++X\nX--\n--X\nX++\nX++\nX--\n++X\nX--",
"output": "1"
},
{
"input": "1\nX--",
"output": "-1"
}
] | 1,699,879,770
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 46
| 0
|
#n is number of statement in the program
x=0
n=int(input())
for i in range(n):
stmt=input().lower()
if stmt=='++x' or stmt=='x++':
x+=1
elif stmt=='--x' or stmt=='x--':
x+=-1
print(x)
|
Title: Bit++
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
Input Specification:
The first line contains a single integer *n* (1<=β€<=*n*<=β€<=150) β the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter Β«XΒ»). Thus, there are no empty statements. The operation and the variable can be written in any order.
Output Specification:
Print a single integer β the final value of *x*.
Demo Input:
['1\n++X\n', '2\nX++\n--X\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
#n is number of statement in the program
x=0
n=int(input())
for i in range(n):
stmt=input().lower()
if stmt=='++x' or stmt=='x++':
x+=1
elif stmt=='--x' or stmt=='x--':
x+=-1
print(x)
```
| 3
|
|
340
|
C
|
Tourist Problem
|
PROGRAMMING
| 1,600
|
[
"combinatorics",
"implementation",
"math"
] | null | null |
Iahub is a big fan of tourists. He wants to become a tourist himself, so he planned a trip. There are *n* destinations on a straight road that Iahub wants to visit. Iahub starts the excursion from kilometer 0. The *n* destinations are described by a non-negative integers sequence *a*1, *a*2, ..., *a**n*. The number *a**k* represents that the *k*th destination is at distance *a**k* kilometers from the starting point. No two destinations are located in the same place.
Iahub wants to visit each destination only once. Note that, crossing through a destination is not considered visiting, unless Iahub explicitly wants to visit it at that point. Also, after Iahub visits his last destination, he doesn't come back to kilometer 0, as he stops his trip at the last destination.
The distance between destination located at kilometer *x* and next destination, located at kilometer *y*, is |*x*<=-<=*y*| kilometers. We call a "route" an order of visiting the destinations. Iahub can visit destinations in any order he wants, as long as he visits all *n* destinations and he doesn't visit a destination more than once.
Iahub starts writing out on a paper all possible routes and for each of them, he notes the total distance he would walk. He's interested in the average number of kilometers he would walk by choosing a route. As he got bored of writing out all the routes, he asks you to help him.
|
The first line contains integer *n* (2<=β€<=*n*<=β€<=105). Next line contains *n* distinct integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=107).
|
Output two integers β the numerator and denominator of a fraction which is equal to the wanted average number. The fraction must be irreducible.
|
[
"3\n2 3 5\n"
] |
[
"22 3"
] |
Consider 6 possible routes:
- [2, 3, 5]: total distance traveled: |2 β 0| + |3 β 2| + |5 β 3| = 5; - [2, 5, 3]: |2 β 0| + |5 β 2| + |3 β 5| = 7; - [3, 2, 5]: |3 β 0| + |2 β 3| + |5 β 2| = 7; - [3, 5, 2]: |3 β 0| + |5 β 3| + |2 β 5| = 8; - [5, 2, 3]: |5 β 0| + |2 β 5| + |3 β 2| = 9; - [5, 3, 2]: |5 β 0| + |3 β 5| + |2 β 3| = 8.
The average travel distance is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/29119d3733c79f70eb2d77186ac1606bf938508a.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ee9d5516ed2ca1d2b65ed21f8a64f58f94954c30.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ed5cc8cb7dd43cfb27f2459586062538e44de7bd.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 2,000
|
[
{
"input": "3\n2 3 5",
"output": "22 3"
},
{
"input": "4\n1 5 77 2",
"output": "547 4"
},
{
"input": "5\n3 3842 288 199 334",
"output": "35918 5"
},
{
"input": "7\n1 2 3 40 52 33 86",
"output": "255 1"
},
{
"input": "7\n1 10 100 1000 10000 1000000 10000000",
"output": "139050619 7"
},
{
"input": "6\n3835302 971984 8706888 1080445 2224695 1093317",
"output": "114053569 6"
},
{
"input": "40\n8995197 7520501 942559 8012058 3749344 3471059 9817796 3187774 4735591 6477783 7024598 3155420 6039802 2879311 2738670 5930138 4604402 7772492 6089337 317953 4598621 6924769 455347 4360383 1441848 9189601 1838826 5027295 9248947 7562916 8341568 4690450 6877041 507074 2390889 8405736 4562116 2755285 3032168 7770391",
"output": "644565018 5"
},
{
"input": "50\n3987477 8934938 4067156 6712855 7269334 5039822 9533601 9335400 5992073 2619268 438734 8620973 4347619 4307947 2249161 815221 7615258 8244100 8341666 5908546 6646952 4812769 6215114 7479369 6290438 5623785 6466133 9953199 3525873 4326034 3510072 8117068 2342953 1717542 9766539 651627 9541804 4518782 7049159 1159304 2892927 8106441 2222088 8240016 6058981 3924422 743755 4621476 1600677 4234884",
"output": "812321046 5"
},
{
"input": "2\n5555 1242323",
"output": "1860707 1"
},
{
"input": "3\n233232 24332 9010101",
"output": "15070247 1"
},
{
"input": "3\n4054378 7133183 7979825",
"output": "11623058 1"
},
{
"input": "3\n4663018 4080080 6848370",
"output": "26664628 3"
},
{
"input": "4\n5997728 7557181 7228856 8086019",
"output": "10514045 1"
},
{
"input": "4\n2895920 1685207 308573 3045658",
"output": "13389647 2"
},
{
"input": "5\n1789943 1662788 8254265 2248046 2588605",
"output": "72470111 5"
},
{
"input": "5\n6667561 1662704 5626810 4453455 7011856",
"output": "77072026 5"
}
] | 1,591,173,432
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 528
| 7,577,600
|
#!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Wed Jun 3 11:57:46 2020
@author: shailesh
"""
from math import gcd
def reduce_fraction(x,y):
d = gcd(x,y)
x = x//d
y = y//d
return x,y
N = int(input())
A = [int(i) for i in input().split()]
A.sort()
d0 = A[0]
sum_val = 0
for i in range(N-1):
m_bf = i+2
m_af = N - i - 1
d = A[i+1]-A[i]
# d = 1
sum_val +=m_af*(2*m_bf - 1)*d
# print(A[i],A[i+1],sum_val)
numerator = N*d0 + sum_val
denominator = N
numerator,denominator = reduce_fraction(numerator,denominator)
print(numerator,denominator)
#from itertools import permutations
#perms = list(permutations([2,3,5]))
#
#perms = [(0,) + perm for perm in perms]
#
#d = {}
#d['02'] = 0
#d['23'] = 0
#d['35'] = 0
#for perm in perms:
# for i in range(len(perm)-1):
#
# start_end = [perm[i],perm[i+1]]
# start_end.sort()
# rng = range(start_end[0],start_end[1]+1)
# if 0 in rng and 2 in rng:
# d['02'] +=1
# if 2 in rng and 3 in rng:
# d['23'] += 1
# if 3 in rng and 5 in rng:
# d['35'] +=1
|
Title: Tourist Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub is a big fan of tourists. He wants to become a tourist himself, so he planned a trip. There are *n* destinations on a straight road that Iahub wants to visit. Iahub starts the excursion from kilometer 0. The *n* destinations are described by a non-negative integers sequence *a*1, *a*2, ..., *a**n*. The number *a**k* represents that the *k*th destination is at distance *a**k* kilometers from the starting point. No two destinations are located in the same place.
Iahub wants to visit each destination only once. Note that, crossing through a destination is not considered visiting, unless Iahub explicitly wants to visit it at that point. Also, after Iahub visits his last destination, he doesn't come back to kilometer 0, as he stops his trip at the last destination.
The distance between destination located at kilometer *x* and next destination, located at kilometer *y*, is |*x*<=-<=*y*| kilometers. We call a "route" an order of visiting the destinations. Iahub can visit destinations in any order he wants, as long as he visits all *n* destinations and he doesn't visit a destination more than once.
Iahub starts writing out on a paper all possible routes and for each of them, he notes the total distance he would walk. He's interested in the average number of kilometers he would walk by choosing a route. As he got bored of writing out all the routes, he asks you to help him.
Input Specification:
The first line contains integer *n* (2<=β€<=*n*<=β€<=105). Next line contains *n* distinct integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=107).
Output Specification:
Output two integers β the numerator and denominator of a fraction which is equal to the wanted average number. The fraction must be irreducible.
Demo Input:
['3\n2 3 5\n']
Demo Output:
['22 3']
Note:
Consider 6 possible routes:
- [2, 3, 5]: total distance traveled: |2 β 0| + |3 β 2| + |5 β 3| = 5; - [2, 5, 3]: |2 β 0| + |5 β 2| + |3 β 5| = 7; - [3, 2, 5]: |3 β 0| + |2 β 3| + |5 β 2| = 7; - [3, 5, 2]: |3 β 0| + |5 β 3| + |2 β 5| = 8; - [5, 2, 3]: |5 β 0| + |2 β 5| + |3 β 2| = 9; - [5, 3, 2]: |5 β 0| + |3 β 5| + |2 β 3| = 8.
The average travel distance is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/29119d3733c79f70eb2d77186ac1606bf938508a.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ee9d5516ed2ca1d2b65ed21f8a64f58f94954c30.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ed5cc8cb7dd43cfb27f2459586062538e44de7bd.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
#!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Wed Jun 3 11:57:46 2020
@author: shailesh
"""
from math import gcd
def reduce_fraction(x,y):
d = gcd(x,y)
x = x//d
y = y//d
return x,y
N = int(input())
A = [int(i) for i in input().split()]
A.sort()
d0 = A[0]
sum_val = 0
for i in range(N-1):
m_bf = i+2
m_af = N - i - 1
d = A[i+1]-A[i]
# d = 1
sum_val +=m_af*(2*m_bf - 1)*d
# print(A[i],A[i+1],sum_val)
numerator = N*d0 + sum_val
denominator = N
numerator,denominator = reduce_fraction(numerator,denominator)
print(numerator,denominator)
#from itertools import permutations
#perms = list(permutations([2,3,5]))
#
#perms = [(0,) + perm for perm in perms]
#
#d = {}
#d['02'] = 0
#d['23'] = 0
#d['35'] = 0
#for perm in perms:
# for i in range(len(perm)-1):
#
# start_end = [perm[i],perm[i+1]]
# start_end.sort()
# rng = range(start_end[0],start_end[1]+1)
# if 0 in rng and 2 in rng:
# d['02'] +=1
# if 2 in rng and 3 in rng:
# d['23'] += 1
# if 3 in rng and 5 in rng:
# d['35'] +=1
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=β€<=*n*<=β€<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integerΒ β the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,671,476,320
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 43
| 93
| 1,536,000
|
a = input()
n = len(a)
c = 0
for i in range(n):
if a[i] == 'Q':
for j in range(i + 1, n):
if a[j] == 'A':
for k in range(j + 1, n):
if a[k] == 'Q':
c += 1
print(c)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=β€<=*n*<=β€<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integerΒ β the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
a = input()
n = len(a)
c = 0
for i in range(n):
if a[i] == 'Q':
for j in range(i + 1, n):
if a[j] == 'A':
for k in range(j + 1, n):
if a[k] == 'Q':
c += 1
print(c)
```
| 3
|
|
625
|
C
|
K-special Tables
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"implementation"
] | null | null |
People do many crazy things to stand out in a crowd. Some of them dance, some learn by heart rules of Russian language, some try to become an outstanding competitive programmers, while others collect funny math objects.
Alis is among these collectors. Right now she wants to get one of *k*-special tables. In case you forget, the table *n*<=Γ<=*n* is called *k*-special if the following three conditions are satisfied:
- every integer from 1 to *n*2 appears in the table exactly once; - in each row numbers are situated in increasing order; - the sum of numbers in the *k*-th column is maximum possible.
Your goal is to help Alice and find at least one *k*-special table of size *n*<=Γ<=*n*. Both rows and columns are numbered from 1 to *n*, with rows numbered from top to bottom and columns numbered from left to right.
|
The first line of the input contains two integers *n* and *k* (1<=β€<=*n*<=β€<=500,<=1<=β€<=*k*<=β€<=*n*)Β β the size of the table Alice is looking for and the column that should have maximum possible sum.
|
First print the sum of the integers in the *k*-th column of the required table.
Next *n* lines should contain the description of the table itself: first line should contains *n* elements of the first row, second line should contain *n* elements of the second row and so on.
If there are multiple suitable table, you are allowed to print any.
|
[
"4 1\n",
"5 3\n"
] |
[
"28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16\n",
"85\n5 6 17 18 19\n9 10 23 24 25\n7 8 20 21 22\n3 4 14 15 16\n1 2 11 12 13\n\n"
] |
none
| 1,000
|
[
{
"input": "4 1",
"output": "28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16"
},
{
"input": "5 3",
"output": "85\n1 2 11 12 13\n3 4 14 15 16\n5 6 17 18 19\n7 8 20 21 22\n9 10 23 24 25"
},
{
"input": "1 1",
"output": "1\n1"
},
{
"input": "2 1",
"output": "4\n1 2\n3 4"
},
{
"input": "2 2",
"output": "7\n1 3\n2 4"
},
{
"input": "500 1",
"output": "62375500\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "3 1",
"output": "12\n1 2 3\n4 5 6\n7 8 9"
},
{
"input": "3 2",
"output": "18\n1 4 5\n2 6 7\n3 8 9"
},
{
"input": "3 3",
"output": "24\n1 2 7\n3 4 8\n5 6 9"
},
{
"input": "4 2",
"output": "38\n1 5 6 7\n2 8 9 10\n3 11 12 13\n4 14 15 16"
},
{
"input": "4 3",
"output": "48\n1 2 9 10\n3 4 11 12\n5 6 13 14\n7 8 15 16"
},
{
"input": "4 4",
"output": "58\n1 2 3 13\n4 5 6 14\n7 8 9 15\n10 11 12 16"
},
{
"input": "5 1",
"output": "55\n1 2 3 4 5\n6 7 8 9 10\n11 12 13 14 15\n16 17 18 19 20\n21 22 23 24 25"
},
{
"input": "5 2",
"output": "70\n1 6 7 8 9\n2 10 11 12 13\n3 14 15 16 17\n4 18 19 20 21\n5 22 23 24 25"
},
{
"input": "5 4",
"output": "100\n1 2 3 16 17\n4 5 6 18 19\n7 8 9 20 21\n10 11 12 22 23\n13 14 15 24 25"
},
{
"input": "5 5",
"output": "115\n1 2 3 4 21\n5 6 7 8 22\n9 10 11 12 23\n13 14 15 16 24\n17 18 19 20 25"
},
{
"input": "6 1",
"output": "96\n1 2 3 4 5 6\n7 8 9 10 11 12\n13 14 15 16 17 18\n19 20 21 22 23 24\n25 26 27 28 29 30\n31 32 33 34 35 36"
},
{
"input": "6 2",
"output": "117\n1 7 8 9 10 11\n2 12 13 14 15 16\n3 17 18 19 20 21\n4 22 23 24 25 26\n5 27 28 29 30 31\n6 32 33 34 35 36"
},
{
"input": "6 3",
"output": "138\n1 2 13 14 15 16\n3 4 17 18 19 20\n5 6 21 22 23 24\n7 8 25 26 27 28\n9 10 29 30 31 32\n11 12 33 34 35 36"
},
{
"input": "6 4",
"output": "159\n1 2 3 19 20 21\n4 5 6 22 23 24\n7 8 9 25 26 27\n10 11 12 28 29 30\n13 14 15 31 32 33\n16 17 18 34 35 36"
},
{
"input": "6 5",
"output": "180\n1 2 3 4 25 26\n5 6 7 8 27 28\n9 10 11 12 29 30\n13 14 15 16 31 32\n17 18 19 20 33 34\n21 22 23 24 35 36"
},
{
"input": "6 6",
"output": "201\n1 2 3 4 5 31\n6 7 8 9 10 32\n11 12 13 14 15 33\n16 17 18 19 20 34\n21 22 23 24 25 35\n26 27 28 29 30 36"
},
{
"input": "500 500",
"output": "124875250\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "500 250",
"output": "93562750\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "94 3",
"output": "419898\n1 2 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280\n3 4 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 31..."
},
{
"input": "22 4",
"output": "5863\n1 2 3 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85\n4 5 6 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104\n7 8 9 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123\n10 11 12 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142\n13 14 15 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161\n16 17 18 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180\n19 20 21 181 182 183 184 185 18..."
},
{
"input": "15 12",
"output": "2910\n1 2 3 4 5 6 7 8 9 10 11 166 167 168 169\n12 13 14 15 16 17 18 19 20 21 22 170 171 172 173\n23 24 25 26 27 28 29 30 31 32 33 174 175 176 177\n34 35 36 37 38 39 40 41 42 43 44 178 179 180 181\n45 46 47 48 49 50 51 52 53 54 55 182 183 184 185\n56 57 58 59 60 61 62 63 64 65 66 186 187 188 189\n67 68 69 70 71 72 73 74 75 76 77 190 191 192 193\n78 79 80 81 82 83 84 85 86 87 88 194 195 196 197\n89 90 91 92 93 94 95 96 97 98 99 198 199 200 201\n100 101 102 103 104 105 106 107 108 109 110 202 203 204 205\n111..."
},
{
"input": "37 35",
"output": "48581\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 1259 1260 1261\n35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 1262 1263 1264\n69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 1265 1266 1267\n103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 1268 1269 1270\n137 ..."
},
{
"input": "87 51",
"output": "516954\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387\n51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 4388 4389 4390 4391 4392 ..."
},
{
"input": "15 4",
"output": "1950\n1 2 3 46 47 48 49 50 51 52 53 54 55 56 57\n4 5 6 58 59 60 61 62 63 64 65 66 67 68 69\n7 8 9 70 71 72 73 74 75 76 77 78 79 80 81\n10 11 12 82 83 84 85 86 87 88 89 90 91 92 93\n13 14 15 94 95 96 97 98 99 100 101 102 103 104 105\n16 17 18 106 107 108 109 110 111 112 113 114 115 116 117\n19 20 21 118 119 120 121 122 123 124 125 126 127 128 129\n22 23 24 130 131 132 133 134 135 136 137 138 139 140 141\n25 26 27 142 143 144 145 146 147 148 149 150 151 152 153\n28 29 30 154 155 156 157 158 159 160 161 162 1..."
},
{
"input": "183 2",
"output": "3064518\n1 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 ..."
},
{
"input": "103 6",
"output": "567942\n1 2 3 4 5 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613\n6 7 8 9 10 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 6..."
},
{
"input": "131 11",
"output": "1202056\n1 2 3 4 5 6 7 8 9 10 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1..."
},
{
"input": "193 186",
"output": "7039482\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "117 109",
"output": "1539603\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 12637 12638 12639 12640 12641 12642 12643 12644 12645\n109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139..."
},
{
"input": "116 91",
"output": "1384576\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466\n91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 1..."
},
{
"input": "140 79",
"output": "2132200\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 1..."
},
{
"input": "350 14",
"output": "22175125\n1 2 3 4 5 6 7 8 9 10 11 12 13 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4..."
},
{
"input": "374 9",
"output": "26648248\n1 2 3 4 5 6 7 8 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 ..."
},
{
"input": "265 255",
"output": "18222195\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "289 287",
"output": "24012143\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "276 11",
"output": "10856736\n1 2 3 4 5 6 7 8 9 10 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 ..."
},
{
"input": "204 7",
"output": "4349688\n1 2 3 4 5 6 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 ..."
},
{
"input": "425 15",
"output": "39560275\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 604..."
},
{
"input": "449 6",
"output": "45664198\n1 2 3 4 5 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2..."
},
{
"input": "477 19",
"output": "56204433\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8..."
},
{
"input": "448 437",
"output": "88708928\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "472 459",
"output": "103591728\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "500 494",
"output": "124123750\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "462 318",
"output": "83103405\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "486 481",
"output": "114081696\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "410 361",
"output": "64708660\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
}
] | 1,657,818,548
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 52
| 93
| 4,608,000
|
import sys
input = sys.stdin.readline
n, k = map(int, input().split())
d = [[0]*n for _ in range(n)]
x = (k-1)*n + 1
c = 1
if k > 1:
for i in range(n):
for j in range(k-1):
d[i][j] = c
c += 1
for i in range(n):
for j in range(k-1, n):
d[i][j] = c
c += 1
print(sum(d[i][k-1] for i in range(n)))
for i in d:
print(' '.join(map(str, i)))
|
Title: K-special Tables
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
People do many crazy things to stand out in a crowd. Some of them dance, some learn by heart rules of Russian language, some try to become an outstanding competitive programmers, while others collect funny math objects.
Alis is among these collectors. Right now she wants to get one of *k*-special tables. In case you forget, the table *n*<=Γ<=*n* is called *k*-special if the following three conditions are satisfied:
- every integer from 1 to *n*2 appears in the table exactly once; - in each row numbers are situated in increasing order; - the sum of numbers in the *k*-th column is maximum possible.
Your goal is to help Alice and find at least one *k*-special table of size *n*<=Γ<=*n*. Both rows and columns are numbered from 1 to *n*, with rows numbered from top to bottom and columns numbered from left to right.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=β€<=*n*<=β€<=500,<=1<=β€<=*k*<=β€<=*n*)Β β the size of the table Alice is looking for and the column that should have maximum possible sum.
Output Specification:
First print the sum of the integers in the *k*-th column of the required table.
Next *n* lines should contain the description of the table itself: first line should contains *n* elements of the first row, second line should contain *n* elements of the second row and so on.
If there are multiple suitable table, you are allowed to print any.
Demo Input:
['4 1\n', '5 3\n']
Demo Output:
['28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16\n', '85\n5 6 17 18 19\n9 10 23 24 25\n7 8 20 21 22\n3 4 14 15 16\n1 2 11 12 13\n\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
n, k = map(int, input().split())
d = [[0]*n for _ in range(n)]
x = (k-1)*n + 1
c = 1
if k > 1:
for i in range(n):
for j in range(k-1):
d[i][j] = c
c += 1
for i in range(n):
for j in range(k-1, n):
d[i][j] = c
c += 1
print(sum(d[i][k-1] for i in range(n)))
for i in d:
print(' '.join(map(str, i)))
```
| 3
|
|
1,006
|
A
|
Adjacent Replacements
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Mishka got an integer array $a$ of length $n$ as a birthday present (what a surprise!).
Mishka doesn't like this present and wants to change it somehow. He has invented an algorithm and called it "Mishka's Adjacent Replacements Algorithm". This algorithm can be represented as a sequence of steps:
- Replace each occurrence of $1$ in the array $a$ with $2$; - Replace each occurrence of $2$ in the array $a$ with $1$; - Replace each occurrence of $3$ in the array $a$ with $4$; - Replace each occurrence of $4$ in the array $a$ with $3$; - Replace each occurrence of $5$ in the array $a$ with $6$; - Replace each occurrence of $6$ in the array $a$ with $5$; - $\dots$ - Replace each occurrence of $10^9 - 1$ in the array $a$ with $10^9$; - Replace each occurrence of $10^9$ in the array $a$ with $10^9 - 1$.
Note that the dots in the middle of this algorithm mean that Mishka applies these replacements for each pair of adjacent integers ($2i - 1, 2i$) for each $i \in\{1, 2, \ldots, 5 \cdot 10^8\}$ as described above.
For example, for the array $a = [1, 2, 4, 5, 10]$, the following sequence of arrays represents the algorithm:
$[1, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $1$ with $2$) $\rightarrow$ $[2, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $2$ with $1$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $3$ with $4$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $4$ with $3$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $5$ with $6$) $\rightarrow$ $[1, 1, 3, 6, 10]$ $\rightarrow$ (replace all occurrences of $6$ with $5$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ $\dots$ $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $10$ with $9$) $\rightarrow$ $[1, 1, 3, 5, 9]$. The later steps of the algorithm do not change the array.
Mishka is very lazy and he doesn't want to apply these changes by himself. But he is very interested in their result. Help him find it.
|
The first line of the input contains one integer number $n$ ($1 \le n \le 1000$) β the number of elements in Mishka's birthday present (surprisingly, an array).
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) β the elements of the array.
|
Print $n$ integers β $b_1, b_2, \dots, b_n$, where $b_i$ is the final value of the $i$-th element of the array after applying "Mishka's Adjacent Replacements Algorithm" to the array $a$. Note that you cannot change the order of elements in the array.
|
[
"5\n1 2 4 5 10\n",
"10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000\n"
] |
[
"1 1 3 5 9\n",
"9999 9 50605065 1 5 89 5 999999999 60506055 999999999\n"
] |
The first example is described in the problem statement.
| 0
|
[
{
"input": "5\n1 2 4 5 10",
"output": "1 1 3 5 9"
},
{
"input": "10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000",
"output": "9999 9 50605065 1 5 89 5 999999999 60506055 999999999"
},
{
"input": "1\n999999999",
"output": "999999999"
},
{
"input": "1\n1000000000",
"output": "999999999"
},
{
"input": "1\n210400",
"output": "210399"
},
{
"input": "5\n100000000 100000000 100000000 100000000 100000000",
"output": "99999999 99999999 99999999 99999999 99999999"
},
{
"input": "1\n2441139",
"output": "2441139"
},
{
"input": "2\n2 2",
"output": "1 1"
},
{
"input": "3\n2 2 2",
"output": "1 1 1"
},
{
"input": "2\n4 4",
"output": "3 3"
}
] | 1,598,864,624
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 93
| 6,963,200
|
n = int(input())
a = [int(s) for s in input().split(' ')]
b = [str(c - ((c + 1) % 2)) for c in a]
print(' '.join(b))
|
Title: Adjacent Replacements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka got an integer array $a$ of length $n$ as a birthday present (what a surprise!).
Mishka doesn't like this present and wants to change it somehow. He has invented an algorithm and called it "Mishka's Adjacent Replacements Algorithm". This algorithm can be represented as a sequence of steps:
- Replace each occurrence of $1$ in the array $a$ with $2$; - Replace each occurrence of $2$ in the array $a$ with $1$; - Replace each occurrence of $3$ in the array $a$ with $4$; - Replace each occurrence of $4$ in the array $a$ with $3$; - Replace each occurrence of $5$ in the array $a$ with $6$; - Replace each occurrence of $6$ in the array $a$ with $5$; - $\dots$ - Replace each occurrence of $10^9 - 1$ in the array $a$ with $10^9$; - Replace each occurrence of $10^9$ in the array $a$ with $10^9 - 1$.
Note that the dots in the middle of this algorithm mean that Mishka applies these replacements for each pair of adjacent integers ($2i - 1, 2i$) for each $i \in\{1, 2, \ldots, 5 \cdot 10^8\}$ as described above.
For example, for the array $a = [1, 2, 4, 5, 10]$, the following sequence of arrays represents the algorithm:
$[1, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $1$ with $2$) $\rightarrow$ $[2, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $2$ with $1$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $3$ with $4$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $4$ with $3$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $5$ with $6$) $\rightarrow$ $[1, 1, 3, 6, 10]$ $\rightarrow$ (replace all occurrences of $6$ with $5$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ $\dots$ $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $10$ with $9$) $\rightarrow$ $[1, 1, 3, 5, 9]$. The later steps of the algorithm do not change the array.
Mishka is very lazy and he doesn't want to apply these changes by himself. But he is very interested in their result. Help him find it.
Input Specification:
The first line of the input contains one integer number $n$ ($1 \le n \le 1000$) β the number of elements in Mishka's birthday present (surprisingly, an array).
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) β the elements of the array.
Output Specification:
Print $n$ integers β $b_1, b_2, \dots, b_n$, where $b_i$ is the final value of the $i$-th element of the array after applying "Mishka's Adjacent Replacements Algorithm" to the array $a$. Note that you cannot change the order of elements in the array.
Demo Input:
['5\n1 2 4 5 10\n', '10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000\n']
Demo Output:
['1 1 3 5 9\n', '9999 9 50605065 1 5 89 5 999999999 60506055 999999999\n']
Note:
The first example is described in the problem statement.
|
```python
n = int(input())
a = [int(s) for s in input().split(' ')]
b = [str(c - ((c + 1) % 2)) for c in a]
print(' '.join(b))
```
| 3
|
|
443
|
A
|
Anton and Letters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
|
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
|
Print a single number β the number of distinct letters in Anton's set.
|
[
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] |
[
"3\n",
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,692,772,851
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 27
| 93
| 0
|
a = input()
p=[]
for i in a:
if(i.isalpha()==True):
p.append(i)
s=list(set(p))
print(len(s))
|
Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number β the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none
|
```python
a = input()
p=[]
for i in a:
if(i.isalpha()==True):
p.append(i)
s=list(set(p))
print(len(s))
```
| 3
|
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=β€<=*n*<=β€<=2Β·105)Β β the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,602,629,518
| 418
|
Python 3
|
OK
|
TESTS
| 42
| 108
| 409,600
|
n = int(input())
s = 'bbaa' * (n // 4 + 1)
s = s[:n]
print(s)
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=β€<=*n*<=β€<=2Β·105)Β β the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
n = int(input())
s = 'bbaa' * (n // 4 + 1)
s = s[:n]
print(s)
```
| 3
|
|
242
|
B
|
Big Segment
|
PROGRAMMING
| 1,100
|
[
"implementation",
"sortings"
] | null | null |
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=β€<=*c*<=β€<=*d*<=β€<=*b*.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=105) β the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=β€<=*l**i*<=β€<=*r**i*<=β€<=109) β the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
|
Print a single integer β the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
|
[
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] |
[
"-1\n",
"3\n"
] |
none
| 1,000
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,585,860,422
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 45
| 1,902
| 16,076,800
|
n=int(input())
L=[]
aG=0;
mini = 1000000000
maxi = -1000000000;
for i in range(0,n):
a=input().rstrip().split(' ')
L.append(a)
if int(a[0])<=mini and int(a[1])>=maxi:
G=int(a[0]);
H=int(a[1]);
S=i;
mini = int(a[0])
maxi = int(a[1])
#print(S,mini,maxi)
for i in range(0,len(L)):
A=L[i];
# print(A)
if int(A[0])>=mini and int(A[0])<=maxi and int(A[1])>=mini and int(A[1]) <= maxi:
continue;
else:
aG=1;
break;
# print(i)
if aG==1:
print(-1)
else:
print(S+1);
|
Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=β€<=*c*<=β€<=*d*<=β€<=*b*.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=105) β the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=β€<=*l**i*<=β€<=*r**i*<=β€<=109) β the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer β the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none
|
```python
n=int(input())
L=[]
aG=0;
mini = 1000000000
maxi = -1000000000;
for i in range(0,n):
a=input().rstrip().split(' ')
L.append(a)
if int(a[0])<=mini and int(a[1])>=maxi:
G=int(a[0]);
H=int(a[1]);
S=i;
mini = int(a[0])
maxi = int(a[1])
#print(S,mini,maxi)
for i in range(0,len(L)):
A=L[i];
# print(A)
if int(A[0])>=mini and int(A[0])<=maxi and int(A[1])>=mini and int(A[1]) <= maxi:
continue;
else:
aG=1;
break;
# print(i)
if aG==1:
print(-1)
else:
print(S+1);
```
| 3
|
|
946
|
A
|
Partition
|
PROGRAMMING
| 800
|
[
"greedy"
] | null | null |
You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences.
Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*?
|
The first line contains one integer *n* (1<=β€<=*n*<=β€<=100) β the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=β€<=*a**i*<=β€<=100) β the elements of sequence *a*.
|
Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*.
|
[
"3\n1 -2 0\n",
"6\n16 23 16 15 42 8\n"
] |
[
"3\n",
"120\n"
] |
In the first example we may choose *b*β=β{1,β0}, *c*β=β{β-β2}. Then *B*β=β1, *C*β=ββ-β2, *B*β-β*C*β=β3.
In the second example we choose *b*β=β{16,β23,β16,β15,β42,β8}, *c*β=β{} (an empty sequence). Then *B*β=β120, *C*β=β0, *B*β-β*C*β=β120.
| 0
|
[
{
"input": "3\n1 -2 0",
"output": "3"
},
{
"input": "6\n16 23 16 15 42 8",
"output": "120"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "100\n-100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100",
"output": "10000"
},
{
"input": "2\n-1 5",
"output": "6"
},
{
"input": "3\n-2 0 1",
"output": "3"
},
{
"input": "12\n-1 -2 -3 4 4 -6 -6 56 3 3 -3 3",
"output": "94"
},
{
"input": "4\n1 -1 1 -1",
"output": "4"
},
{
"input": "4\n100 -100 100 -100",
"output": "400"
},
{
"input": "3\n-2 -5 10",
"output": "17"
},
{
"input": "5\n1 -2 3 -4 5",
"output": "15"
},
{
"input": "3\n-100 100 -100",
"output": "300"
},
{
"input": "6\n1 -1 1 -1 1 -1",
"output": "6"
},
{
"input": "6\n2 -2 2 -2 2 -2",
"output": "12"
},
{
"input": "9\n12 93 -2 0 0 0 3 -3 -9",
"output": "122"
},
{
"input": "6\n-1 2 4 -5 -3 55",
"output": "70"
},
{
"input": "6\n-12 8 68 -53 1 -15",
"output": "157"
},
{
"input": "2\n-2 1",
"output": "3"
},
{
"input": "3\n100 -100 100",
"output": "300"
},
{
"input": "5\n100 100 -1 -100 2",
"output": "303"
},
{
"input": "6\n-5 -4 -3 -2 -1 0",
"output": "15"
},
{
"input": "6\n4 4 4 -3 -3 2",
"output": "20"
},
{
"input": "2\n-1 2",
"output": "3"
},
{
"input": "1\n100",
"output": "100"
},
{
"input": "5\n-1 -2 3 1 2",
"output": "9"
},
{
"input": "5\n100 -100 100 -100 100",
"output": "500"
},
{
"input": "5\n1 -1 1 -1 1",
"output": "5"
},
{
"input": "4\n0 0 0 -1",
"output": "1"
},
{
"input": "5\n100 -100 -1 2 100",
"output": "303"
},
{
"input": "2\n75 0",
"output": "75"
},
{
"input": "4\n55 56 -59 -58",
"output": "228"
},
{
"input": "2\n9 71",
"output": "80"
},
{
"input": "2\n9 70",
"output": "79"
},
{
"input": "2\n9 69",
"output": "78"
},
{
"input": "2\n100 -100",
"output": "200"
},
{
"input": "4\n-9 4 -9 5",
"output": "27"
},
{
"input": "42\n91 -27 -79 -56 80 -93 -23 10 80 94 61 -89 -64 81 34 99 31 -32 -69 92 79 -9 73 66 -8 64 99 99 58 -19 -40 21 1 -33 93 -23 -62 27 55 41 57 36",
"output": "2348"
},
{
"input": "7\n-1 2 2 2 -1 2 -1",
"output": "11"
},
{
"input": "6\n-12 8 17 -69 7 -88",
"output": "201"
},
{
"input": "3\n1 -2 5",
"output": "8"
},
{
"input": "6\n-2 3 -4 5 6 -1",
"output": "21"
},
{
"input": "2\n-5 1",
"output": "6"
},
{
"input": "4\n2 2 -2 4",
"output": "10"
},
{
"input": "68\n21 47 -75 -25 64 83 83 -21 89 24 43 44 -35 34 -42 92 -96 -52 -66 64 14 -87 25 -61 -78 83 -96 -18 95 83 -93 -28 75 49 87 65 -93 -69 -2 95 -24 -36 -61 -71 88 -53 -93 -51 -81 -65 -53 -46 -56 6 65 58 19 100 57 61 -53 44 -58 48 -8 80 -88 72",
"output": "3991"
},
{
"input": "5\n5 5 -10 -1 1",
"output": "22"
},
{
"input": "3\n-1 2 3",
"output": "6"
},
{
"input": "76\n57 -38 -48 -81 93 -32 96 55 -44 2 38 -46 42 64 71 -73 95 31 -39 -62 -1 75 -17 57 28 52 12 -11 82 -84 59 -86 73 -97 34 97 -57 -85 -6 39 -5 -54 95 24 -44 35 -18 9 91 7 -22 -61 -80 54 -40 74 -90 15 -97 66 -52 -49 -24 65 21 -93 -29 -24 -4 -1 76 -93 7 -55 -53 1",
"output": "3787"
},
{
"input": "5\n-1 -2 1 2 3",
"output": "9"
},
{
"input": "4\n2 2 -2 -2",
"output": "8"
},
{
"input": "6\n100 -100 100 -100 100 -100",
"output": "600"
},
{
"input": "100\n-59 -33 34 0 69 24 -22 58 62 -36 5 45 -19 -73 61 -9 95 42 -73 -64 91 -96 2 53 -8 82 -79 16 18 -5 -53 26 71 38 -31 12 -33 -1 -65 -6 3 -89 22 33 -27 -36 41 11 -47 -32 47 -56 -38 57 -63 -41 23 41 29 78 16 -65 90 -58 -12 6 -60 42 -36 -52 -54 -95 -10 29 70 50 -94 1 93 48 -71 -77 -16 54 56 -60 66 76 31 8 44 -61 -74 23 37 38 18 -18 29 41",
"output": "4362"
},
{
"input": "2\n-1 1",
"output": "2"
},
{
"input": "3\n1 -2 100",
"output": "103"
},
{
"input": "5\n1 -2 3 1 2",
"output": "9"
},
{
"input": "10\n100 -10 -100 10 10 10 10 10 10 10",
"output": "280"
},
{
"input": "4\n2 0 -2 4",
"output": "8"
},
{
"input": "4\n3 -3 1 -1",
"output": "8"
},
{
"input": "3\n1 -1 1",
"output": "3"
},
{
"input": "4\n2 5 -2 4",
"output": "13"
},
{
"input": "2\n-2 2",
"output": "4"
},
{
"input": "3\n1 -2 1",
"output": "4"
},
{
"input": "5\n-1 -2 1 1 -1",
"output": "6"
},
{
"input": "4\n-2 0 2 4",
"output": "8"
},
{
"input": "8\n-42 7 87 -16 -5 65 -88 1",
"output": "311"
},
{
"input": "3\n1 -3 4",
"output": "8"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "3\n-1 2 -1",
"output": "4"
},
{
"input": "18\n-21 12 65 66 -24 62 82 35 -45 -47 28 37 5 -32 22 -14 -69 -95",
"output": "761"
},
{
"input": "4\n-1 1 -1 1",
"output": "4"
},
{
"input": "5\n-1 2 1 1 1",
"output": "6"
},
{
"input": "3\n1 1 1",
"output": "3"
}
] | 1,580,799,944
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 72
| 109
| 0
|
n = int(input())
b, c = 0, 0
for i in map(int, input().split()):
if i < 0:
c += i
else:
b += i
print(b - c)
|
Title: Partition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences.
Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*?
Input Specification:
The first line contains one integer *n* (1<=β€<=*n*<=β€<=100) β the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=β€<=*a**i*<=β€<=100) β the elements of sequence *a*.
Output Specification:
Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*.
Demo Input:
['3\n1 -2 0\n', '6\n16 23 16 15 42 8\n']
Demo Output:
['3\n', '120\n']
Note:
In the first example we may choose *b*β=β{1,β0}, *c*β=β{β-β2}. Then *B*β=β1, *C*β=ββ-β2, *B*β-β*C*β=β3.
In the second example we choose *b*β=β{16,β23,β16,β15,β42,β8}, *c*β=β{} (an empty sequence). Then *B*β=β120, *C*β=β0, *B*β-β*C*β=β120.
|
```python
n = int(input())
b, c = 0, 0
for i in map(int, input().split()):
if i < 0:
c += i
else:
b += i
print(b - c)
```
| 3
|
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,633,725,431
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 62
| 6,758,400
|
def main():
s = input()
heidi = "heidi"
j = 0
hasHeidi = 0
for i in s:
if(i == heidi[j]):
if(j < 4):
j += 1
else:
hasHeidi = 1
if(hasHeidi == 0):
print("NO")
else:
print("YES")
if __name__ == '__main__':
main()
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
def main():
s = input()
heidi = "heidi"
j = 0
hasHeidi = 0
for i in s:
if(i == heidi[j]):
if(j < 4):
j += 1
else:
hasHeidi = 1
if(hasHeidi == 0):
print("NO")
else:
print("YES")
if __name__ == '__main__':
main()
```
| 3
|
|
278
|
B
|
New Problem
|
PROGRAMMING
| 1,500
|
[
"brute force",
"strings"
] | null | null |
Coming up with a new problem isn't as easy as many people think. Sometimes it is hard enough to name it. We'll consider a title original if it doesn't occur as a substring in any titles of recent Codeforces problems.
You've got the titles of *n* last problems β the strings, consisting of lowercase English letters. Your task is to find the shortest original title for the new problem. If there are multiple such titles, choose the lexicographically minimum one. Note, that title of the problem can't be an empty string.
A substring *s*[*l*... *r*] (1<=β€<=*l*<=β€<=*r*<=β€<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *s**l**s**l*<=+<=1... *s**r*.
String *x*<==<=*x*1*x*2... *x**p* is lexicographically smaller than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=<<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there exists such number *r* (*r*<=<<=*p*,<=*r*<=<<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=<<=*y**r*<=+<=1. The string characters are compared by their ASCII codes.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=30) β the number of titles you've got to consider. Then follow *n* problem titles, one per line. Each title only consists of lowercase English letters (specifically, it doesn't contain any spaces) and has the length from 1 to 20, inclusive.
|
Print a string, consisting of lowercase English letters β the lexicographically minimum shortest original title.
|
[
"5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear\n",
"4\naa\nbdefghijklmn\nopqrstuvwxyz\nc\n"
] |
[
"j\n",
"ab\n"
] |
In the first sample the first 9 letters of the English alphabet (a, b, c, d, e, f, g, h, i) occur in the problem titles, so the answer is letter j.
In the second sample the titles contain 26 English letters, so the shortest original title cannot have length 1. Title aa occurs as a substring in the first title.
| 1,000
|
[
{
"input": "5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear",
"output": "j"
},
{
"input": "4\naa\nbdefghijklmn\nopqrstuvwxyz\nc",
"output": "ab"
},
{
"input": "1\na",
"output": "b"
},
{
"input": "1\nb",
"output": "a"
},
{
"input": "1\nz",
"output": "a"
},
{
"input": "5\nsplt\nohqykk\nxqpz\nknojbur\npmfm",
"output": "a"
},
{
"input": "2\nrxscdzkkezud\nwjehahqgouqvjienq",
"output": "b"
},
{
"input": "2\nxlaxwpjabtpwddc\ntxwdjmohrrszorrnomc",
"output": "e"
},
{
"input": "1\nepkotfpkkrhhmuipmtdk",
"output": "a"
},
{
"input": "2\nhk\nobsp",
"output": "a"
},
{
"input": "3\nrjnflsbpxqivrcdjptj\nvpojopbwbwbswdu\nrydkiwnugwddcgcrng",
"output": "a"
},
{
"input": "10\nkpmwcdoysw\ngtpr\nkuzoxmiixxbl\ncrgqtuo\njhbplhpklrgwnaugdf\nzuxdaat\naycv\nqwghrkqwkobrgevsjrk\ntdxgc\nlxyzgcmbzulcst",
"output": "ab"
},
{
"input": "30\nwaiphwcqrrinr\no\nqiqehzmgsjdoqd\nkjexeesevrlowxhghq\njudikhzkj\nz\nxo\nlsdzypkfqro\nsshgcxsky\ngecntpcmoojfwp\nsvmytmcfhc\njrsrvsvbaiumlmkptn\ns\nwpcsovfjlyspviflk\nktvyzvddgllht\nszahigtmklglrcocbo\nznligfxkgxzkcfeu\nliryvzmqwhr\nxgrxkgiehxztv\netrjxdczppafly\njrdgajschhwsci\ndoxnxbjwptnimjmsuijx\nzciwkbvrhgsjhrr\nehh\nbzlnmd\nxpbtbpftimnn\nkhbknqbvdkdd\nmldj\nskrvnyz\navptgpjmenfzfxwckmt",
"output": "aa"
},
{
"input": "30\ne\nx\nitaubd\nxcn\nv\nx\ni\nci\naqs\nzbi\nq\ncvdu\na\njos\nqy\nfjf\nnayke\nge\ns\nq\nqwad\ngvz\no\nubn\nnzoc\nh\nwnjwjrf\nt\nbq\nbw",
"output": "l"
},
{
"input": "30\nb\nu\np\nn\nf\nm\nt\ni\nj\nk\np\nh\na\nc\nw\nz\nz\np\nt\nd\no\nw\nu\nq\nl\ny\ni\no\na\nu",
"output": "e"
},
{
"input": "5\nojdfhi\nabcdefghijklmnopqrst\nuvwxyz\nddfhdfhlasjt\nqqq",
"output": "aa"
},
{
"input": "5\ndfijdfhi\nabcdefghijklmnopqrst\nuvwxy\nkopsdfgiopjipw\njty",
"output": "z"
},
{
"input": "5\nzzxpfk\nabcdefghijklmnopqrst\nuvwxz\nsrgkjaskldfkln\nvgnsdfdgfh",
"output": "y"
}
] | 1,571,597,995
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 248
| 0
|
# from dust i have come, dust i will be
n = int(input())
a = []
for i in range(n):
x = input()
a.append(x)
arr = []
for i in range(26):
arr.append(chr(i + ord('a')))
for i in range(26):
for j in range(26):
arr.append(arr[i] + chr(j + ord('a')))
for i in range(len(arr)):
cnt = 0
for j in range(n):
if arr[i] not in a[j]:
cnt += 1
if cnt == n:
print(arr[i])
exit(0)
|
Title: New Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Coming up with a new problem isn't as easy as many people think. Sometimes it is hard enough to name it. We'll consider a title original if it doesn't occur as a substring in any titles of recent Codeforces problems.
You've got the titles of *n* last problems β the strings, consisting of lowercase English letters. Your task is to find the shortest original title for the new problem. If there are multiple such titles, choose the lexicographically minimum one. Note, that title of the problem can't be an empty string.
A substring *s*[*l*... *r*] (1<=β€<=*l*<=β€<=*r*<=β€<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *s**l**s**l*<=+<=1... *s**r*.
String *x*<==<=*x*1*x*2... *x**p* is lexicographically smaller than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=<<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there exists such number *r* (*r*<=<<=*p*,<=*r*<=<<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=<<=*y**r*<=+<=1. The string characters are compared by their ASCII codes.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=30) β the number of titles you've got to consider. Then follow *n* problem titles, one per line. Each title only consists of lowercase English letters (specifically, it doesn't contain any spaces) and has the length from 1 to 20, inclusive.
Output Specification:
Print a string, consisting of lowercase English letters β the lexicographically minimum shortest original title.
Demo Input:
['5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear\n', '4\naa\nbdefghijklmn\nopqrstuvwxyz\nc\n']
Demo Output:
['j\n', 'ab\n']
Note:
In the first sample the first 9 letters of the English alphabet (a, b, c, d, e, f, g, h, i) occur in the problem titles, so the answer is letter j.
In the second sample the titles contain 26 English letters, so the shortest original title cannot have length 1. Title aa occurs as a substring in the first title.
|
```python
# from dust i have come, dust i will be
n = int(input())
a = []
for i in range(n):
x = input()
a.append(x)
arr = []
for i in range(26):
arr.append(chr(i + ord('a')))
for i in range(26):
for j in range(26):
arr.append(arr[i] + chr(j + ord('a')))
for i in range(len(arr)):
cnt = 0
for j in range(n):
if arr[i] not in a[j]:
cnt += 1
if cnt == n:
print(arr[i])
exit(0)
```
| 3
|
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=β€<=*n*<=β€<=2Β·105)Β β the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,596,355,058
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 155
| 21,196,800
|
n = int(input())
thingo=["a","a","b","b"]
print(int(n/4)*"aabb" + "".join(thingo[:n%4]))
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=β€<=*n*<=β€<=2Β·105)Β β the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
n = int(input())
thingo=["a","a","b","b"]
print(int(n/4)*"aabb" + "".join(thingo[:n%4]))
```
| 3
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=β€<=*n*<=β€<=100) β the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=β€<=*a**i*<=β€<=100) β the number of cookies in the *i*-th bag.
|
Print in the only line the only number β the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies β 5β+β3β=β8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2β*β9β+β99β=β117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,656,272,331
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 92
| 4,505,600
|
n = int(input())
a = [int(i) for i in input().split()]
x = sum(a)
counter = 0
for i in range(len(a)):
difference = x - a[i]
if difference % 2 == 0:
counter = counter + 1
print(counter)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=β€<=*n*<=β€<=100) β the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=β€<=*a**i*<=β€<=100) β the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number β the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies β 5β+β3β=β8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2β*β9β+β99β=β117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n = int(input())
a = [int(i) for i in input().split()]
x = sum(a)
counter = 0
for i in range(len(a)):
difference = x - a[i]
if difference % 2 == 0:
counter = counter + 1
print(counter)
```
| 3
|
|
750
|
A
|
New Year and Hurry
|
PROGRAMMING
| 800
|
[
"binary search",
"brute force",
"implementation",
"math"
] | null | null |
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
|
The only line of the input contains two integers *n* and *k* (1<=β€<=*n*<=β€<=10, 1<=β€<=*k*<=β€<=240)Β β the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
|
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
|
[
"3 222\n",
"4 190\n",
"7 1\n"
] |
[
"2\n",
"4\n",
"7\n"
] |
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5β+β10β=β15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5β+β10β+β15β+β20β=β50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
| 500
|
[
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,700,313,373
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 46
| 0
|
Q, min = input().split()
QsolvinTime = 0
count = 0
qmin = 5
for i in range(int(Q)):
QsolvinTime += qmin
if 240 - int(min) >= QsolvinTime:
qmin += 5
count += 1
else:
break
print(count)
|
Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=β€<=*n*<=β€<=10, 1<=β€<=*k*<=β€<=240)Β β the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5β+β10β=β15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5β+β10β+β15β+β20β=β50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
|
```python
Q, min = input().split()
QsolvinTime = 0
count = 0
qmin = 5
for i in range(int(Q)):
QsolvinTime += qmin
if 240 - int(min) >= QsolvinTime:
qmin += 5
count += 1
else:
break
print(count)
```
| 3
|
|
988
|
A
|
Diverse Team
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
|
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) β the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
|
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
|
[
"5 3\n15 13 15 15 12\n",
"5 4\n15 13 15 15 12\n",
"4 4\n20 10 40 30\n"
] |
[
"YES\n1 2 5 \n",
"NO\n",
"YES\n1 2 3 4 \n"
] |
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter.
| 0
|
[
{
"input": "5 3\n15 13 15 15 12",
"output": "YES\n1 2 5 "
},
{
"input": "5 4\n15 13 15 15 12",
"output": "NO"
},
{
"input": "4 4\n20 10 40 30",
"output": "YES\n1 2 3 4 "
},
{
"input": "1 1\n1",
"output": "YES\n1 "
},
{
"input": "100 53\n16 17 1 2 27 5 9 9 53 24 17 33 35 24 20 48 56 73 12 14 39 55 58 13 59 73 29 26 40 33 22 29 34 22 55 38 63 66 36 13 60 42 10 15 21 9 11 5 23 37 79 47 26 3 79 53 44 8 71 75 42 11 34 39 79 33 10 26 23 23 17 14 54 41 60 31 83 5 45 4 14 35 6 60 28 48 23 18 60 36 21 28 7 34 9 25 52 43 54 19",
"output": "YES\n1 2 3 4 5 6 7 9 10 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 33 36 37 38 39 41 42 43 44 45 47 49 50 51 52 54 57 58 59 60 73 74 76 77 79 80 83 "
},
{
"input": "2 2\n100 100",
"output": "NO"
},
{
"input": "2 2\n100 99",
"output": "YES\n1 2 "
},
{
"input": "100 100\n63 100 75 32 53 24 73 98 76 15 70 48 8 81 88 58 95 78 27 92 14 16 72 43 46 39 66 38 64 42 59 9 22 51 4 6 10 94 28 99 68 80 35 50 45 20 47 7 30 26 49 91 77 19 96 57 65 1 11 13 31 12 82 87 93 34 62 3 21 79 56 41 89 18 44 23 74 86 2 33 69 36 61 67 25 83 5 84 90 37 40 29 97 60 52 55 54 71 17 85",
"output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 41\n54 16 42 3 45 6 9 72 100 13 24 57 35 5 89 13 97 27 43 9 73 89 48 16 48 55 18 15 55 28 30 6 18 41 100 61 9 42 35 54 57 25 73 15 42 54 49 5 72 48 30 55 4 43 94 5 60 92 93 23 89 75 53 92 74 93 89 28 69 6 3 49 15 28 49 57 54 55 30 57 69 18 89 6 25 23 93 74 30 13 87 53 6 42 4 54 60 30 4 35",
"output": "NO"
},
{
"input": "100 2\n70 64 70 32 70 64 32 70 64 32 32 64 70 64 64 32 64 64 64 70 70 64 64 64 64 70 32 64 70 64 32 70 70 70 64 70 64 70 64 32 70 32 70 64 64 64 32 70 64 70 70 32 70 32 32 32 70 32 70 32 64 64 70 32 32 64 70 64 32 32 64 64 32 32 70 70 32 70 32 64 32 70 64 64 32 64 32 64 70 32 70 32 70 64 64 64 70 70 64 70",
"output": "YES\n1 2 "
}
] | 1,625,758,791
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 10
| 62
| 0
|
n,k=map(int,input().split())
l=list(map(int,input().split()))
s=set()
for i in range(len(l)):
s.add(l[i])
l1=[i for i in s]
l2=[]
if len(s)>=k:
print("YES")
for i in range(k):
if(l1[i] in l):
l2.append(l.index(l1[i])+1)
l2.sort()
for i in range(len(l2)):
print(l2[i],end=' ')
else:
print("NO")
|
Title: Diverse Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) β the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
Output Specification:
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
Demo Input:
['5 3\n15 13 15 15 12\n', '5 4\n15 13 15 15 12\n', '4 4\n20 10 40 30\n']
Demo Output:
['YES\n1 2 5 \n', 'NO\n', 'YES\n1 2 3 4 \n']
Note:
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter.
|
```python
n,k=map(int,input().split())
l=list(map(int,input().split()))
s=set()
for i in range(len(l)):
s.add(l[i])
l1=[i for i in s]
l2=[]
if len(s)>=k:
print("YES")
for i in range(k):
if(l1[i] in l):
l2.append(l.index(l1[i])+1)
l2.sort()
for i in range(len(l2)):
print(l2[i],end=' ')
else:
print("NO")
```
| 3
|
|
246
|
A
|
Buggy Sorting
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"greedy",
"sortings"
] | null | null |
Little boy Valera studies an algorithm of sorting an integer array. After studying the theory, he went on to the practical tasks. As a result, he wrote a program that sorts an array of *n* integers *a*1,<=*a*2,<=...,<=*a**n* in the non-decreasing order. The pseudocode of the program, written by Valera, is given below. The input of the program gets number *n* and array *a*.
But Valera could have made a mistake, because he hasn't yet fully learned the sorting algorithm. If Valera made a mistake in his program, you need to give a counter-example that makes his program work improperly (that is, the example that makes the program sort the array not in the non-decreasing order). If such example for the given value of *n* doesn't exist, print -1.
|
You've got a single integer *n* (1<=β€<=*n*<=β€<=50) β the size of the sorted array.
|
Print *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=100) β the counter-example, for which Valera's algorithm won't work correctly. If the counter-example that meets the described conditions is impossible to give, print -1.
If there are several counter-examples, consisting of *n* numbers, you are allowed to print any of them.
|
[
"1\n"
] |
[
"-1\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "3 2 1 "
},
{
"input": "4",
"output": "4 3 2 1 "
},
{
"input": "5",
"output": "5 4 3 2 1 "
},
{
"input": "6",
"output": "6 5 4 3 2 1 "
},
{
"input": "7",
"output": "7 6 5 4 3 2 1 "
},
{
"input": "8",
"output": "8 7 6 5 4 3 2 1 "
},
{
"input": "9",
"output": "9 8 7 6 5 4 3 2 1 "
},
{
"input": "50",
"output": "50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "22",
"output": "22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "34",
"output": "34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "50",
"output": "50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "12",
"output": "12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "26",
"output": "26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "38",
"output": "38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "4",
"output": "4 3 2 1 "
},
{
"input": "18",
"output": "18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "30",
"output": "30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "46",
"output": "46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "32",
"output": "32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
}
] | 1,676,717,806
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 46
| 0
|
# LUOGU_RID: 102443681
n = int(input())
if n < 3:
print(-1)
else:
print(*range(n, 0, -1))
|
Title: Buggy Sorting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little boy Valera studies an algorithm of sorting an integer array. After studying the theory, he went on to the practical tasks. As a result, he wrote a program that sorts an array of *n* integers *a*1,<=*a*2,<=...,<=*a**n* in the non-decreasing order. The pseudocode of the program, written by Valera, is given below. The input of the program gets number *n* and array *a*.
But Valera could have made a mistake, because he hasn't yet fully learned the sorting algorithm. If Valera made a mistake in his program, you need to give a counter-example that makes his program work improperly (that is, the example that makes the program sort the array not in the non-decreasing order). If such example for the given value of *n* doesn't exist, print -1.
Input Specification:
You've got a single integer *n* (1<=β€<=*n*<=β€<=50) β the size of the sorted array.
Output Specification:
Print *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=100) β the counter-example, for which Valera's algorithm won't work correctly. If the counter-example that meets the described conditions is impossible to give, print -1.
If there are several counter-examples, consisting of *n* numbers, you are allowed to print any of them.
Demo Input:
['1\n']
Demo Output:
['-1\n']
Note:
none
|
```python
# LUOGU_RID: 102443681
n = int(input())
if n < 3:
print(-1)
else:
print(*range(n, 0, -1))
```
| 3
|
|
544
|
B
|
Sea and Islands
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"implementation"
] | null | null |
A map of some object is a rectangular field consisting of *n* rows and *n* columns. Each cell is initially occupied by the sea but you can cover some some cells of the map with sand so that exactly *k* islands appear on the map. We will call a set of sand cells to be island if it is possible to get from each of them to each of them by moving only through sand cells and by moving from a cell only to a side-adjacent cell. The cells are called to be side-adjacent if they share a vertical or horizontal side. It is easy to see that islands do not share cells (otherwise they together form a bigger island).
Find a way to cover some cells with sand so that exactly *k* islands appear on the *n*<=Γ<=*n* map, or determine that no such way exists.
|
The single line contains two positive integers *n*, *k* (1<=β€<=*n*<=β€<=100, 0<=β€<=*k*<=β€<=*n*2) β the size of the map and the number of islands you should form.
|
If the answer doesn't exist, print "NO" (without the quotes) in a single line.
Otherwise, print "YES" in the first line. In the next *n* lines print the description of the map. Each of the lines of the description must consist only of characters 'S' and 'L', where 'S' is a cell that is occupied by the sea and 'L' is the cell covered with sand. The length of each line of the description must equal *n*.
If there are multiple answers, you may print any of them.
You should not maximize the sizes of islands.
|
[
"5 2\n",
"5 25\n"
] |
[
"YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS\n",
"NO\n"
] |
none
| 1,000
|
[
{
"input": "5 2",
"output": "YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS"
},
{
"input": "5 25",
"output": "NO"
},
{
"input": "82 6047",
"output": "NO"
},
{
"input": "6 5",
"output": "YES\nLSLSLS\nSLSLSS\nSSSSSS\nSSSSSS\nSSSSSS\nSSSSSS"
},
{
"input": "10 80",
"output": "NO"
},
{
"input": "48 1279",
"output": "NO"
},
{
"input": "40 1092",
"output": "NO"
},
{
"input": "9 12",
"output": "YES\nLSLSLSLSL\nSLSLSLSLS\nLSLSLSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS"
},
{
"input": "43 146",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSS..."
},
{
"input": "100 5000",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "100 4999",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "100 5001",
"output": "NO"
},
{
"input": "99 4901",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nS..."
},
{
"input": "99 4900",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nS..."
},
{
"input": "99 4902",
"output": "NO"
},
{
"input": "99 9801",
"output": "NO"
},
{
"input": "99 10",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "99 1",
"output": "YES\nLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "100 10000",
"output": "NO"
},
{
"input": "100 10",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS..."
},
{
"input": "50 1200",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL..."
},
{
"input": "50 1438",
"output": "NO"
},
{
"input": "50 2447",
"output": "NO"
},
{
"input": "49 1719",
"output": "NO"
},
{
"input": "51 1996",
"output": "NO"
},
{
"input": "51 1981",
"output": "NO"
},
{
"input": "34 1060",
"output": "NO"
},
{
"input": "74 3901",
"output": "NO"
},
{
"input": "65 617",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "89 497",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "34 621",
"output": "NO"
},
{
"input": "1 0",
"output": "YES\nS"
},
{
"input": "10 0",
"output": "YES\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS"
},
{
"input": "11 0",
"output": "YES\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS"
},
{
"input": "99 0",
"output": "YES\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "100 0",
"output": "YES\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS..."
},
{
"input": "1 1",
"output": "YES\nL"
},
{
"input": "2 1",
"output": "YES\nLS\nSS"
},
{
"input": "2 0",
"output": "YES\nSS\nSS"
},
{
"input": "2 2",
"output": "YES\nLS\nSL"
},
{
"input": "2 3",
"output": "NO"
},
{
"input": "2 4",
"output": "NO"
}
] | 1,574,799,916
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 124
| 307,200
|
import sys
input = sys.stdin.readline
read_tuple = lambda _type: map(_type, input().split(' '))
def solve():
n, k = read_tuple(int)
grid = [['S' for _ in range(n)] for _ in range(n)]
flag = True
for i in range(n):
for j in range(n):
if k and flag:
grid[i][j] = 'L'
k -= 1
flag ^= True
if n % 2 == 0:
flag ^= True
if k == 0:
print("YES")
else:
print("NO")
if k == 0:
for row in grid:
print(''.join(row))
if __name__ == '__main__':
solve()
|
Title: Sea and Islands
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A map of some object is a rectangular field consisting of *n* rows and *n* columns. Each cell is initially occupied by the sea but you can cover some some cells of the map with sand so that exactly *k* islands appear on the map. We will call a set of sand cells to be island if it is possible to get from each of them to each of them by moving only through sand cells and by moving from a cell only to a side-adjacent cell. The cells are called to be side-adjacent if they share a vertical or horizontal side. It is easy to see that islands do not share cells (otherwise they together form a bigger island).
Find a way to cover some cells with sand so that exactly *k* islands appear on the *n*<=Γ<=*n* map, or determine that no such way exists.
Input Specification:
The single line contains two positive integers *n*, *k* (1<=β€<=*n*<=β€<=100, 0<=β€<=*k*<=β€<=*n*2) β the size of the map and the number of islands you should form.
Output Specification:
If the answer doesn't exist, print "NO" (without the quotes) in a single line.
Otherwise, print "YES" in the first line. In the next *n* lines print the description of the map. Each of the lines of the description must consist only of characters 'S' and 'L', where 'S' is a cell that is occupied by the sea and 'L' is the cell covered with sand. The length of each line of the description must equal *n*.
If there are multiple answers, you may print any of them.
You should not maximize the sizes of islands.
Demo Input:
['5 2\n', '5 25\n']
Demo Output:
['YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS\n', 'NO\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
read_tuple = lambda _type: map(_type, input().split(' '))
def solve():
n, k = read_tuple(int)
grid = [['S' for _ in range(n)] for _ in range(n)]
flag = True
for i in range(n):
for j in range(n):
if k and flag:
grid[i][j] = 'L'
k -= 1
flag ^= True
if n % 2 == 0:
flag ^= True
if k == 0:
print("YES")
else:
print("NO")
if k == 0:
for row in grid:
print(''.join(row))
if __name__ == '__main__':
solve()
```
| 3
|
|
690
|
F1
|
Tree of Life (easy)
|
PROGRAMMING
| 1,300
|
[] | null | null |
Heidi has finally found the mythical Tree of Life β a legendary combinatorial structure which is said to contain a prophecy crucially needed to defeat the undead armies.
On the surface, the Tree of Life is just a regular undirected tree well-known from computer science. This means that it is a collection of *n* points (called vertices), some of which are connected using *n*<=-<=1 line segments (edges) so that each pair of vertices is connected by a path (a sequence of one or more edges).
To decipher the prophecy, Heidi needs to perform a number of steps. The first is counting the number of lifelines in the tree β these are paths of length 2, i.e., consisting of two edges. Help her!
|
The first line of the input contains a single integer *n* β the number of vertices in the tree (1<=β€<=*n*<=β€<=10000). The vertices are labeled with the numbers from 1 to *n*. Then *n*<=-<=1 lines follow, each describing one edge using two space-separated numbers *a*β*b* β the labels of the vertices connected by the edge (1<=β€<=*a*<=<<=*b*<=β€<=*n*). It is guaranteed that the input represents a tree.
|
Print one integer β the number of lifelines in the tree.
|
[
"4\n1 2\n1 3\n1 4\n",
"5\n1 2\n2 3\n3 4\n3 5\n"
] |
[
"3",
"4"
] |
In the second sample, there are four lifelines: paths between vertices 1 and 3, 2 and 4, 2 and 5, and 4 and 5.
| 0
|
[
{
"input": "4\n1 2\n1 3\n1 4",
"output": "3"
},
{
"input": "5\n1 2\n2 3\n3 4\n3 5",
"output": "4"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "3\n2 1\n3 2",
"output": "1"
},
{
"input": "10\n5 1\n1 2\n9 3\n10 5\n6 3\n8 5\n2 7\n2 3\n9 4",
"output": "11"
}
] | 1,490,269,770
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 93
| 4,812,800
|
n = int(input())
t = [0] * n
out = 0
for _ in range(n-1):
a, b = input().split(' ')
a, b = [int(a), int(b)]
t[a-1] += 1
t[b-1] += 1
for x in t:
out += x * (x-1) / 2
print(int(out))
|
Title: Tree of Life (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Heidi has finally found the mythical Tree of Life β a legendary combinatorial structure which is said to contain a prophecy crucially needed to defeat the undead armies.
On the surface, the Tree of Life is just a regular undirected tree well-known from computer science. This means that it is a collection of *n* points (called vertices), some of which are connected using *n*<=-<=1 line segments (edges) so that each pair of vertices is connected by a path (a sequence of one or more edges).
To decipher the prophecy, Heidi needs to perform a number of steps. The first is counting the number of lifelines in the tree β these are paths of length 2, i.e., consisting of two edges. Help her!
Input Specification:
The first line of the input contains a single integer *n* β the number of vertices in the tree (1<=β€<=*n*<=β€<=10000). The vertices are labeled with the numbers from 1 to *n*. Then *n*<=-<=1 lines follow, each describing one edge using two space-separated numbers *a*β*b* β the labels of the vertices connected by the edge (1<=β€<=*a*<=<<=*b*<=β€<=*n*). It is guaranteed that the input represents a tree.
Output Specification:
Print one integer β the number of lifelines in the tree.
Demo Input:
['4\n1 2\n1 3\n1 4\n', '5\n1 2\n2 3\n3 4\n3 5\n']
Demo Output:
['3', '4']
Note:
In the second sample, there are four lifelines: paths between vertices 1 and 3, 2 and 4, 2 and 5, and 4 and 5.
|
```python
n = int(input())
t = [0] * n
out = 0
for _ in range(n-1):
a, b = input().split(' ')
a, b = [int(a), int(b)]
t[a-1] += 1
t[b-1] += 1
for x in t:
out += x * (x-1) / 2
print(int(out))
```
| 3
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=1000) β the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,676,105,198
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 102,400
|
from collections import defaultdict, deque, Counter
from heapq import heapify, heappop, heappush
def main():
t = 1
# t = int(input())
for _ in range(t):
run_test_case()
def run_test_case():
n = int(input())
l = list(map(int, input().split()))
sereja = dima = 0
left, right = 0, n - 1
i = 0
while left <= right:
curMax = max(l[left], l[right])
if i % 2 == 0:
sereja += curMax
else:
dima += curMax
if l[left] > l[right]:
left += 1
else:
right -= 1
i += 1
print(sereja, dima)
if __name__ == "__main__":
main()
"""
/* stuff you should look for
* int overflow, array bounds
* special cases (n=1?)
* do smth instead of nothing and stay organized
* WRITE STUFF DOWN
* DON'T GET STUCK ON ONE APPROACH
*/
"""
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=1000) β the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
from collections import defaultdict, deque, Counter
from heapq import heapify, heappop, heappush
def main():
t = 1
# t = int(input())
for _ in range(t):
run_test_case()
def run_test_case():
n = int(input())
l = list(map(int, input().split()))
sereja = dima = 0
left, right = 0, n - 1
i = 0
while left <= right:
curMax = max(l[left], l[right])
if i % 2 == 0:
sereja += curMax
else:
dima += curMax
if l[left] > l[right]:
left += 1
else:
right -= 1
i += 1
print(sereja, dima)
if __name__ == "__main__":
main()
"""
/* stuff you should look for
* int overflow, array bounds
* special cases (n=1?)
* do smth instead of nothing and stay organized
* WRITE STUFF DOWN
* DON'T GET STUCK ON ONE APPROACH
*/
"""
```
| 3
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.