Split (1)

train · 3.61k rows

text stringlengths 21 4k	label stringclasses 2 values
Mike Taylor, University of Wolverhampton, UK; Digital Science. Jenny Ghith, Pfizer, USA Open Access medical research (2011-23): OA journal articles are associated with accelerated research and socio-clinical impact BACKGROUND AND OBJECTIVES • Open Access (OA) has been predicted to accelerate medical science (Woelfle et al., 2011) and expand the audience for research (UNESCO, 2022). • The annual cost of OA publication fees has been estimated to be $2B (Zhang et al., 2022). • Other researchers have identified potential issues with the growth of poor quality OA research (Beall, 2015). • Previous limited research (Holmberg 2019; Taylor, 2023) has reported some advantages for OA publications, however such research has not addressed the phenomena at scale, nor attempted to understand the consequences of the dominance of OA research. CONCLUSIONS • The growth of OA research and the associated impact indicators suggest that OA has increased the overall level of coverage and discussion linked to medical research, and that different forms of OA are not equivalent. • Traditional journals, whether supported with strong preprint (Green) policies or mixed Gold/Bronze OA publishing dominate all forms of impact. • The explosive growth of Gold OA journals is not delivering accelerated impact. • Rates of discourse in News and on X / Twitter have dropped since COVID, although Green maintains a strong advantage. • There is no evidence that the gap between OA and non-OA closes over time. Beall, J. (2015). What the Open-Access Movement Doesn’t Want You to Know. American Association of University Professors. https://www.aaup.org/article/what-open-access-movement-doesn%E2%80%99t-want-you-know Holmberg, K., Hedman, J., Bowman, T. D., Didegah, F., & Laakso, M. (2019). Do articles in open access journals have more frequent altmetric activity than articles in subscription-based journals? An investigation of the research output of Finnish universities. Scientometrics. https://doi.org/10.1007/s11192-019-03301-x Taylor, M. (2023). Slow, slow, quick, quick, slow: five altmetric sources observed over a decade show evolving trends, by research age, attention source maturity and open access status. Scientometrics. https://doi.org/10.1007/S11192-023-04653-1 UNESCO. (2022). Understanding open science. https://doi.org/10.54677/UTCD9302 Woelfle, M., Olliaro, P., & Todd, M. H. (2011). Open science is a research accelerator. Nature Chemistry 2011 3:10, 3(10), 745–748. https://doi.org/10.1038/nchem.1149 Zhang, L., Wei, Y., Huang, Y., & Sivertsen, G. (2022). Should open access lead to closed research? The trends towards paying to perform research. Scientometrics, 127(12), 7653–7679. https://doi.org/10.1007/S11192-022-04407-5/FIGURES/8 Gold in Open Journal Gold in Hybrid Journal Closed with Preprint (Green) Closed Bronze 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 0 100,000 200,000 300,000 400,000 500,000 600,000 700,000 Year of Publication # Publications Explosive growth in Gold in Open Journals over the decade Papers from 2023 still embargoed Increased in paid-for OA, decrease in preprint OA Growth in all forms of OA following federal / national funding policy changes Gold in Open Journal Gold in Hybrid Journal Closed with Preprint (Green) Closed Bronze 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 0.00 1.00 2.00 3.00 4.00 5.00 6.00 7.00 Year of Publication Annual Mean Citations per Year Citations are a lagging indicator, so lower rates expected in recent years, embargo still applies to 2023 publications Increased OA in traditional journals accelerated research during COVID Although in a minority, Green OA in Closed journals out-performs all other OA/non-OA publications Gold in Open Journal Gold in Hybrid Journal Closed with Preprint (Green) Closed Bronze 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 0.00 2.50 5.00 7.50 10.00 12.50 15.00 17.50 20.00 22.50 25.00 Year of Publication Mean Altmetric Attent	poster
12x HWT or 12x K9R ∆HisC ∆HisC Increased chromatin accessibility and gene expression in K9R mutants. A-B) Ratio of K9R to HWT FAIRE-seq (A) or RNA-seq (B) signal prepared from third larval wandering (3LW) imaginal wing discs. Darker color indicates higher density of peaks. Published in Penke et al. (2016). A WT K9R H3 H3K9me3 H3K9me2 WT K9R Reduced H3K9me3 in K9R mutants. A) Immunofluorescence of polytene chromosomes prepared from 3rd instar larval (3LW) salivary glands. Blue, DAPI; Green H3K9me2; red, H3K9me3. Published in Penke et al. (2016). B) Western blot from total cellular histones from whole 3LW larvae. Published in Penke et al. (2016). RNA-seq signal K9R/HWT (log2) B RNA-seq FAIRE-seq A B H3K9me3 Cut-n-Run C B A A chr3R chr3L chr2R chr2R chr2L Future Directions Interrogating the role of the histone mark H3K9me3 in D. melanogaster Genome Organization and Gene Regulation Abstract H3K9R mutation results in loss of H3K9me3 and HP1 binding at pericentromeres Methodology Purpose and Hypotheses Acknowledgements UNIVERSITY of NORTH CAROLINA at CHAPEL HILL Dowen Jill & McKay Dan Labs Telomere architecture is maintained in H3K9R HP1 Background: H3K9me3 and HP1 The histone replacement platform. We delete the endogenous histone locus from chr2L (∆HisC) and insert a designer histone cassette harboring 12 copies of the replication-independent histone gene cassette to a chr3L. Mutant or wild type histones are expressed from the designer histone cassette (12x WT or 12x K9R) to replace all endogenous replication-dependent histones in the fly (McKay 2015). We investigate the role of H3K9me3-mediated HP1 binding in establishing architectural features by performing HiC in H3K9me3-deficient D. melanogaster. Given the roles for HP1 and H3K9me3 in heterochromatin structure, we hypothesize that H3K9me3-deficient flies will exhibit dramatic changes to genome architecture, particularly in transcriptionally silent (aka B) compartments and known regions of constitutive heterochromatin. Eukaryotic genomes are packaged into basic units known as nucleosomes, which are comprised of DNA wrapped around a bundle of 8 core histone protiens. Histone tails are post-translationally modified (PTM) to act as a substrate for effector proteins to bind. One such PTM, tri-methylation, occurs at lysine 9 on histone H3 (H3K9me3). H3K9me3 is canonically referred to as a heterochromatic histone mark, and has been implicated in repressing gene expression. H3K9me3 recruits an effector protein, HP1a, which has strong self-associating properties. It has been hypothesized that engagement of H3K9me3 by HP1 is responsible for establishing heterochromatin. Organization of chromatin in three-dimensional (3D) space impacts DNA-templated events by controlling the accessibility of transcriptional machinery to the underlying DNA sequence. Despite its importance in regulating genome function, the mechanisms controlling 3D architecture remain poorly understood. Here, we examine the contribution of histone post-translational modifications (PTMs), a feature of chromatin that is highly correlated with 3D genome organization, but whose role has not been directly tested. In particular, we interrogate the role for the heterochromatin-correlate, histone H3 lysine 9 trimethylation (H3K9me3), in governing 3D organization of the D. melanogaster genome. We directly test the contribution of H3K9me3 by using a genetic platform in which the endogenous histone gene locus has been deleted and replaced with transgenic versions encoding non modifiable histone H3K9. H3K9me3 provides a binding site for heterochromatin protein 1 (HP1), which has been implicated in liquid-liquid phase separation, a biophysical property that separates molecules in 3D space. Given this property of HP1 and it’s localization to H3K9me3, we hypothesize H3K9me3 demarcates regions of the genome that become physically separated from other regions of the genome. We perform a comprehensive analysis of genomics data, including Hi	poster
AVG Art 5 Principes en Passende Technische & Organisatorische Maatregelen Marlon Domingus, Erasmus University Rotterdam marlon.domingus@eur.nl Februari 2021 Artikel 8 De bescherming van persoonsgegevens 1. Eenieder heeft recht op bescherming van zijn persoonsgegevens. 2. Deze gegevens moeten eerlijk worden verwerkt, voor bepaalde doeleinden en met toestemming van de betrokkene of op basis van een andere gerechtvaardigde grondslag waarin de wet voorziet. Eenieder heeft recht van inzage in de over hem verzamelde gegevens en op rectificatie daarvan. 3. Een onafhankelijke autoriteit ziet erop toe dat deze regels worden nageleefd. Rechtmatigheid Behoorlijkheid Transparantie Doelbinding Minimale gegevensverwerking Juistheid Opslagbeperking Integriteit Vertrouwelijkheid 8. Integriteit Toon AVG compliancy aan door: 8.1. monitoring van logging mbt toegang tot en wijziging van de data. 8.2. gebruik maken van Privacy Enhancing Technologies (PETs), en de versleuteling van data in rest en in transit. 9. Vertrouwelijkheid Toon AVG compliancy aan door: 9.1. monitoring van logging mbt toegang tot en wijziging van de data. 9.2. gebruik maken van PETs, waar mogelijk obv zero trust architecture en geldige ISO certiﬁcaten voor de beveiliging van de data en de systemen en de communicatie daarmee. 1. Rechtmatigheid, 2. Behoorlijkheid en 3. Transparantie Toon AVG compliancy aan door: 1. wettelijke grondslag voor de verwerking van persoonsgegevens in het onderzoek, gedocumenteerd in: onderzoeksplan, register van verwerkingen en indien relevant in het consortium agreement en de DPIA. 2. doel van het onderzoek beschreven in onderzoeksplan, register van verwerkingen, het privacy statement van het onderzoek (publiek online toegankelijk) en, indien relevant in het toestemmingsformulier en DPIA. 3. Beschrijvingen van doel van onderzoek en evt risico’s, helder en transparant, in eenvoudig taalgebruik en beknopt. 4. Doelbinding Toon AVG compliancy aan door: 4.1. gedocumenteerde onderbouwing van te verwerken data in onderzoeksplan, register van verwerkingen en evt DPIA. 4.2. gedocumenteerde onderbouwing van het doel van de verwerking(en) in het onderzoek in het privacy statement (publiek online toegankelijk), en, indien van toepassing, in het toestemmingsformulier. 5. Minimale Gegevensverwerking Toon AVG compliancy aan door: 5.1. gedocumenteerd en onderbouwd gebruik van alleen gegevens relevant voor het doel van het onderzoek, indien relevant: getoetst door een internal review board (IRB). 5.2. gedocumenteerde toegang binnen de onderzoeksgroep op basis van need to know in een autorisatiematrix. 5.3. gedocumenteerd gebruik van zero knowledge diensten (leveranciers hebben waar mogelijk by default geen toegang tot persoonsgegevens). 5.4. gebruik van gepseudonymiseerde data, geaggregeerde data indien mogelijk of van synthetische data. 6. Juistheid Toon AVG compliancy aan door: 6.1. toetsing van te gebruiken methodiek, bestaande datasets en nieuwe dataverwerkingen door een IRB of, indien relevant: Ethische Commissie. 6.2. documentatie van onderzoeksdata en wijzigingen in de onderzoeksdata, ook ten behoeve van pseudonimisering, in een data dictionary of codeboek. Geldt ook voor beschrijven en beheren van data linkage, sleutelbestanden van pseudonymisering en bewerkingen tbv pseudonymisering. 7. Opslagbeperking Toon AVG compliancy aan door: 7.1. documentatie vooraf, in het datamanagement plan, van de te hanteren bewaartermijnen van ruwe data, analysedata en verschillende versies van bewerkingen van data en media. Ook van de termijn van archivering en wie op welke wijze toegang mag krijgen voor welk doel. 7.2. bewaartermijnen zijn opgesteld cf de VSNU gedragscode wetenschappelijke integriteit, de Archiefwet, en beleid van de instelling. AVG Art. 5.1.Beginselen inzake verwerking van persoonsgegevens Handvest van de Grondrechten van de Europese Unie Art. 8.	poster
Led by STAKEHOLDERS CHALLENGES AMBITION Improve pricing policies system with local stakeholders Maintain the quality of surface water, fight against saline untrusions Need of investment in infrastructures Improve the socio-economic performance of local water pricing policies Improve the vertical (between stakeholders at different levels) and horizontal (between local stakeholders) dialogues Fostering the co-construction of public water policies, with a focus on the crossed sectors Improving the citizen engagement by providing relevant socio- economic information and tools Local Water Agency DEAL La Réunion Parliamentary Attaché Chamber of Agriculture Electricité de France Water compagnies Representatives of water users INNWATER PARTNERS RÉUNION ISLAND France Pilot Site #1 CONTACT: Michel PAUL - michel.paul@univ-reunion.fr This project has received funding from the European Union’s Horizon EUROPE research and innovation program under grant agreement No. 101086512. This project was funded by UK Research and Innovation (UKRI) under the UK government’s Horizon Europe funding guarantee [grant number 10066637]. contact.innwater@oieau.fr www.innwater.eu © OiEau 2023 @InnWater_EU @InnWater A consortium gathering 13 organisations (Research and Technology Organisations, SMEs, end users, associations with EU and international coverages). Promoting social innovation to renew multi-level and cross‑sector water governance	poster
group II AG006_mChr3_MAX5 References 1. Latorre et al. BMC Biology (2020). 2. Langner et al. PloS Genetics (2021). 3. de Guillen et al. PloS Pathogens (2015). Mini-Chromosomes as Horizontal Gene Shuttles in the Multihost Blast Fungus A. Cristina Barragán1, Sergio M. Latorre2, Angus Malmgren1, Adeline Harant1, Joe Win1, Kurt Lamour3, Hernán A. Burbano2, Sophien Kamoun1 and Thorsten Langner1 1The Sainsbury Laboratory, University of East Anglia, Norwich, UK 2Centre for Life’s Origins and Evolution, Department of Genetics, Evolution and Environment, University College London, UK 3Department of Entomology and Plant Pathology, University of Tennessee, USA M. oryzae infects both rice and wild grasses across Italy’s Po Valley + ++ + - deletion complementation host virulence Mini-chromosome content in M. oryzae includes “alien” mini-chromosomes of unknown origin Working Model “alien” mChr3 in AG006 “Alien” mChr3 from rice-infecting AG006 is similar to Lolium & Triticum M. oryzae group −150 −100 −50 0 50 normalized variant depth “Alien” mChr3 carries MAX effector3,4 which is present across multiple M. oryzae lineages mini-chromosomes may act as horizontal gene shuttles, promoting host adaptation Triticum Lolium Leersia Cenchrus Bromus Elinorus Urochloa Echinochloa Avena Digitaria Zea Oryza Setaria Panicum group I Brachiaria Rhynchelytrum Hordeum Eragrostis Eleusine Pennisetum Inferred AG006 mini-chromosome (mChr) composition Sampling trip August 2021 M. oryzae M. oryzae wild grasses as reservoirs for genetic variation rice M. oryzae mChr Common host plants Echinochloa Cyperus What other fungi are found in and around rice fields in the Po Valley? Ribosomal sequences SSU LSU 5.8S ITS1 ITS2 413 M. oryzae strains collected from different hosts NG0153 W-NGR-58 W-NGR-13 NG0135 W-NGR-59 NG0054 NG0012 W-TOG-5 W-TOG-5- W-GHA-7 CD0203 E-BRD-54 KA1-3-1 NG0104 NG0110 WD-3-1 1 BN0252 BN0293 W-BEN-12 W-BEN-12- W-GHA-7- AV1-1-1 W-BEN-11 CH0680 HN10-1604 GD-05-029b BF32 W-BKF-15- CH0328 FJ2000-69A FJ13SH05-2 Sar-2-20-1 SC-10-120-65-2 YN07205e CH0595 FJ99138 FJ72ZC7-77 FJ95085AZB13-116 GD06-53 CH0549 CL3.6.7 ML0025 KE415 UG08 E-RWD-4- E-UGD-47 E-TZA-22- A-PH-38 E-UGA-34 BD0024 MD0929 BF17 W-BKF-16 BF48 CM0028 ML0060 364 GY0040 CL0026 E-BRD-52 E-BRD-55 W-BFA-16- CD0073-1 FJ98099 FJ11SH-527-1 FJSH0703 SC-10-25-44-1 FJ11YD-673-1 HN-158 GD08-2025 FJ0204804 H08-1a H08-1c FJ2003-001A1 FJ2005113B FJ2001-112B FJ2000-62A MG10 NP0061 FJ12JN-084-3 FJ2006-60A3 658 678 NP0041 A-PHL-39- PH0103 A-PH-71 10100 PH0118 Nich-2-3-2 Nich-2-7-4 Sar-AD3-5 10880 LA0005 TH0014 TH3 TH0017 TN0001 TN0002 KE491 - 1 2 - A Z T - E 0 7 - A Z T - E 0 9 0 0 N T 1 2 0 0 A L 9 9 9 0 H C 9 1 0 1 H C CH0043 CH1164 CH1103 VT0030 VT0027 TG004 W-NGR-14 TG0032 TG0004 W-TOG-6 W-MAL-17 W-MAL-18 ML0062 CD0065 IN0054 IN0114 IN0115 IN0116 E-UGD-32 13FM-24-1 13FM-5-1 70-15 76 3 Guy11 GUY-56 CD0142 KA2-1-1 VO104 CH0072 E-TZA-25 E-TZA-69 TN0050 KE473 E-TZN-24 E-TZN-22 E-TZN-27 TN0057 TZ090 KE210 KE255 E-KYA-65 KE332 E-UGD-36 KE443 B157 IN0072 CH0701 HB-14 IN0082 MG01 IN0059 IN0017 MG02 BN0123 W-BKF-15 IN0094 US0031 VO108 VO113 KE002 KE029 KE021 KE017 KE019 E-KEN-29 KE016 KE041 NP0037 CH0452 CH0333 YN08181e YN8773R-27 CH0461 YN8773-19 CH0532 YN08182c 13FM-16-1 YN072313 JUM1 US0041 CH1016 HB-LTH18 TW-12YL-TT4-1 TW-6-43-1 TW-PT1-1 TW-12YL-DL3-2 JS09-138 JS-10-6-1-2 CH0092 82 0835 FJ81-JY E-RWD-43 AG038 BJ-90-611 SP0005 DB11-621 BJ08-8 BJ08-8-1 NP0052 TW-12TN-HB2-2 TW-12YL-DP1-1 TW-12CY-TB1-2 TW-PT6-1 TW-12HL-YL2-1 TW-CYBP1-3 TW-TN4-2 TW-PT3-1 TW-12TD-RH1-1 TW-1-1-1-B-1 TW-2-7-2-A-1 AG059 San Andrea EG308 13FM-3-2 13FM-9-1 YN072311 YN126311 YN126441 E-BRD-1- E-RWD-41 CH0860 YN072310 FJ86061ZE3-39 HN0001 TW-12HL-DF1-2 TW-6-2-2-B-1 JS08-611 JP0010 AG098 PR003 AG039 IT0010 FR13 MC0016 US0098 W-BEN-9 BN0202 AG0004 BR0026 AG032 TR0025 E-UGD-49 AG002 AG006 PR0009 FJ81-ZP JX11-141 FJ81221ZB11-14 GLHN3 GLHN4 FJ95054B ZJ00-10 ZJ2011-7-1 ZJ08-41 FJ81-MH FJ78-JJ CH0052 FJ86-CT FJ81-SW JX-09Z116-1 JX10-102 INA168 90 4	poster
Molecular tracing of dissemination routes of Salmonella spp, Hepatitis E virus and other viruses as fecal indicators in pigs at slaughterhouse Ianiro G.1, Pavoni E2., Alborali G. L.2, Guadagno F.2, Delibato E.1, Treglia I.1, De Sabato. L.1, Monini M.1, Ostanello F.3, Di Bartolo I.1 1 Istituto Superiore di Sanità, Rome, Italy 2 Istituto Zooprofilattico Sperimentale della Lombardia e dell'Emilia Romagna "Bruno Ubertini", Brescia, Italy 3 University di Bologna, Scienze Veterinarie, Bologna, Italy RESULTS & DISCUSSION 4th One Health European Joint Programme Annual Scientific Meeting - 11th-13th April 2022, Orvieto, Italy AIM The aim of this study was to investigate the occurrence of Salmonella spp. and hepatitis E virus (HEV) in pig slaughterhouses, and to identify critical points of the slaughter chain associated with the fecal contamination of carcasses. To this purpose, the detection of animal fecal indicators (porcine adenovirus PAdV, Torque teno sus virus TTSuV and group A rotavirus RVA) was also performed. Swabs were collected from 2 abattoirs in Italy at the end of the slaughtering cycle before cleaning. Environmental (floor, lairage, and trucks), equipment (knives and splitter) and external part of carcasses were sampled. HEV, RVA, TTSuV, PAdV and Salmonella spp. were detected by Real time PCR. Salmonella detection was confirmed by EN ISO 6579- 1:2017. Artificial contamination of samples was performed by using murine norovirus (MNV) to assess the nucleic extraction recovery rate. No samples were positive for HEV. Salmonella spp. was detected in one slaughterhouse, in 2 swabs sampled on the floor under the evisceration station and at lairage (Table 1). The result highlights the presence of Salmonella spp. positive pigs, able to shed the pathogen in feces in both the contaminated areas. In both abattoirs, the presence of PAdV was revealed (7/23 swabs) in several points, including external part of carcasses which was probably cross-contaminated by feces for improper handling (Table 1). Sus TTV was also revealed in both abattoirs (6/23) (Table 1). However, since it can be retrieved in blood and feces, we cannot establish if it is linked to fecal contamination. CONCLUSIONS Results confirmed that Salmonella spp. carriage may occur in pigs at slaughterhouses. HEV is rarer and co-infection with other viruses is frequent. The application of GHP is a main factor for managing carcass contamination at slaughterhouse. METHODS Funding acknowledgement This work was partially supported by funding from the European Union’s Horizon 2020 Research and Innovation programme under grant agreement No 773830: One Health European Joint Programme and from Italian Ministry of Health, grant RF-2016-02361926 (Ricerca Finalizzata anno 2016). Sample Recovery Rate (MNV) HEV TTV PAdV RVA Salm spp. Sampling Site Date ISS1 Not sampled Floor truck after washing ISS2 33.22% 0 0 pos 0 pos Lairage pens (floor) before cleaning 14 July 2021 ISS3 22.38% 0 pos 0 0 0 Scalding water tank caroussel arm 14 July 2021 ISS4 21.92% 0 0 pos 0 0 Surface at 2-knives system tank 14 July 2021 ISS5 100.00% 0 0 0 0 0 Carcass splitter surface 14 July 2021 ISS6 100.00% 0 pos 0 0 0 Evisceration knife 14 July 2021 ISS7 11.19% 0 pos pos 0 pos Evisceration step (floor) 14 July 2021 ISS8 22.22% 0 0 pos 0 0 Outer surface of 3 carcasses after evisceration 14 July 2021 ISS9 100.00% 0 pos 0 0 0 Outer surface of 3 carcasses after evisceration 14 July 2021 ISS10 68.30% 0 0 0 0 0 Outer surface of 3 carcasses after evisceration 14 July 2021 ISS11 95.93% 0 0 0 0 0 Outer surface of 3 carcasses after evisceration 14 July 2021 ISS12 100.00% 0 0 0 0 0 Outer surface of 3 carcasses after evisceration 14 July 2021 BS1 100.00 0 0 pos 0 0 Floor truck after washing October 2021 BS2 37.57 0 0 0 0 0 Lairage pens (floor) before cleaning October 2021 BS3 42.82 0 0 0 0 0 Carcass splitter surface October 2021 BS4 12.44 0 0 pos 0 0 Scalding water tank caroussel arm October 2021 BS5 25.14 0 pos 0 0 0 Evisceration	poster
Citations 1. Vidal, M., Cusick, M., & Barabasi, A.L., 2011. Interactome Networks and Human Disease. Cell. 986-998. 2. Sahni et al 2015. Macromolecular Interaction Perturbation Human Disorders. Cell. 161:3, 647-660. 3. Fragoza, R., et al 2019. Extensive disruption of protein interactions by genetic variants across the allele frequency spectrum in human populations. Nat Comm. 4.Albers & McVean 2020. Dating genomic variants and shared ancestry in population-scale sequencing data. PLoS Biology. 18(1):e30000586. Conclusion Takeaways ●Taken together, the younger age and lower chance of lying in long ROH suggest that PPI disruptive variants are indeed deleterious. ●And simulations show that recent demography can push recessive deleterious mutations to higher frequencies as observed in PPI disruptive variants, although the vast majority of common polymorphisms are neutral. Population Genetic Attributes of Variants That Disrupt Protein-Protein Interactions Mitchell G. Lokey1,2, Robert Fragoza1, Philipp W. Messer2, Haiyuan Yu1,2, Andrew G. Clark1,2 1Department of Molecular Biology & Genetics, Cornell University, Ithaca, New York 14853, USA 2Department of Computational Biology, Cornell University, Ithaca, New York 14853, USA Email: mgl77@cornell.edu @mitch_lokey Background • We seek improved methods to discover genotype to phenotype relationships. One approach to this problem focuses on the network of macromolecular interactions known as the interactome. Of great importance for cellular function, and our focus here, are networks of Protein-Protein Interactions (PPIs).1 • Yeast-2-Hybrid (Y2H) and similar assays have allowed mapping of the human protein interaction network by identifying large numbers of binary PPIs.1 • Studies of the effects of disease-associated variants on the known network of PPIs have shown that ~1/2 of tested Mendelian disease- associated variants disrupt PPIs.2 • Until recently, no work had looked at the extent to which naturally segregating variants in the human population affect PPIs. Fragoza et al (2019) sampled variants from the ExAC database and tested PPIs of >2,000 non-synonymous SNPs (nsSNPs) with the Y2H assay.3 • Fragoza et al (2019) showed that 10.5% of tested variants disrupted PPIs, a larger estimate of functional variation than previously reported. Surprisingly they also found that disruptive variants often segregate at relatively high allele frequencies.3 • As the links between cellular phenotypes, such as PPIs, and impacts on fitness are not straightforward we seek to illuminate population genetic attributes of PPI disruptive variants by leveraging large human databases and simulations. Future Directions ●Investigating the evolutionary signatures of PPI disruptive variants may help us to better identify which variants within a protein interaction network are important for disease. ●The results presented here should be tested against a control set of variants with similar allele frequencies. Acknowledgements ●This work is supported by NIH grant R01 GM125639 to H. Yu and A.G. Clark ●Clark Lab ●Messer Lab ●Yu Lab ●Sarah Kunz Naturally Segregating Variants & PPIs • Fragoza et al investigated fitness impacts of PPI variants using PolyPhen-2 a machine learning tool that probabilistically classifies the deleteriousness of missense mutations. PolyPhen-2 scores show that PPI disruptive variants are more deleterious than non-disruptive and even more so for variants that disrupt all of their PPIs. • Theory tells us that deleterious variants such as disease-associated variants, and likely PPI disruptive variants, will be kept at low allele frequencies due to purging selection. However, Fragoza et al found that although ~20% of very rare variants disrupt PPIs, ~9.6% of common variants (allele frequency > 10%) also disrupt PPIs.3 • To better understand the evolutionary history and impact of PPI disruptive variants we first looked at the ages of our disruptive and non-disruptive variants using Genealogical Estimati	poster
The research leading to these results has received funding from the project titled "Cluster for innovative energy" in the frame of the program "HORIZON-MSCA- 2022-SE-01" under the Grant agreement number 101129820 REGIONAL SYSTEM OF ALTERNATIVE ENERGY SOURCES dr. Marcin Rabe, Institute of Management, University of Szczecin; Centre of Sociological Research, Szczecin, Poland; marcin.rabe@usz.edu.pl dr. Katarzyna Widera, Faculty of Economics and Management, Opole University of Technology, Opole, Poland; k. widera@po.edu.pl dr. Andrzej Gawlik, Faculty of Environmental Management and Agriculture, West Pomeranian University of Technology in Szczecin, Szczecin, Poland; andrzej.gawlik@zut.edu.pl mgr Tomasz Pudło, Faculty of Mechanical Engineering and Mechatronics, West Pomeranian University of Technology, Szczecin, Poland, pudlo.tomasz95@gmail.com Methodology Results The main goal is to identify and analyze the conditions relating to the conduct of regional energy policy, with particular emphasis on unconventional energy sources occurring in a given area. The methodological goal is to build a mathematical model of the regional energy system, related to the region's development strategy in specific time periods (years), and to generate development scenarios taking into account sustainable development criteria, i.e. economic, ecological and social. The aim of the work is to propose to regional authorities the desired direction of energy policy development in the analyzed periods and to offer a model for creating energy policy in other local government units: counties and communes. Research hypothesis It is advisable and possible to build a regional system of obtaining energy from alternative sources, meeting the principles of sustainable development, increasing energy security and increasing energy efficiency and full use of renewable energy sources. The research also formulated three specific hypotheses. The first one concerns the lack of interest in building regional energy systems, both on the part of the central energy sector and regional and local authorities, caused by the variability of EU and national regulations, which do not support the development of prosumer and renewable energy. The second concerns the lack of appropriate infrastructure for the development of renewable energy The third one concerns the high risk and uncertainty of investments in renewable energy in the current legal and economic conditions . Results .	poster
Iterative fast equivalent-layer technique INTRODUCTION The equivalent layer technique (Dampney, 1969) has been used for: 1) interpolating and gridding data, 2) computing the upward (or downward) continuation of data, 3) computing the reduction to the pole of magnetic data, 4) merging multiple datasets and, 5) jointly processing multiple components of airborne gravity gradient data. The classical equivalent layer technique consists in constructing a linear system of equations and solving a linear inverse problem to estimate a set of coefficients describing a discrete layer of equivalent sources. Usually, the equivalent layer technique deals with intractable large-scaled matrix computations for processing large data sets. This obstacle propels the development of computational strategies to make the equivalent layer technique computationally efficient. APPLICATION TO REAL DATA BACKGROUND AND NEW INSIGHTS The Dirichlet integral, that is also called upward continuation integral (Henderson, 1970) is defined as: CONCLUSIONS • A new fast iterative equivalent-layer technique for processing gravity data grounded on excess mass constraint. • Iteratively, our approach estimates the mass distribution that fits the gravity data within the measurement errors. • The initial approximation to a mass distribution is proportional to the gravity observation • Iteratively, we estimate a mass distribution correction that is proportional to the residual gravity data. • This mass distribution correction is the excess mass constraint. • The algorithm has low processing time and computer memory usage AIM Faced with the demand for fast and computationally efficient equivalent layer method able to handle with large datasets, we have developed a new iterative equivalent layer technique that do not solve linear systems. We validate our method using synthetic and real data. For full details of the proposed method please read Siqueira et al. (2017). ACKNOWLEDGEMENTS This research is supported by the Brazilian agencies CNPq (307135/2014-4) and FAPERJ (E-26/203. 091/2016) and CAPES. The authors thank Bell Geospace Inc. for permission to use the real data. REFERENCES Dampney, C. N. G. [1969] The equivalent source technique. Geophysics, 34, 39–53. Henderson, R. G. [1970] On the validity of the use of the upward continuation integral for total magnetic intensity data. Geophysics, 35, 916–919. Grant, F. and G. West [1965] Interpretation theory in applied geophysics: McGraw-Hill. Oliveira Jr, V.C. and Barbosa, V.C.F. [2013] 3-D radial gravity gradient inversion. Geophysical Journal International, 195, 883–902. Siqueira, F.C.L., Oliveira Jr, V.C. and Barbosa, V.C.F. [2017] Fast iterative equivalent-layer technique for gravity data processing: A method grounded on excess mass constraint. Geophysics, 82, G57–G69. Uieda, L., Oliveira Jr, V. C. and Barbosa, V. C. F. [2013] Modeling the Earth with Fatiando a Terra. Proceedings of the 12th Python in Science Conference, 91–98. CONTACT INFORMATION valcris@on.br – OBSERVATÓRIO NACIONAL, RIO DE JANEIRO, BRAZIL FILLIPE C. L. SIQUEIRA1, VANDERLEI C. OLIVEIRA JR1 and VALERIA C. F. BARBOSA1 1 Observatório Nacional, Rio Janeiro, Brazil                               d d z z y x z z g o i i i o i 1 ) , , g( 2 1 2 / 1 2 2 2 N Potential-field observations can be exactly reproduced by a continuous and infinite 2D physical-property distribution Potential-field observations produced by a 3D physical-property distribution Equivalent-layer principle y x E Depth z 2D physical-property distribution • This 2D physical-property distribution is approximated by a finite set of equivalent sources arrayed in a layer with finite horizontal dimensions and located below the observation surface. We assume that the set of equivalent sources are distributed in a regular grid with a constant depth zo forming an equivalent layer y x N E z Depth Layer of equivalent sources Equivalent sources (e.g., point masses) zo where gi ≡	poster
Daya Bay, Double Chooz and RENO combined analy- sis J. Garc´ıa Belloa, B. Vargas Perezb, J. Garc´ıa-Raveloc, Dionisio Tund, Carlos L´opez Limae Instituto Polit´ecnico Nacional, Escuela Superior de F´ısica y Matem´aticas, Departamento de F´ısica, Unidad Profesional Adolfo L´opez Mateos, Mexico City, Mexico. Jes´us Escamilla Roaf Instituto Polit´ecnico Nacional, Unidad Profesional Interdisci- plinaria de Ingenier´ıa, Ciudad del Conocimiento y la Cultura, Hidalgo, Mexico. afisjorge@live.com, bfis.vargas.perez@gmail.com, cg.ravelo@hotmail.com, ddtun@outlook.com, ecarlosomega40@hotmail.es fjesus.escamilla.roa@gmail.com Abstract Through a global statistical analysis from the public experimental data of the three LBL reactor experiments, Daya Bay, Double Chooz and RENO. We obtain the Daya Bay, Double Chooz and RENO conﬁdence regions for the neutrino oscil- lation mixing angle θ13 and the effective squared mass difference ∆m2ee in the three neutrino mixing model. Our single results are consistent with those published by the collaborations and corroborate that this statistical analysis improves individual results. Introduction The main objectives of Double Chooz, RENO and Daya Bay experiments are the precise measurement of the mixing angle θ13 and the ∆m2ee, [1][2]. These experiments detect reactor Anti-neutrinos by means of Inverse Beta Decay, mea- suring the positron kinetic energy produced. The three-ﬂavor survival probability P of a νe with energy Eν(MeV) after traveling a distance L(m), is given by P(ee) = 1 −sin2(2θ13)sin2 (1.27∆m2eeL Eν ) −cos4 θ13 sin2(2θ12)sin2 (1.27∆m2 12L Eν ) (1) where θ12 and ∆m2 12 are ﬁxed by others experiments. The average survival probability in the ith energy bin, P i is used to determine oscillation parameters. 1 Double Chooz The Double Chooz collaboration determined sin2(2θee) = 0.090+0.032 −0.029, without showing conﬁdence regions and using the value obtained by MINOS of 2.44+0.09 −0.10 × 10−3eV2/c4 for ∆m2ee in a simpliﬁed two ﬂavor mixing model, [3]. Double Chooz was designed to run with two detectors located at LF = 1050 m, (Far), and LN = 400 m, (Near). We use only the Double Chooz far data in χ2 tests to determine both sin2(2θ13) and ∆m2ee as well as their conﬁdence regions1. The experiment measures visible energy between 0.5 and 20 MeV, divided into 40 bins. The Rate + Shape analysis is determined by the function χ2 DC = 40 ∑ i=1 40 ∑ j=1 (N obs i −N exp i )M −1 ij (N obs j −N exp j ) + χ2 δE(ϵa,ϵb,ϵc) + 5 ∑ k=1 ϵ2 k σ2 k + χ2 off. (2) N obs i (N exp i ) are the observed (expected) number of IBD in the ith energy bin, Mij is the co- variance Matrix and N exp i is proportional to the expected number of antineutrinos without oscillations, nexp i , and to the average survival probability. Also, we write N exp i as follows N exp i = nexp i Pi(θ13,∆m2ee,L) + f(ϵ1,...,ϵ4), where the last term is a correction due to the background sources. Eight systematic uncertainties are considered in the second and third terms of χ2 R+S, using pull parameters ϵx. The fourth term in (2) is the contribution when the two reactors are turned off. We report the minimization of the function χ2 R+S and its level curves Fig. 1. Figure 1: It is shown the behavior of the χ2 DC statistics for Double Chooz and its con- ﬁdence regions up to 68, 95 and 99% of C. L. for (sin2 2θ13, ∆m2ee) for Full Covariance Matrix analysis. This graph is an improvement of the shown in [2]. This is because we have used a three mixing model and we have taken in account the Double Chooz collab- oration suggestions. In this case, we do not obtain two disjoint regions and the value for ∆m2ee is in good agreement with the currently acepted value. 2 RENO analysis The RENO collaboration determined sin2(2θee) = 0.0896 ± 0.0067 and 2.68 ± 0.13 × 10−3eV2/c4 for ∆m2ee, [5]. RENO runs with two detectors and six nuclear reactors in a linear conﬁguration. We use only the RENO far data in χ2 tests to determine both sin2(2θ13) and ∆m2ee as well as their conﬁd	poster
Facilitating Effective Collaboration under the JWCRP using the JASMIN Platform Ag Stephens (ag.stephens@stfc.ac.uk). Science & Technology Facilities Council, Didcot, Oxon, OX11 0QX. UPSCALE - massive HPC outputs, transfers and analyses! MONSooN HPC Overflow Converting Climate runs to CF-NetCDF Atmospheric Dispersion Modelling Regional Climate Modelling 4. RUN YOUR OWN VMs (Root included!) 1. SHARE “LARGE” DATA WITH COLLABORATORS 3. EFFICIENT DATA TRANSFERS The Joint Weather & Climate Research Programme ( ) is a shared programme between NERC and the Met Office. Its goals are to ensure that the UK maintains and strengthens its leading international position in weather and climate science, and hence in weather and climate forecasting and provision of advice for policy. The JWCRP involves a commitment to sustain and grow the UK's national capability and research in observing, understanding, modelling and predicting weather and climate, along with the infrastructure required to deliver that national capability and research. It also focuses on aligning major research initiatives and programmes to ensure the most effective impact of that research and pull-through into the delivery of services to government and business. B. N. Lawrence, V. Bennett, J. Churchill, M. Juckes, P. Kershaw, P. Oliver, M. Pritchard & A. Stephens (2012). The JASMIN super-data-cluster. http://arxiv.org/abs/1204.3553 Pascoe, S. (2013). Growing a community analysis platform with JASMIN and the Community Intercomparison Suite. NCAS Staff Meeting 2013. Poster. Stephens, A. (2013). Running the Met Office NAME dispersion model on the JASMIN computing platform: A new community tool and trajectory service. NCAS Staff Meeting 2013. Poster. UM Conversion Tool page on the CEDA Services wiki: http://proj.badc.rl.ac.uk/cedaservices/wiki/JASMIN/SupportForScience/UMConversionTool JASMIN website: http://www.jasmin.ac.uk JWCRP website: http://www.jwcrp.org.uk CEDA website: http://www.ceda.ac.uk is a data and computing platform designed to meet the needs of scientists working with very large datasets that require complex and computationally expensive analysis. Managed by STFC’s Centre for Environmental Data Archival (CEDA) the platform now holds the complete archives of the NCAS BADC and NEODC. JASMIN also provides access to high-performance disk, a virtualisation environment, compute cluster and high-speed networking. Satellite nodes are deployed in the Universities of Leeds, Bristol and Reading. Plans to expand this capability are being developed. The JASMIN computing platform at NCAS BADC provides access to high-performance disk, a virtualisation platform, compute cluster and high-speed networking. One key aspect from the NCAS perspective is that resources are equally accessible to researchers in UK universities and the UK Met Office. This makes JASMIN an excellent candidate for hosting services to support collaborations under the Joint Weather and Climate Research Programme (JWCRP). 2. ANALYSE DATA 5. PARALLEL PROCESSING Specific projects may require dedicated computing resources and/or specific software environments. JASMIN provides root access to project-specific virtual machines so that external administrators can build and maintain specialised environments with minimum overhead and support. Projects, such as those discussed below (UPSCALE, NAME and PRECIS), typically marry this provision with a Group Workspace to store their inputs and outputs. Many projects are making JASMIN a focal point for collaboration by setting up a “Group Workspace”. This is a shared disk made accessible to a chosen group of scientists working on the same project. Group Workspaces currently range between 5Tb and 380Tb in size. Typically they are used for: • Sharing large data – pushing from remote sites • Accessing data – retrieving to remote sites • Analysing data – space for storing big outputs • Intercomparison – comparing data with established archived datasets, such as CMIP5 and ERA-Interim	poster
To achieve the objectives, the following tasks will be carried out: Design of a separation system for the closed-loop superheated steam drying process in the paper industry Felipe de Oliveira a*, Marcel Meinders b, Edwin Zondervan a a University of Twente, Drienerlolaan 5, 7522 NB, Enschede b Wageningen University & Research, Droevendaalsesteeg 4, 6708 PB, Wageningen Methodology Introduction Questions / Tips References Objectives ➢Validated contaminant separation model with device cleaning mode ➢Optimized operational scheduler to minimize energy use and CO2 emissions ➢Feedback control loop ➢User-friendly digital twin The paper industry is highly energy-consuming with the paper drying step accounting for 70% of the energy requirements, i.e. there is scope for improvement [1], [2]. Scheme of the main units of a typical paper-making process De-barker Chipper Digester Dryer Mixer Wood Paper Superheated steam drying can reduce energy use by 70% compared to traditional air drying [2]. As the paper is dried, the steam is contaminated, causing operational issues and reducing the efficiency of the process. Effective contaminant control is needed for a closed-loop process. [1] – Eurostat: Final energy consumption in industry - detailed statistics – Retrieved from: https://ec.europa.eu/eurostat/statisticsexplained/index.php?title=Final_energy_consu mption_in_industry_- _detailed_statistics#The_largest_industrial_energy_consumers_in_the_EU [Accessed on 2024-07-05] [2] – Wilk, V., Knöttner, S. B., Drexler-Schmid, G., & Barz, T. (2023). Superheated steam drying for paper production: process efficiency assessment. In Proceedings of ECOS 2023: 36th International Conference on Efficiency, Cost, Optimization, Simulation and Environmental Impact of Energy Systems (pp. 1411-1421) https://doi.org/10.52202/069564-0128 - Units of the paper process scheme designed by Freepik Separation / device cleaning model • Review separation technologies • Analyse contaminated steam composition • Select separation technology • Model contaminant separation from steam • Model device cleaning process • Integrate models with switching capability • Experimental validation of model Process optimization • Identify performance indicators • Optimization constraints • Develop an optimization algorithm • Propose an operational scheduler System Implementation • Develop the feedback control loop • Create the digital twin Separation mode Device cleaning mode Feel free to ask or send me an e-mail using the QR code below Expected outcomes Deliverables on the left with the related tasks on the right Optimized operational scheduler Controller Process Correcting device Measuring device Setpoint Feedback control loop and digital twin	poster
The X/Ka-band (8.4/32 GHz) 2024a Celestial Reference Frame C.S. Jacobs1, S. Horiuchi2, D. Firre3, Y. Murata4, H. Takeuchi4, T. Uchimura4 13th International VLBI Service General Meeting, Tsukuba, Japan, 4-9 March 2024 (1) Jet Propulsion Laboratory, California Institute of Technology (2) Canberra DSCC/NASA, CSIRO, Australia, (3) European Space Agency, Darmstadt, German (4) JAXA, Sagamihara Kanagawa, 252-5210, Japan Abstract: The X/Ka-band (8.4/32 GHz) Celestial Reference Frame became one of three components of the ICRF-3 in 2018. In the five years since, the X/Ka data set has increased by about 93% as well as adding the much needed north-south geometry from Japan to Australia. The latest solutions have 686 sources with median formal precisions of 43 μas in α cosδ and 62 μas in δ. The large spherical harmonic distortions seen in the ICRF3-X/Ka are greatly improved with the Z-dipole term reduced from 314 μas to a statistically insignificant -49 +- 40 µas and with the quadrupole 2,0 magnetic term of 186 +- 15 µas and a quadrupole 2,0 electric term of 80 +- 24 µas. We note that the X/Ka frame is derived from a limited geometry of only five observing sites of which the two DSN baselines dominate with 85% of the total data thus creating a susceptibility of this frame to geometric distortions. The prospects for future improvements are bright and we expect the distortions to be reduced as more data from the ESA Malargüe and JAXA Misasa stations are added. Fig. 1 NASA-ESA-JAXA Ka-band network. The addition of Argentina & Japan adds 6 baselines & Full Sky coverage. For d = +45 to +90 deg coverage is from California-=Spain and Japan-Spain baselines. For d -45 to -90 deg, coverage is only from the Australia-Argentina baseline. Three sites are susceptible to earthquakes. V. Conclusions: The X/Ka-band CRF has 686 sources covering the full sky and is making rapid improvements in the precision. The median precision is 43 / 62 µas in acosd / d. Spherical harmonic differences vs. ICRF3-S/X are <= 190 µas. wRMS scatter vs. Gaia is ~230 µas. Improving accuracy depends on controlling systematics via increased observations using a North-South baseline geometry. Acknowledgements: Copyright © 20234 All Rights Reserved. This research was carried out in part at the Jet Propulsion Laboratory, California Institute of Technology, under a contract with the National Aeronautics and Space Administration (80NM0018D0004). Fig. 4: Schematic of Active Galactic Nuclei (Marscher, 2006, Krichbaum, 1999, Wehrle, 2010) X-band 3.6 cm S-band 13 cm Ka-band 0.9 cm W-band 0.3 cm Water:1.3 cm/ 22 GHz O2 line: 0.5 cm/ 60 GHz L-band 19-24 cm Fig. 5: The radio “window” is transparent compared to most of the spectrum (credit: NASA) Ka-band (32 GHz) is in the saddle point between H20 (22 GHz) and O2 (60 GHz) lines. Fig. 7: Dec precision: Median s is 62 µas for 686 sources. Median = 150 µas for Dec < -45 deg. I. High Frequency Radio Frames: As radio frequencies increase, sources tend to be more core dominated as the extended structure in the jets tends to fade away with increasing frequency (fig. 3,4). The spatial offset of the emissions from the AGN engine due to opacity effects (“core shift”) is reduced as frequency increases. Advantages of Ka-band compared to S/X-band: • More compact, stable sources (Fig. 3,4) • Reduced opacity effects: “core shift” • Ionosphere & solar plasma effects reduced by 15X. Disadvantages of Ka-band: • More weather sensitive (fig. 5) • Shorter coherence times • Weaker sources, many resolved • Antenna pointing is more difficult,. • Combined effect is lower sensitivity, But increasing data rates are rapidly compensating. We have increased JPL operations to 2.0 Gbps. Executive Summary: Celestial angular coordinates (a,d) are derived from VLBI measurements at 8.4/ 32 GHz (36/ 9 mm) of Active Galactic Nuclei. Agreement with S/X is at the part per billion level. X/Ka has reduced astrophysical systematics vs. S/X. Fig. 2. Antennas of combined NASA-ESA-JAXA X/	poster
A fala de migrantes internos: uma agenda de estudos Motivações para o estudo da fala de migrantes ▶Migrantes compõem grande parte da população das cidades atualmente (IPEA, 2011) ▶Migração: tópico relativamente pouco estudado ▶Estabilidade da fala adulta? • Hipótese do período crítico (Lenneberg, 1967) • Estudos em tempo real (p.ex., Paiva & Duarte, 2003; Sankoﬀ& Blondeau, 2007) ▶Mudanças linguísticas devido ao contato dialetal (Oushiro, 2015) ▶Relação entre padrões individuais e da comunidade Desaﬁos ▶Mais variação do que na fala de “nativos” (Trudgill, 1986; Chambers, 1992) ▶Grande variação entre indivíduos ▶Múltiplas variáveis sociais: sexo/gênero, idade, classe social, idade de migração, tempo de residência, rede social, atitudes, identidades, habilidade pessoal... ▶Múltiplas variáveis sociolinguísticas Projeto “Processos de Acomodação Dialetal” (Processo FAPESP 2016/04960-7) ▶Corpus: 72 gravações com migrantes + 84 com nativos (corpus controle) ▶Métodos • Análise de 6 variáveis (ver Quadro 1) ▶4 fonéticas (vogais pretônicas, /r/ em coda, /t, d/ antes de [i]), 2 morfossintáticas (negação sentencial, concordância nominal) ▶NE vs. SE, rural vs. urbano • Entrevistas sociolinguísticas ▶Bairro, Infância, Família, Trabalho, Lazer ▶Avaliações sociolinguísticas ▶Lista de Palavras • Questionário de Rede Social, Hábitos e Identidade. Exemplos de perguntas: ▶Quem são as 5 pessoas com quem você mais conversa? ▶Seus vizinhos são nordestinos? ▶Com que frequência você come comida nordestina? ▶Numa escala de 0 a 10, o quanto você se considera alagoano? • Questionário socioeconômico (Mendes & Oushiro, 2013) • Análises na plataforma R (R Core Team, 2018) ▶Sexo/gênero se correlaciona com variáveis do continuum rural–urbano ▶Idade de migração se correlaciona sistematicamente com variáveis fonéticas ▶Tempo em SP se correlaciona somente com (-r) Quadro 1: Resumo dos resultados das Amostras 1 e 2 em modelos de efeitos mistos (e) (o) (-r) (td) (NEG) (CN) Sexo/Gênero x x x ✓* x ✓* Faixa Etária x x x ✓ ✓ ✓ Escolaridade x x ✓ x ✓ ✓ Motivo de Migração x x x x ✓ ✓ Idade de Migração ✓ ✓ ✓ ✓ x x Tempo em SP x x ✓ x x* x *Resultados divergentes entre Amostras 1 e 2 Uma agenda de estudos Tipologia de variáveis: há variáveis mais ou menos propensas à aquisição dialetal? Se sim, elas se deﬁnem por: (i) saliência? (Trudgill, 1986); (ii) existência na comunidade de origem? (cf. /r/ em coda e /t, d/ antes de [i]); (iii) nível de análise: fonética, fonológica, morfológica, sintática etc.? Direção da aquisição: um falante de um dialeto A adquirindo o dialeto B passa pelos mesmos processos que um falante do dialeto B adquirindo o dialeto A? É mais interessante examinar um fenômeno da perspectiva da aquisição ou da perda de traços? Papel de variáveis sociais: para além de sexo/gênero, faixa etária, nível de escolaridade, qual é o papel (i) da rede social dos migrantes?; (ii) de suas atitudes?; (iii) de sua(s) identidade(s)?; (iv) de seus hábitos? Como operacionalizar essas variáveis? Papel de variáveis linguísticas: além de aumento ou diminuição de uso de variantes, os falantes também são capazes de adquirir regras variáveis mais abstratas, como hierarquia de restrições? (ver Guedes, no prelo) Referências CHAMBERS, J. K. 1992. Dialect acquisition. Language, vol. 68(4), 673–705. GUEDES, S. (no prelo) Emprego do artigo deﬁnido em situação de contato dialetal: um estudo da fala de migrantes paraibanos em São Paulo. Domínios da Linguagem. HORA, D. 1993. Projeto Variação Linguística no Estado da Paraíba. IPEA. 2011. Comunicados do IPEA no. 115 – Perﬁl dos migrantes em São Paulo. LENNEBERG, E.H. 1967. Biological foundations of language. Wiley. MENDES, R.B.; OUSHIRO, L. (2013) Documentação do Projeto SP2010 – Construção de uma amostra da fala paulistana. Disponível em <http://projetosp2010.ﬄch.usp.br/producao-bibliograﬁca>. OLIVEIRA, A. J. 2017. Projeto PORTAL: variação linguística no português alagoano. Disponível em <http://www.portuguesalagoano.com.br/>. OUSHIRO, L. 2	poster
2. Paleomagnetic analysis 3. Petrographical analysis 1. Magnetic Surveys Acknowledgements: This project has received funding from the European Union’s Horizon 2020 research and innovation program under grant agreement No 730041 and the Spanish National Plan project 2016 ESP2015-70184-R. The main objective is to develop a methodology to achieve a better interpretation of future on ground geophysical characterization on - board planetary vehicles. The methodology is structured as follows: 1) In situ vector magnetic surveys and sample collection. This investigation allows having a preliminary magnetic signature of the crater. (Figures left below) 2) Laboratory analyses to improve the interpretation. These analyses involve two disciplines: a. Paleomagnetic analysis of collected samples performed at INTA and in the Complutense University of Madrid. (Figures below) b. Petrographical analysis performed at Göttingen University. (Figures on the right) 3) The experimental results are complemented with magnetic models which simulate the magnetic signature of the crater as a whole. Objectives and methodology Example of IRM analysis (Sample PA 15) is shown in the figure above. All the studied samples have at least 4 magnetic carriers. First component identified is titanomagnetite (Ti-Mt). The second component represents probably a combination of a paramagnetic phase and titano- hematite, based on the trend of the curve and supported by the petrographic analysis (SEM photo in the upper left corner and the petrographic analysis, which show a significant amount of ilmenites and hematites). The other components correspond to a minority composition and low magnetic moment (< 0.2 emu/g). In the upper right figure the percentages of contribution of the different magnetic components are calculated for all investigated samples along the transect of the crater. Improved understanding of magnetic signatures of basaltic lava flows and cones with implication for extraterrestrial exploration Amanda Arlensiú Ordóñez Cencerrado1, Marina Díaz-Michelena1, Francisco Ríos2, and Rolf Kilian2 (1) INTA, Torrejón de Ardoz, Spain, (2) University of Trier, Germany PS 2.3 References: Day, R., Fuller, M. and Schmidt, V. A. (1977). Phys. Earth Planet. Inter., 13: 260-267; Dunlop, D.J. (2002). J. Geophys. Res., 107 (B3), 10.1029; Díaz-Michelena, M., et al. (2016). Geosci. Instrum . Meth., 5: 127-142.; Diaz-Michelena, M. & Kilian, R. (2015). Phys. Earth Planet. Inter, 248: 35 – 54. D’Orazio, M., et al (2000). Tectonophysics, 321: 407–427; Ejima, T., et al. (2013). Mineral. Petrol. Sci., 108: 25-36; Filiberto, J., et al. (2016). 47th Lunar and Planetary Science Conference (2016), 2171 p; Gunnlaugsson, H.P et al. (2006). Phys. Earth Planet. Inter, 154: 276–289; Haggerty, S.E. & Baker, I. (1967). Contrib. Mineral. Petrol. 16, 233–257; Kruiver, P. P., et al. (2001). Earth Planet. Sci. Lett., 189 (3), 269-276; Lowrie, W. (1990). Geophys. Res. letters, 17 (2), 159-162; Moskowitz, B.M., et al. (1998). Earth Planet. Sci. Lett., 157: 141–149; Peters, C., & Dekkers, M. J. (2003). Phys. Chem. Earth, Parts A/B/C, 28 (16): 659-667; Peters, C., & Thompson, R. (1998). J. Magn. Magn. Mater., 183 (3): 365-374; Rasmussen, H., et al. (2014). Geochim. Cosmochim. Acta, 134: 275-288; Roeder, P.L. (1994). Canadian Mineralogist, 32: 729–746; Tauxe, L. (2010). Essentials of paleomagnetism. Univ of California Press. Chapter 7.7 • NRM and susceptibility to calculate the Köningsberger ratios which show a predominant remanent magnetization of the rocks. • Hysteresis loops for the Day plots to ascertain the grain size and the domain structure information. • Coercivity spectrum based on Isothermal Remanent magnetization (IRM) to identify magnetic carriers (Tauxe, 2010, Kruvier et al. 2001). Day plot (Day et al. 1977) with the analyzed rock samples in between Single and Multidomain (SD and MD) and Pseudo Single Domain (PSD) areas. This is compatible with a content in MD Ti-Mt and some SD ones as an al	poster
Alzheimer’s Disease Co-pathology and its Influence on Biofluid Biomarkers in Autopsied Subjects from the PPMI Study David Coughlin MD MTR1, Kristy Hwang MD1,2, Ece Bayram MD PhD1, Douglas Galasko MD1 1. University of California San Diego Department of Neurosciences La Jolla CA 92037 2. Long Beach VA Medical Center, Long Beach CA Objective: To examine the relationship between biofluid biomarkers and post-mortem pathological findings in autopsied subjects from the Parkinson’s Progression Marker Initiative (PPMI) with a focus on Alzheimer’s disease (AD) co-pathology. Methods: CSF measurements Platform Aβ1-42 Elecsys (Roche) total-tau (t-tau) Elecsys (Roche) phosphorylated tau (p-tau181) Elecsys (Roche) Total CSF alpha-synuclein (aSyn) ELISA (Biolegend) aSyn-Seeding Amplification assay (aSyn-SAA) Amprion Serum measurements Platform Neurofilament light chain (sNfL) Simoa (Quanterix) Please see www.ppmi-info.org for more details Autopsies were performed per local methods. Biofluid markers and clinical features from PD cases with no or low AD neuropathological change (PD-ADNC) and PD cases with intermediate or high AD neuropathological change (PD+ADNC) were compared cross sectionally at last available assay and longitudinally. Data used in the preparation of this research were obtained from the (PPMI database (www.ppmi-info.org/access-data-specimens/download- data). For up-to-date information on the study, visit www.ppmi-info.org . Conclusions • AD co-pathology is common and associated with more rapid cognitive and motor decline in the PPMI autopsy-validated cohort. • CSF biomarkers can accurately identify AD co- pathology in vivo. • High rates of genetic variants may result in bias in current dataset • The PPMI autopsy cohort will provide unique opportunities to examine relationships between clinical, imaging, biofluid biomarkers and histopathological changes as it expands. PD-ADNC N=11 PD+ADNC N=9 Clinical Features p (t-test, fisher exact) Age onset N=10 60.7 (12.3) N=8 65.1 (5.1) 0.4 Sex 4 Female, 7 Male 3 Female, 6 Male 1.0 Disease Duration (y) N=10 11.4 (5.4) N=8 10.4 (3.4) 0.6 UPDRS-III (OFF, last) N=9 34.4 (8.8) 43.3 (20.6) 0.25 MoCA (last) N=9 23.4 (4.6) 19.2 (6.6) 0.12 LRRK2, GBA GBA: N409S N=1 LRRK2: R1441G N=1 G2019S N=2 GBA: N409S N=2 LRRK2: G2019S N=1 NA APOE Genotype 2/4: 1, 3/3: 7, 3/4: 1 2/4: 1, 2/4:1 3/3: 4 3/4: 1 E4 dominant: 0.6 Last Biofluid Assessments (mean (SD). Test-death interval 5.1y [IQR 2.9-7.2] P (LR controlling for test-death) CSF Aβ1-42 pg/ml N=7 887 (315) N=7 544 (254) 0.06 CSF t-tau/Aβ1-42 N=7 0.20 (0.06), N=7 0.47 (0.13) 0.02 CSF p-tau/Aβ1-42 N=7 0.017 (0.005) N=7 0.030 (0.01) 0.04 CSF total-αSyn pg/ml N=7 1378 (444) N=7 1099 (289) 0.2 CSF aSyn-SAA N=8 8/8 positive N=8 8/8 positive NA Serum NfL N=9 18.9 (8.3) 27.6 (11.9) 0.1 Neuropathological Features p (fisher exact) Braak aSyn 5/6: 4 6/6: 7 5/6: 1 6/6: 8 0.3 Braak Tau B0:1, B1:6, B2:4 B2:6, B3:3 0.007 CERAD Plaque Stage C0:10, C1:1 C2:2, C3:7 <0.001 Thal Aβ Phase A0:4, A1:5, A2:1 A2:2, A3:7 <0.001 AD Neuropath. Change Not: 5, Low: 6 Inter.: 6, High: 3 <0.001 TDP-43 None: 7, Hipp: 1, MF: 1 None: 6, Hipp:2 1.0 Cerebral Amyloid Ang. None:4 Mild:2 Mod.:2 None:3 Mild:1 Mod.:3 Severe:1 0.7 Hippocampal Sclerosis 1 2 0.7 Arteriolosclerosis None:3, Mild:2, Mod:3 None:1, Mild:2, Mod;5, Severe:1 0.7 Results: Data from 22 autopsied subjects was available (17/22 from Stanford University). One subject had MSA and another had a LRRK2 G2019S mutation without Lewy body pathology (both aSyn-SAA negative). 11 cases were PD-ADNC and 9 were PD+ADNC as below. Contact: David Coughlin MD MTR. dacoughlin@ucsd.edu P<0.001 P values reflect results of group differences in GLM models Longitudinal Changes P<0.001 P<0.001 P=0.003 P<0.001 P<0.001 P=0.3 A. Clinical B. Biomarkers	poster
Photovoltages in perovskite-type oxide thin film cells Introduction Mechanistic Investigation for LSCr10/STO Conclusion Maximilian Morgenbesser(a)*, Alexander Viernstein(a), Niklas Bodenmüller(a), Stefanie Taibl(a), Markus Kubicek(a), Jürgen Fleig(a) (a) TU Wien, Institute of Chemical Technologies and Analytics, Vienna, Austria Contact Information maximilian.morgenbesser@tuwien.ac.at TU Wien - Institute of Chemical Technologies and Analytics Getreidemarkt 9 – 1060 Vienna, Austria References Current and Voltage Measurements for LSCr10/STO Material Optimization Experimental SrTiO3 (STO), a perovskite-type oxide, shows many interesting effects under UV light illumination, such as an increase in oxygen incorporation rate,1 an enhancement in conductivity and a change in color in Fe doped STO single crystals.2 The increased oxygen uptake under UV light has also been used for a battery-type voltage in STO under UV light irradiation.3 With a top layer, e.g. (La,Sr)CrO3 (LSCr), much higher photovoltages can be realized.4 Such high temperature solid oxide photovoltaic (PV) cells are promising due to their possible combination with solid oxide electrolyzer cells (SOEC). By using a common electrode of a PV cell and an underlying SOEC it is possible to directly transfer light to chemical energy. However, optimization of voltage and power of such high temperature PV cells is still required. In this study, different materials (e.g. (La, Sr)(Cr,Mn)O3 (LSCrM), (La,Sr)CoO3 (LSC), (La,Sr)FeO3 (LSF) and NdNiO3 (NNO),…) were tested for their applicability in oxide solar cells and mechanistic insight in processes under UV is gained. 1. Merkle, R., De Souza, R.A., Maier, Angewandte Chemie - International Edition 2001, 40(11), 2126-2129. 2. Viernstein, A., Kubicek, M., Morgenbesser, M., Walch, G., Brunauer, G.C., Fleig, J., Advanced Functional Materials 2019, 29(23). 3. Walch, G., Rotter, B., Brunauer, G.C., Esmaeili, E., Opitz, A.K., Kubicek, M., Summhammer, J., Ponweiser, K., Fleig, J., Journal of Materials Chemistry A 2017, 5(4), 1637-1649. 4. Brunauer, G.C., Rotter, B., Walch, G., Esmaeili, E., Opitz, A.K., Ponweiser, K., Summhammer, J., Fleig, J., Advanced Functional Materials 2016, 26(1), 120-128. Poster Design by Eva Pycha and Stefan Smetaczek Sample preparation: On a single crystaline STO substrate, a thin film, e.g. LSCr or Au is deposited. Pt stripes are applied as a current collector. A porous Pt paste is brushed on the bottom side as a counter electrode. The top layer as well as the substrate are varied in this study. Measurements: The characterization is performed in air at 350 °C. The voltage/current is measured for 15 min withouth UV light, then for 15 min under UV light and then for 15 min after switching the UV light off. Multimeter / Impedance analyzer SrTiO3 single crystal La0.9Sr0.1CrO3 thin film UV lamp Porous Pt paste Pt stripes 15 min 30 min time voltage UV off UV on UV off Figure 1: Sketch of the sample (a) and a typical measurement (b) a) b) Optimization of the high temperature solar cell: The LSCrM/STO system is a very robust high temperature solar cell with photovoltages higher than 1 V at 350 °C. Other top layers also work with high photovoltages, such as Au. The variation of the substrate shows that STO as a substrate generally leads to high photovoltages in this study. Mechanistic insight in processes under UV light: Under UV light illumination, the resistance of the space charge region is switched off. Additionally, stoichiometry polarization leads to an increase in current under UV light (self-enhanced HT solar cell). A change in oxygen stoichiometry occurs forming an oxygen depleted region under the top layer (negative battery voltage). Top Layer Variation: LSCrM/STO Top Layer Variation: Other Materials Substrate Variation Current and Voltage Measurement Long-term Measurement: Current Figure 2: Variation of Sr and Mn content in LSCrM as a top layer Figure 4: Variation of the substrate Figure 3: Variation of the top l	poster
The NanoCommons e-infrastructure – A quick guide to the „what and how“ of nanoinformatics in safety assessment suiting basic to expert users in academia, industry, and regulatory authorities Martin Himly1, Lucian Farcal2, Anastasios Papadiamantis3, Cristiana Gheorghe3, Albert Duschl1, Iseult Lynch3 and the NanoCommons consortium Paris Lodron University of Salzburg1 Edelweiss Connect2, and University of Birmingham3 Nanotechnologies and the resulting novel and emerging materials (NEMs) represent major areas of investment and growth for the European economy. Recent advances have enabled confidence in the understanding of what constitutes toxicity of NEMs in relation to health and environmental hazards. However, the nanotechnology and nanosafety communities remain disparate and unconnected, whilst knowledge and data remain fragmented and inaccessible. The NanoCommons‘ TA service categories & available online training tools Background NanoCommons is a research e-infrastructure project offering access to high quality nanoinformatics tools and services for nanotechnology and nanosafety stakeholders (academia, industry, regulators). It is user-led, offering and developing the services needed by the user community of nanotechnology, nanosafety and related fields. NanoCommons is built on 3 main pillars: joint research activities, networking activities and transnational access (TA) services. Aim This work is funded by the European Union’s H2020 Research & Innovation Action „NanoCommons – The European Nanotechnology Community Informatics Platform: Bridging data and disciplinary gaps for industry and regulators“ (grant agreement No 731032). Acknowledgment II. Data processing & analysis NanoCommons consortium More info on TA: helpdesk@nanocommons.eu www.nanocommons.eu I. Experimental workflow design & implementation III. Data visualization & predictive toxicity IV. Data storage & online accessibility TA services are designed to promote data FAIRness (Findable, Accessible, Interoperable, and Reusable). NanoCommons provides innovative solutions for data mining, harmonisation, utilisation and re-utilisation, including incorporation of a range of modelling and decision support tools that require and/or can produce organised, high-quality datasets. TA service category Nanoinformatics services Training formats Level Experimental workflow PC characterization protocols Written tutorial Basic Data processing & analysis Biomax data templates Recorded webinar Basic NIKC data templates Written tutorial Advanced Jaqpot platform Demo video Advanced Demo video Expert Enalos NanoXtract for TEM image analysis Demo video Basic Online tutorial Basic Biocorona in silico modelling Recorded webinar Advanced OpenRiskNet e-infrastructure Recorded webinars incl demo videos Basic Recorded webinars incl videos and documentations Advanced Data visualization & toxicity prediction Enalos cloud for zeta potential Demo video Basic Recorded webinar Basic Enalos cloud for Safe-by- Design Demo video Basic Online tutorial Basic Guidenano Recorded webinar Basic Data storage Scinote Demo video Basic Online tutorial Basic ACEnano knowledge infrastructure Online tutorial Basic For access to services, info resources & events: www.infrastructure.nanocommons.eu	poster
Application of Artificial Neural Networks on improving predictions of nuclear radii Vasilis Skarlis1, Emmanuel Bratsolis1, Eleni Charou2, Theo J.Mertzimekis1 1Department of Physics, University of Athens, Zografou Campus, GR-15784, Athens, Greece 2IIT, NCSR “Demokritos”, GR-15310, Ag. Paraskevi, Greece Abstract Artificial Neural Networks (ANN) [1] are mathematical computing paradigms imitating the operations of biological neural systems. Their nonlinear nature and ability to learn from the environment make them highly suited to solve real-world problems from those that are still under development. In the field of Physics there are many problems that cannot be adequately solved with the physics-based methods and the use of ANN may yield better results. In the present work ANNs have been tested in predicting nuclear charge radii considering as input the atomic and mass numbers, exclusively. The performance of different supervised ANNs is evaluated. The dataset used for the training and testing was based on evaluated data of nuclear radii available in IAEA tables . Experimental Method In the first experiment, a training set was constructed from 300 randomly selected elements of the dataset and the ability to predict the nuclear radius was tested on the remaining 609 elements. In order to test the capability of networks to predict unknown nuclear radii a second experiment was performed using a subset of 400 elements randomly selected from the first 600 elements of our dataset. The networks were tested in the remaining “unknown” 309 elements. The results of those experiments are shown below. Results & Discussion Conclusion and future work The Feed Forward Neural Network (FFNN) has shown promising results and can be proven useful in predicting unknown radii in exotic regions of the isotopic chart. Work in the near future will pursue radii predictions in the superheavy region and compare the FFNN results with existing theoretical models. References [1] C.M. Bishop, Pattern Recognition and Machine Learning, Springer, Singapore (2006) [2] I. Angeli and K.P. Marinova, At. Data Nucl. Data Tables 99, 69 (2013) Figure 1: Results of FFNN by using 300 randomly nucleus as training set. With blue are the experimental errors and with orange the network errors Figure 2: Results of RBF by using 300 randomly nucleus as training set. With blue are the experimental errors and with orange the network errors Figure 3: Results of our two networks with 400 randomly selected nucleus form the first 600. With blue are the experimental errors, with orange the FFNN and with yellow the RBF errors. • After some experimentation the appropriate FFNN was the one with two hidden layers, 10 and 5 nodes respectively. • From figures 1,2 we can clearly see that FFNN has smaller errors than RBF. For this reason we can say with certainty that it is suitable for predicting an unknown nucleus radius in the known regions of the isotopic map. • If we look at the errors of the smaller nucleus we can see that our networks have relatively big errors and this is due to their incapability to understand the deeper nuclear phenomena that are present. Those phenomena have small contributions for big nuclei, therefore we can have better predictions as we go near the region of super heavy. Introduction & Motivation The information about size and nuclear density distributions in unstable (radioactive) nuclei is usually extracted from the data on interaction of radioactive nuclear beams with a nuclear target thus doing the experiments and analyzing the data is a difficult and time consuming task. Assuming the nucleus is described by the liquid-drop its radius can be described/predicted by the relation R=r0 A1/3, which is in general a rough estimate. The purpose of this work is to assess whether ANNs are capable of predicting nuclear charge radii given the atomic and mass numbers for a given nucleus. This is particularly useful for exotic species, where experimental data are very scarce	poster
5-25Hz Σ Power/sec Threshold (T , mm) 0 0.5 1 0 5 10 15 e Object Localization and Vibrissal Behavior in 3D Per Magne Knutsen, Armin Biess, Maciej Pietr & Ehud Ahissar Departments of Neurobiology and Mathematics, Weizmann Institute of Science, Israel Whisking behavior in 3D We trained rats to discriminate the relative horizontal (posterior-anterior) offset of two vertical poles. Offsets were adjusted according to a staircase procedure, allowing us to estimate psychophysical thresholds. Summary Horizontal object localization Whisker torsion enables labelled-line encoding of horizontal object location Whisker azimuth and torsional rotation Rats can resolve horizontal spatial offsets with hyperacuity resolution, an ability that relies on actively generated whisker movements. The major components of whisking are azimuthal and torsional rotation. These two angles are tightly coupled during whisking, ensuring per- ceptual stability across whisking cycles. Furthermore, the existence of torsion suggests that neurons with different directional selectivity are gradually recruited during active palpation, which enables mapping of contact information onto the circumference of the whisker follicle and a labelled-line code for horizontal object location. High-speed camera Mirror Head bolts Z X z x Y y ϕ θ ζ 0 20 40 -10 10 30 -20 -10 0 Medio-lateral (mm) Rostro-caudal (mm) Dorso-ventral (mm) A B C D E α (dζ/dθ) Whisker Row −1 0 1 R2 = 0.97 A1 B1 C1 D1 E1 = 0.77 (0.77) R2 = 0.74 (0.9) R2 = 0.90 R2 = 0.98 R2 200 ms 40 deg 40 deg θ 40 deg ζ Azimuthal protraction (deg) 0 45 90 135 180 A B C D E Whisker Row A B C D E R(α) Whisker Row 0 0.5 1 0 50 100 150 θ ζ ϕ Angles Amplitude Whisker deflection angle ζ Protraction θ Retraction 0 π -π Follicle orientation Normalized spike-rate Backlit discrimination area Behavioral box Reward well Touch sensor Vertical poles Servo motor IR beam A B C D 1 2 3 4 10mm Offset (mm) Trial number 20 40 1 5 20 0.9 20 2.7 20 40 60 0.5 60 80 100 Angle (deg) 0 250 500 750 50 Time (msec) distance (mm) Nosepoke 0 5 10 15 20 0 50 100 150 Trials Whisks/trial 0 5 10 15 20 0 .25 .5 .75 1 Initial groups After trimming Control groups Sessions (%) 0 5 10 15 20 0 5 10 15 20 0 .25 .5 .75 1 0 .25 .5 .75 1 ALL ARC ROW C2 ROW/ARC-FN ROW-C2-NONE ALL-ARC ALL-ARC-C2 ALL-C2 ARC-C2 ROW-C2 Threshold (T , mm) e,s Threshold (T , mm) e,s Threshold (T , mm) e,s 0 10 20 30 -10 0 10 Radial distance (mm) Horizontal distance (mm) C3 C3 C1 C1 C2 C2 Power/sec (dB/Hz/s) 2 4 6 8 10 .001 .01 .05 1 20 50 5 P-value Frequency (Hz) Whisking frequency (Hz) 0 5 10 15 20 25 0 .05 .1 .15 Probability W The visual system may also employ popula- tions of directionally tuned neurons to encode visual features in a gaze dependent manner. Accuracy of horizontal localization is correlated with whisking power. Spatial acuity depends on whisker configuration Spatial acuity exceeds whisker spacing Horizontal localization is an active process and depends on whisker movement The correlation between torsion and azimuth is reminiscent of Donder's Law in vision, which states that eye torsion is directly related to gaze direction. Such relationships ensure visual/tactile stability across sequential fixations/whisks. Upon contact with an object, the touch signal will be conveyed primarily by a population of primary afferents, whose direc- tional preference coincides with the torsional angle. Reconstructions of whisker movements in 3D using high-speed, stereo videography enabled us to extract 5 degrees of freedom: 3 rotational, and 2 translational movement components. Whiskers undergo torsional rotation (up to 100 deg) during whisking. Torsion was highly cor- related with azimuthal rotations, in a manner consistent for individual whiskers, similar along rows, but systematically varying across rows such that rows A and E counter-rotated. Torsion predicts that neurons with different directional selec- tivity are gradually recruited during active palpation. Thus, tor- sion adds another	poster
Dynamics of mesoplankton community related to sea ice melting in Terra Nova Bay during the austral summer: a diachronic analysis Aim: Characterize mesoplankton dynamics during austral summer, studying sea-ice melting moment to normalize data from several years Study area : Terra Nova Bay (Ross Sea) Why plankton? Plankton represents the base of the sea trophic web and is a fundamental compartment for marine system (also Antarctic) Samplings: 44 samplings were collected in Faraglione Station (74° 43' S ,164° 6’ E) during 12 years of PNRA (Italian National Project for Antarctica Research) expeditions Network Analysis: Provides Ecological Indicators describing functional and structural characteristics of a system 𝑇𝑆𝑇 = ෍ 𝑖=1,𝑗=1 𝑛 𝑇𝑖𝑗 𝑇𝐿𝑗= 1 + ෍ 𝑖=1 𝑛 𝐷𝐶𝑗𝑖× 𝑇𝐿𝑖 𝐴𝑀𝐼= 𝐾 × ෍ 𝑖,𝐽 𝑇𝑖𝑗 𝑇𝑆𝑇 × 𝑙𝑜𝑔𝑇𝑖𝑗 × 𝑇𝑆𝑇 𝑇𝑖× 𝑇𝑗 Trophic Level (TL): TL=1 to primary producers and detritus, other calculated as: Total System Throughput (TST): Sum of all flows in the system Average Mutual Information: Measure of flows organization Mass balanced models Modelling approach based on mass-balanced models flows analysis (Ecopath with Ecosim) Required: - Biomass - Production/Biomass, - Consumption/Biomass - Diet Matrix Days Since Sea-Ice Melting (DaSIM): A novel method to normalize data from different years on the same temporal scale, based on sea ice melting threshold (Dataset of Sea-Ice Coverage from Copernicus), defining four phases in austral summer General Additive Models (GAM) was used to study statistical relationship between DaSIM and Ecological Indicators. Ecological Indicators Discussion - Biomass evidencing the importance of copepods in plankton composition, particularly for Calanidae family. - Phytoplankton biomass and Primary Production identify the moment of phytoplanktonic bloom (Early Season) in correspondence to sea ice melting. A possible second bloom, with the increase of this parameters during end of season. - However, the second phytoplankton bloom is not mirrored by system functionality indicators, probably because the response is too slow or the biomass produced is addressed to other compartments (e.g. microplankton) not considered here. - In Late Season Mean Trophic Level, AMI, TST having they’re maximum values pointing out a system well developed and efficient together with higher equilibrium in term of biomass distribution and groups presence. The mesoplanktonic compartments in Terra Nova Bay starts with the Phytoplanktonic bloom in Early Season, producing a lot of biomass. The system uses this biomass very rapidly, in the beginning, and optimizes the flows organization later when the biomass decreases and the trophic level raises. Biomass GAM Results A. Guida 1,2, P. Povero 1,3, M. Castellano 1, S. Magozzi 1,3, A. Novellino 2, C. Paoli 1,3, P. Vassallo 1,3 Introduction Materials and methods Results 1 DISTAV, Dipartimento di Scienze della Terra dell’Ambiente e della Vita, Università degli Studi di Genova, corso Europa 26, 16132, Genova, Italia 2 ETT S.p.A., Via Sestri 37, 16154, Genova, Italia 3 NBFC (National Biodiversity Future Center), Palermo, Italia 𝐷𝐶𝑗𝑖= fraction of prey i in diet of predator j 𝑇𝐿𝑖= Trophic Level of prey i 𝑇𝑖𝑗= flux out of i- group going in j- group K= scalar constant Distribution of twelve years of expeditions, colors connected with the samplings in the austral summer period Ecopath master equations Consumption = production + respiration + unassimilated part Production = predation mortality + fishing mortality + biomass accumulation + net migration + other mortality DaSIM Temperature Salinity Legends Total System Throughput 0.0102 . 0.1-0.05 Average Mutual Information 0.00296 0.0486 0.0331 * 0.05-0.01 Mean Trophic Level 0.00245 0.0057 0.01-0.001 Primary Production 1.19E-03 * <0.001 Total Biomass 2.00E-16 0.0669 Phytoplankton Zooplankton - Copernicus Climate Change Service (C3S) Climate Data Store (CDS). Copernicus Climate Change Service (C3S) (2024): Sea Ice Concentration Daily Gridded Data from 1979 to Present	poster
IODP Expedition 393: South Atlantic Transect 2 Chiara Amadori, University of Pavia THE ITALIANS ON BOARD! PHYS-PROP CORNER CORE REPOSITORY College Station, TX • The South Atlantic Transect (SAT) The SAT drilled seven sites on 7, 15, 31, 49, and 61 Ma ocean crust along a slow- to intermediate-spreading rate Mid-Atlantic Ridge at ~31°S. This was possible thanks to two engineering Expeditions 390C & 395E and two scientific Expeditions 390 & 393. STRATIGRAPHIC CORRELATION • Post-cruise activities • The Editorial meeting and basement Sample Party in College Station (TX, USA), November 2022: • During the Editorial Meeting, a selected group of the science party from both expeditions works to produce a complete summary describing methods and preliminary results of the Expeditions 390 and 393. These final proceedings will be available to the entire scientific community by 2024. • We sampled basement rocks to perform additional paleomagnetic and physical property analyses. • The XRF-scan analysis in College Station (TX, USA), November 2022: • X-ray fluorescence (XRF) core scanning was conducted on all sediment core sections used to construct the Splice. Data report with these results will be published in January 2024 (Amadori et al., 2024, Site U1560). • Sediment Sample Party in Bremen (Germany) in January 2023: • We sampled sedimentary rocks (stored at MARUM, in Bremen) to perform additional geochemical analyses. • The ECORD Training School in Bremen (Germany) in March 2023. Travel grant provided by IODP Italia. • The ECORD Research Grant for outstanding Early Career Researchers 2023: 3000 EUR. Project Title: Investigating the effects of a novel analytical method on Moisture and Density estimates: porosity correction of basement rocks from the South Atlantic Transect (X390-393). • Exp. 393 – Physical Property Specialist & Stratigraphic Correlator on board The Physical Property Specialist The Phys-prop Specialist characterizes the physical, chemical, and structural properties of the recovered sediment and hard rock cores. Physical properties I’ve measured include bulk density, natural gamma radiation, magnetic susceptibility, compressional and shear velocities, thermal conductivity, porosity, shear strength, and electrical resistivity. They were characterized using a variety of techniques and methods on core sections and discrete samples. The Stratigraphic Correlator As the Stratigraphic Correlator aboard, I used petrophysical and paleomagnetic data to correlate adjacent holes and construct a a complete stratigraphic section for sites drilled during X393. This requires multiple holes at a given site referenced to a composite depth scale (i.e., Splice Section).	poster
U.S. Environmental Protection Agency Office of Research and Development EPA www.epa.gov Hindered phenols are phenols with one or more bulky functional groups ortho to the hydroxyl group. E.g. 3-Chloro-4- hydroxybenzoic acid ( ) Distribution of hindered and non-hindered phenols in the source analog dataset A Systematic Evaluation of Analogs for Read-across Prediction of Estrogenicity Prachi Pradeep1, Kamel Mansouri1, Grace Patlewicz2 and Richard Judson2 1Oak Ridge Institute for Science Education Fellow, National Center for Computational Toxicology, Office of Research and Development, U.S. Environmental Protection Agency, Research Triangle Park, NC, USA 2National Center for Computational Toxicology, Office of Research and Development, U.S. Environmental Protection Agency, Research Triangle Park, NC, USA INTRODUCTION METHODS ANALYSIS ILLUSTRATIVE EXAMPLES CONCLUSIONS Prachi Pradeep l pradeep.prachi@epa.gov l 919-541-5150 Read-across is a data gap filling technique which is commonly used within category and analog approaches to predict a biological property for a target (data-poor) chemical using known information from similar (source analog) chemical(s). Analog identification and evaluation are critical steps in deriving a robust read-across prediction. Potential source analogs are typically identified based on structural similarity. Despite the available frameworks for read-across, few guiding principles exist to help evaluate the scientific validity of any source analogs identified. This case study used a two-tiered approach to analyze structurally related source analogs to read-across estrogenicity for target chemicals of interest. Structural source analogs were identified using 3 different chemical descriptor approaches (Pubchem, Chemotyper and MoSS MCSS) and Tanimoto similarity index as a cut-off. The measured estrogenicity outcomes for the source analogs were then compared with those for the target chemicals to determine the extent of their agreement. A dataset of 2834 phenols as taken from the CERAPP project was used as an inventory of potential source analogs for 2231 hindered phenols (targets). The analysis suggests that none of the 3 descriptor approaches could be considered as an unequivocal method for analog identification for reading across estrogenicity. Analog Selection Method Binding Agreement (%) Number of Target-Analog Pairs Pubchem/ Chemotyper/ MCSS 92.5 87 Chemotyper/ MoSS MCSS 90.0 124 MoSS MCSS 83.9 226 Pubchem/ MoSS MCSS 83.8 136 Chemotyper 67.0 1060 Pubchem/ Chemotyper 63.5 358 Pubchem 59.6 2274 Analog Selection Method Binding Agreement (%) Number of Target-Analog Pairs Chemotyper/ MoSS MCSS 76.5 930 Pubchem/ Chemotyper 76.5 3722 Pubchem/ Chemotyper/ MCSS 76.0 830 Pubchem/ MoSS MCSS 70.0 1780 Chemotyper 69.0 7878 MoSS MCSS 68.0 2314 Pubchem 62.0 19456 Analog Selection Method Number Pubchem Chemotyper MCSS Pubchem/ Chemotyper Pubchem/ MCSS Chemotyper/ MCSS Pubchem/ Chemotyper/ MCSS True Positives (Binders) 502 206 136 172 120 90 90 False Negatives 314 79 50 39 39 19 19 Total Positives 816 285 186 211 159 109 109 True Negatives (Non-binders) 528 148 78 82 64 34 30 False Positives 314 79 50 39 39 19 19 Total Negatives 842 227 128 121 103 53 49 Analog Selection Method Number Pubchem Chemotyper MCSS Pubchem/ Chemotyper Pubchem/ MCSS Chemotyper/ MCSS Pubchem/ Chemotyper/ MCSS True Positives (Binders) 209 94 39 35 25 28 21 False Negatives 25 18 1 10 1 0 0 Total Positives 234 112 40 45 26 28 21 True Negatives (Non-binders) 52 52 13 19 6 8 4 False Positives 152 54 9 11 5 4 2 Total Negatives 204 106 22 40 11 12 6 Number Assay Hindered Non-hindered Total Actives Total Actives Binding 462 207 257 155 Agonist 396 45 204 96 Antagonist 360 46 169 14 Underlying basis for each of the three chemical descriptor approaches Analog Evaluation Method • Select hindered and non-hindered analogs using both: 1. Tanimoto similarity cut-off (0.1 – 0.9), & 2. Number of analogs (1-10) • Analyze the consistency in experimental estrogenic	poster
While productivity is typically the focus of grassland site management, plant biodiversity is another important characteristic of grasslands, which does not necessarily coincide with high productivity. However, both are important for long-term feed and bioenergy supply, food security, and the diversity of other trophic levels (e.g. pollinators). We therefore investigate how different climate change scenarios, soil conditions and management regimes affect grassland biodiversity and productivity. We apply the grassland model GRASSMIND and develop it further. GRASSMIND is an individual-based, mechanistic ecological model. For a given grassland site, it explicitly simulates the processes that let biodiversity dynamics emerge: individual plants can establish, grow and die. q For the pilot study, we focus on one site in Germany (GCEF, run by UFZ) with multiple grassland plots under different, well-controlled management and climate conditions. Observations were biomass, vegetation cover, mowing yield and leaf area index (2013-2022)K q The pipeline elements developed (cf. UC scheme below) include data preparation as input for simulations or as patterns for model recalibration. Also scripts were developed that minimize deviations between observations and model results (parallelized, using Matlab), and the model was and is further improved. q GRASSMIND runs on LUMI, incl. parallelization over hundreds of cores. LUMI results match accurately to those from Windows or the UFZ Linux cluster. Test runs on LUMI were used to assess the number of single stochastic replicate runs required such that the mean results get approximately invariant. We will test the transferability of the recalibration to Python and LUMIK q We also developed result visualization scripts, so far specific to the pilot study. They can be adapted to suite data from additional sites. Introduction Technical description Outputs Biodiversity Dynamics Grassland Biodiversity Dynamics Authors: Thomas Banitz, Franziska Taubert Helmholtz Centre for Environmental Research – UFZ, Leipzig, Germany Biodiverse grassland in Germany. © André Künzelmann, UFZ Use case DT development scheme	poster
Investigating Data-Related Practices in Neuroscience, Psychology, and Beyond Background Research Questions Data Management in Neuroscience Data Management in Psychology Next Steps Neuroscience research presented an ideal test case for studying discipline-specific data management practices. The data involved is often large and complex, small changes in analytical pipelines have significant downstream effects, and there are ongoing efforts to facilitate data sharing and other open science practices. Survey Results To understand the data management practices of active researchers in the field of neuroimaging, we surveyed researchers whose work involves magnetic resonance imaging (MRI) about how they store, organize, document, and preserve their data. A total of 144 researchers from 11 countries, 69 institutions, and a range of research areas participated in our study. Lack of time, professional incentives, and community- supported best practices commonly limiting their current data related practices. Our results indicate that neuroimaging researchers collect data in a variety of forms and that data-related practices differ between and within research groups. Though current levels of adoption were low, a substantial number of participants indicated they would publish preprints, preregister studies, and publish in OA journals in the future. To ensure that our questions would be meaningful to active researchers, we consulted with the neuroimaging community throughout the survey design process. Following up on our survey of MRI researchers, we are currently preparing to investigate data-related practices in the field of psychology. Our survey instrument is being designed in consultation with psychology researchers as well as individuals who work on data-related issues in academic libraries. In addition to advertising through social media and discipline- specific listservs, we will also e-mail corresponding authors of recent articles in psychology journals. We are revising the form and content of our survey to reflect the terminology and tools of psychology research and also to provide us with more information related to limits, motivations, and outstanding needs. 1 2 3 4 5 Field Self Field Self Field Self Da ta Sha ring Da ta Ana lysis Da ta Colle ctio n Maturity Rating Ad-Hoc Mature 1 2 3 4 5 Re late d files ar e lin ked D ocu me nt atio n: Dat a o rg an izat ion File n am in g a nd or ga niza tio n Sen sitiv e d ata is sec ure d Ra w d ata is b ac ked up Da ta Colle ctio n 1 2 3 4 5 Re late d files ar e lin ked Ana lysis wor kflo w is con sist en t Do cum e nta tio n: So ftw ar e a nd co de Do cum e nta tion : An alys is p ipe line Ana lyze d dat a is ba cke d u p Da ta Ana lysis 1 2 3 4 5 Da ta is sh ar ed Pro ce du re s sh ar ed Re sea rc h m at er ials (e. g. stim uli) sh ar ed Da ta cur at ed for r ep rod uc ibility Re late d ma ter ials ar e lin ke d Da ta Sha ring Data Management Maturity Ratings Participants often stated that their RDM practices are more mature than the field as a whole (and they may be right). Participants rated practices related to data collection and analysis as more mature than those related to sharing (and they may be wrong). John A. Borghi, Stanford University Ana E. Van Gulick, Carnegie Mellon University We hope to increase our engagement with the neuroscience and psychology communities and develop follow-up studies and researcher-focused educational materials related to data management and open science. We’re also exploring how to investigate data-related practices in other research areas. Our Paper: https://doi.org/10.1371/journal.pone.0200562 Open Data: https://doi.org/10.1184/R1/5845656.v1 1. How are researchers in different scientific disciplines actually managing and sharing their research data? 2. What are the current levels of adoption for emerging open science practices including publishing preprints, sharing research materials, and publishing in open access journals? 3. How do we, as librari	poster
AutSPACEs: a co-created & open-source project to improve environments for sensory processing in autistic people Bastian Greshake Tzovaras, Georgia Aitkenhead, Callum Mole, Helen Duncan, Martin Stoffel, David Llewellyn-Jones, Sophia Batchelor, James Scott, Susanna Fantoni, Kirstie Whitaker, the AutSPACEs community ✉bgreshaketzovaras@turing.ac.uk https://github.com/alan-turing-institute/AutSPACEs Introduction AutSPACEs stands for Autism research into Sensory Processing for Accessible Community Environments. Together with a team of neurodiverse co- researchers and open-source developers, we are using participatory research to co-create an open source, citizen science platform. AutSPACEs will collect rich, qualitative data on how sensory processing differences affect autistic people’s daily lives. 9/10 autistic people experience sensory processing differences compared to non- autistic people, like finding lights brighter, sounds louder. This can lead to everyday spaces such as school, hospitals, public transport and offices being suboptimal, uncomfortable, or totally inaccessible to many autistic people. While autism is not a disability, AutSPACEs is inspired by the disability rights movement social model of disability and motto : “Nothing About Us Without Us” Goals Methods A Diverse Community Next & ongoing steps 1. Last design improvements: - Improve copy, thanks to Autistic writers & editors - Accessible visualizations, thanks to Autistic illustrator 2. Launch of AutSPACEs platform – already got conditional ethics approval 3. Collect data and open to researchers Supporting our community Susanna Fantoni MODERATION DILEMMA STANDARD APPROACH AUTSPACES STRATEGY Instant rewards vs. protecting users from discriminatory or abusive content Post-publication review Pre-publication review to significantly reduce risk Protecting users from triggering content vs. censoring negative experiences Binary moderation options - publish or remove Traffic-lights system with trigger labels that can be filtered Positive feedback vs. risks of negative feedback (or no feedback at all) Anyone can use or comment No comments on posts Scan to listen to Susanna talk about moderation for a podcast: Scan to watch Otis share his personal account of being a citizen scientist: Otis Smith Collaborator Stories Meet-up sessions Monthly newsletters Twitter GitHub support and upskilling Co-working Inclusive facilitation Sharing opportunities Creating inclusive spaces “…it’s not just expert advice, everyone is…coming from their life experience, from their relative’s experience, and they’re saying, ‘it helped someone, I’m sure it would help others’, so I think a project like this is important” Autistic adult and parent to an autistic child Co-design case-studies Moderating the AutSPACEs platform Scan to read our preprint on the moderation approach: Green= Meets all requirements Amber= Doesn’t break CoC but contains potentially triggering content so will be flagged Red= Breaks CoC and will not be approved for public sharing User testing our platform implementation So far, we did two cycles of user testing, with a total of 24 autistic participants (20 new to the project, 4 existing contributors). In response platform improved in many categories, including: - Finding & fixing bugs - Optimizing user flows - Improving digital accessibility (dark mode, sensory requirements) Run task-based user tests Aggregate & anonymise feedback Analyse feedback Prioritise improvements Further develop & improve platform Done by/with larger AutSPACEs community	poster
Authors: Vera Chiquet; orcid.org/0000-0001-5925-2956, vc@virtualculture.ch Marian Clemens Manz; orcid.org/0000-0002-4408-7107, marianclemes.manz@unibas.ch Organization(s): 1: Virtual Culture GmbH, Switzerland; 2: University Basel, Switzerland www.virtualculture.ch This poster is licensed under CC BY SA 4.0. The Digital Humanities Lab of the University of Basel, Virtual Cul- ture, and the Digital Museum of Learning, an Initiative of the Ja- cobs Foundation realized a collaborative photogrammetry project. Digital Capacity Building for GLAMs References: Sapirstein, P. (2018). A high-precision photogrammetric recording system for small artifacts. Journal of Cultural Heritage, 31, 33–45. https://doi.org/10.1016/j.culher.2017.10.011. Tan, P. (2020). Image-Based Modeling. In Computer Vision (S. 1–4). Springer International Publishing. https://doi.org/10.1007/978-3- 030-03243-2_11-1. Westoby, M. J., Brasington, J., Glasser, N. F., Hambrey, M. J., & Reynolds, J. M. (2012). ‘Struc- ture-from-Motion’ photogrammetry: A low-cost, effective tool for geoscience applications. Geomorphology, 179, 300–314. https://doi. org/10 1016/j geomorph 2012 08 021 In recent times, museums have endeavored to present themselves as insti- tutions that are committed to promoting public education. In light of this, it is essential that they adopt measures that prioritize the expansion of their outreach and visibility, as well as the exhibition of their collections and dis- semination of knowledge. Currently, digital methods are the primary means of achieving these goals. The optimal utilization of digitized materials in this process involves meeting various standards, which enable their application not only in research contexts but also in other museum-related activities such as marketing and education. While sizable cultural heritage institu- tions possess the requisite financial and human capital to facilitate internal digitization workflows and efforts or engage third-party service providers for support, their smaller counterparts lag behind in this regard. Image-based modeling, also known as photogrammetry or structure from motion photogrammetry (SfM), has become a ubiquitous technique for creating 3D models of cultural heritage. Today’s use of highly efficient algorithms, including SfM, multi-view stereo, mesh reconstruction, and texture synthesis, and accessible user interfaces in both commercial and open-source software packages have made it possible to convert 2D image data into textured 3D models in an easy-to-use, flexible, and cost-effective manner. As a result, photogrammetry is a particularly suitable method for cultural heritage digitization in GLAM institutions, as it offers a viable alternative to the purchase of expensive laser and light scanning systems. The effectiveness of SfM software is largely dependent on the pixel data extracted from imported source files, highlighting the critical role that 2D photographic image quality plays in the creation of high-fidelity 3D models. Therefore, the development of 3D guidelines for the creation of 3D models using photogrammetry should focus not only on the processing of the data, but also on the acquisition process. To achieve this, researchers from the Digital Humanities Lab at the University of Basel created a prototype and documented each step of the acquisition and processing. The resulting guidelines were formulated and communicated in text form, supplemented by images and videos to ensure their clarity and accessibility. By providing detailed instructions and best practices for data acquisition and process- ing, these guidelines can help ensure the quality, accuracy, and usability of photogrammetry-generated 3D models. Photogrammetry DIY on research quality level Initiative and Goal Designing digital exhibitions, with a focus on education in the con- text of schools and children to reach a larger audience, is one of the tasks that the Digital Museum of Learning, an initiative of the Jacobs Foun	poster
Matter vs. vacuum oscillations at long-baseline accelerator neutrino experiments arXiv:2001.08676 Suman Bharti1, Ushak Rahaman2, S. Uma Sankar1 1Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076, India, 2Centre for Astro-Particle Physics (CAPP) and Department of Physics, University of Johannesburg, South Africa Abstract We search for evidence of modiﬁcation of neutrino oscillation by matter eﬀect in the data of T2K and NOνA. We ﬁnd that vacuum oscillations provide as good a ﬁt to the data as matter modiﬁed oscillations. Even an extended run of these experiments, with 5 years each in neutrino and anti-neutrino modes, can not make a 3 σ distinction between vacuum and matter modiﬁed oscillations. A 5 σ discrimination against vacuum oscillations requires the combination of (5ν + 5¯ν) runs of T2K, NOνA and DUNE. Introduction Due to the propagation of the neutrinos through earth matter, it is expected that the oscillation probabilities would be modiﬁed by matter eﬀects. These matter eﬀects are sensitive to the sign of ∆31 and their observation can lead to a determination of this sign. For baselines less than 1000 km, the matter eﬀects lead to negligibly small changes in νµ/¯νµ survival probabilities [1]. In the case of atmospheric neutrinos, the survival probabilities Pµµ and P¯ µ¯ µ are expected to undergo signiﬁcant changes due to matter eﬀects. However, at present Super-Kamiokande is able to make only a small distinction between them [2]. In the long- baseline accelerator experiment, the νe/¯νe appearance data is sensitive to matter eﬀects [3, 4]. But they are also sensitive to the unknown CP violating phase δCP. Given a set of data, three solutions are likely to occur [5, 6]: • matter modiﬁed oscillations with NH and δ1 CP, • vacuum oscillations with δ2 CP and • matter modiﬁed oscillations with IH and δ3 CP. Unless the question of vacuum vs matter modiﬁed oscillations is resolved, it may not be possible to measure δCP. Establishing CP violation in neutrino oscillations is one of the most impor- tant goals of both current and future long-baseline accelerator neutrino experiments. To achieve this goal, it becomes impor- tant to establish a distinction between vacuum oscillations and matter modiﬁed oscillations. Analysis procedure We calculated the theoretical event spectra with three ﬂavour oscillations using GLoBES [7, 8], for the appearance and disap- pearance channels in both neutrino and anti-neutrino modes for T2K and for NOνA. These rates are calculated with the mat- ter potential parametrized as q ∗A, where A is the standard Wolfenstein matter term [9] and q is a multiplicative factor. In this analysis, we consider the possibility of non-standard matter term, as was done in ref. [2]. ∆21 and sin2 θ12 were held ﬁxed to their best-ﬁt values [10]. Other oscillation parameters were varied in their 3 sigma ranges given in ref. [10]. q has been varied in the range [0, 2]. For each data set of each experiment, the Poissonian χ2 is calculated with χ2 = X i 2[(Nth i −Nexp i ) + Nexp i × ln(Nexp i /Nth i )] + X j [2 × Nth j ] + χ2(sys), (1) where i stands for bins for which Nexp i ̸= 0 and j stands for bins for which Nexp j = 0. The term χ2(sys) arise due to systematic uncertainties. For each of the two experiments, we included sys- tematic uncertainty of 10%, using the pull method. We varied the pull parameter in 3σ range and marginalized over it to de- termine χ2 as a function of test values of oscillation parameters, mass hierarchies and q. We calculated the total χ2 for both NH test and IH test by adding up χ2 m from all experiments and all channels, but for same parameter values. We added priors on sin2 θ13, sin2 θ23 and \|∆31\| (\|∆32\|) for NH (IH). We found the minimum of χ2(tot) and subtracted it from all other val- ues of χ2(tot) to obtain ∆χ2 and marginalised ∆χ2 over all the oscillations parameters except hierarchy and q. Analysis and expectations of NOνA and T2K present T2K and NOνA data for the POT	poster
Discovering Young Eclipsing Binary Systems with TESS Ann Sinclair1, Celia Parts1, Eric Jensen1, Kim McLeod2, Karen Collins3, John Kielkopf4 1Swarthmore College, 2Wellesley College, 3Harvard-Smithsonian Center for Astrophysics, 4University of Louisville Sample Selection We began our search for young, low-mass EBs using a set of 5007 young stellar objects (YSOs) with masses of ~0.05-1.5 M◉ identified from the APOGEE-2 spectro- scopic survey [3]. To optimize our chances of finding EBs, we first examined two subsets of these YSOs: those flagged as double-lined spectroscopic binaries and those identified as radial velocity variables. For each of these 398 targets, we used the Lightkurve package to produce cutouts of TESS full frame images and perform aperture photometry to create a series of light curves and field plots. We inspected the light curves by eye to identify potential EB systems. From these plots, we compiled a sample of potential young, low-mass EBs. Figure 5 from Pegues et al 2021 [2] Our Sample We have identified nine targets that may be young, low-mass EB sys- tems. Eight of these targets were found in star forming regions of Orion; the other in IC 348. Their periods vary from 1.7 to 15.9 days, and many exhibit non-eclipsing variability, likely caused by rotation. At least two-thirds of these targets are double-lined spectroscopic binaries. Modeling and OriNTT 429 We flattened each light curve in our sample to elimi- nate any non-eclipse variation. Using the exoplanet package, we fit preliminary models to the flattened light curves. We employed Markov chain Monte Carlo (MCMC) sampling to find the distribution of possible values for each system’s stellar parameters, with a focus on fine-tuning the eclipse times and periods that will inform follow-up observations. We obtained radial velocity measurements for our target OriNTT 429 (TIC 276662451) from spectra taken for a previous study of PMS binary systems [5]. These data allowed us to perform a full model fit on the target and more tightly constrain its stellar properties. This model fit yields primary and secondary masses of 1.15 ± 0.0180 and 1.07 ± 0.0164 M◉, respectively. We also find the system to have an elliptical orbit with an eccentricity of 0.287 ± 0.00114 and a period of 7.46 ± 5.52e-7 days. Next Steps While we have performed initial model fits for the systems in our sample, we need radial velocity measurements and multi-wavelength observa- tions of the targets to accurately determine their stellar parameters. We plan to take ground-based follow-up observations of the systems this fall and winter. Once we have these supplementary data, we will use the measurements to model each system and find its properties. We also want to extend our search to include all 5007 YSOs in the original data- set. Ultimately, we hope to use our findings to better constrain models of PMS stellar evolution. Why look for young EBs with TESS? Finding young eclipsing binaries (EBs) and determining their properties can allow us to better understand and model how stars evolve before they reach the main se- quence. At low masses, current pre-main-sequence (PMS) models do not agree with one another [1] and are not always consistent with measured stellar prop- erties [2]. Stellar parameters of EB systems can be mea- sured from observations with very few assumptions, making them ideal targets for constraining models of PMS stars. In this project, we aim to identify previously unknown young EBs using TESS data, determine their properties, and compare them to PMS models in order to help enhance the current understanding of young stellar evolution. Figure 1: Plot of measured masses for a set of PMS stars as a function of mass predict- ed by PMS evolutionary models. The points systemati- cally fall above the 1:1 ratio line, showing disagreement between the measured and predicted masses. Figure 2: Normalized light curves generated from one sector of TESS data for each of the nine EBs currently	poster
Correlation of Motor and Social Skills in Toddlers with Autism Spectrum Disorder: Preliminary Findings Sabrina Martinez1, Jamie Holloway, PT, DPT, PhD, PCS2 1University of South Florida, Honors College, 2University of South Florida, School of Physical Therapy and Rehabilitation Sciences Sabrina Martinez Email: smartinez14@mail.usf.edu Contact Information 1. Baio J, Wiggins L, Christensen DL, et al. Prevalence of Autism Spectrum Disorder Among Children Aged 8 Years -- Autism and Developmental Disabilities Monitoring Network, 11 Sites, United States, 2014. MMWR Surveillance Summaries. 2018;67(6):1- 23. 2. World Health Organization. The ICD-10 classification of mental and behavioral disorders: clinical descriptions and diagnostic guidelines. World Health Organization; 1992. 3. Downey R, Rapport MJ. Motor activity in children with autism: a review of current literature. Pediatric Physical Therapy. 2012;24(1):2-20. 4. Holloway JM, Long TM, Biasini F. Relationships Between Gross Motor Skills and Social Function in Young Boys With Autism Spectrum Disorder. Pediatric Physical Therapy. 2018(3):184. References INTRODUCTION Twelve toddlers with ASD between the ages of 18 and 42 months were recruited for this study. Participant ages ranged from 25 to 41 months, with a mean age of 35 months. METHODS • Children with ASD who had higher motor scores generally had higher social scores. • Higher fine motor scores tended to be related to adult, peer, and self-concept and social role subtests. • Children with higher gross motor scores generally had higher peer interaction scores. • Findings may be related to the fact that children are often very active when they socialize, participating in activities which require both gross and fine motor skills. DISCUSSION • Motor skill levels of children with ASD were correlated with social functioning, as children who had better motor scores also had better social skills. • Correlation may be due to the importance of strong motor functioning for children to be able to socialize and engage in active pastimes with one another. • Results suggest that including intervention strategies for children with ASD which improve motor skills may also be beneficial for increasing social functioning, as these skills appear to be related. CONCLUSIONS Current research states that 1 in every 59 children has a diagnosis of autism spectrum disorder (ASD) (1). ASD is a neurodevelopmental disorder which is characterized and diagnosed by poor social and communication skills as well as atypical repetitive behavior patterns (2). Emerging evidence suggests that ASD may also be linked to various motor impairments. Impairments of fine and gross motor skills prevent children with ASD from engaging in the same number and range of activities as their typically-developing peers (3). A previous study done has shown that motor skills are predictive of levels of social functioning as well as social participation (4). The purpose of this study was to investigate the connection between motor and social skills in toddlers diagnosed with ASD. RESULTS This research was supported by the Florida Physical Therapy Association through the Linda Crane Research Award. A special thank you also goes to Emily Shaffer- Hudkins, Marcela Galicia, Nicholas Smith, and Holland Hayfod for their assistance. Acknowledgements • More research will allow the disorder to be better understood, supporting development of earlier and more comprehensive intervention strategies for children with ASD. • Interventions which improve overall motor skills, such as physical therapy, could be useful for improving participation of children with ASD. FUTURE DIRECTIONS Participant Demographics Demographic Variable Number (%) Gender Male 7 (58) Female 5 (42) Race White/Caucasian 6 (50) African American 2 (17) Asian 1 (8) 2 or more races 3 (25) Ethnicity Non-Hispanic 10 (83) Hispanic 2 (17) Measures Peabody Developmental Motor Scales, Second Edition (PDMS-2) Used to measure fine and gross	poster
Science–media online training: challenges and opportunities • 6 training sessions • 5 topics • 7 trainers • 76 participants • 17 countries • Each session: 5-12 hours Planned (for 2020) 3 day meeting, Toulouse Implemented (during 2021 and 2022) Six online sessions Topics and trainers: • Combining visual and written elements in science communication Filipa Vala and Gil Costa • Science journalism Peter Hyldgård • Science and the Media: A match made in Heaven Sara Sá and Renata Pinto • Writing about science for the media Rita Ponce • Low-cost science video: from production to communication Miguel Ferreira Euroscitizen and EVOKE Challenges • Online environment • Group diversity Opportunities • Reduced costs • Greater scope (and higher diversity) • Higher flexibility • Networking Important to include • Hands-on activities • Group work • Brainstorming activities • Debate • Sharing ideas and good practices • Evaluation Rita Ponce, Filipa Vala, Gil Costa, Peter Hyldgård, Sara Sá, Renata Pinto, Miguel Ferreira, Susana Ambrósio, Raquel Branquinho, Antonio García and Szymek Drobniak WANT TO ORGANIZE AN ONLINE TRAINING? Check out our check-list	poster
Motivation and objective Effects of pressure and precursor flow rate on the surface chemistry of the plasma-polymerized coatings Chamber Pressure (kPa) Precursor Flow rate (g/h) S (%) C (%) O (%) - - - 77.3 ± 0.8 22.7 ± 0.8 10 0.250 9.6 ± 1.2 79.5 ± 0.5 10.9 ± 1.4 15 0.250 4.3 ± 1.1 79.7 ± 1.4 16.0 ± 2.4 10 0.125 4.3 ± 1.4 77.5 ± 0.9 18.1 ± 1.9 • The optimal chamber pressure: 10 kPa • The optimal precursor flow rate: 0.25 g/h Table 1: Surface chemical composition of untreated and plasma-coated PCL nanofibers at different pressures and precursor flow rates (discharge power: 5 W and treatment time:10 min) Effects of treatment time and discharge power on the surface chemistry of the plasma-polymerized coatings and morphology of the treated fibers Discharge power (W) Treatment time (min) S (%) C (%) O (%) - - - 77.3 ± 0.8 22.7 ± 0.8 3 10 6.0 ± 2.2 75.7 ± 0.6 18.2 ± 1.9 3 15 10.9 ± 0.7 79.1 ± 0.6 10.0 ± 1.0 5 10 9.6 ± 1.2 79.5 ± 0.5 10.9 ± 1.4 5 15 10.0 ± 0.5 81.2 ± 0.9 8.8 ± 0.4 Table 2: Surface chemical composition of untreated and plasma-coated PCL nanofibers at different treatment times and dis- charge powers. Water stability of the plasma-polymerized thiol-rich coatings Treatment Power (W) Treatment Time (min) C (%) O (%) S (%) 3 10 75.4 ± 0.4 18.1 ± 1.3 6.6 ± 1.1 3 15 77.4 ± 1.4 15.1 ± 4.3 7.5 ± 2.4 5 10 77.8 ± 0.4 13.5 ± 1.7 8.7 ± 1.4 5 15 77.5 ± 1.2 15.6 ± 2.9 6.9 ± 2.7 Table 3: Surface chemical composition of plasma-coated PCL nanofibers at different treatment times and discharge powers after immersion in water at 37˚ C for 24 h The most stable coating with the highest S-content Cyto-responsive properties of the untreated and thiolated PCL nanofibers Untreated Thiolated D1 D3 D7 Figure 5: Live-dead staining images of Schwann cells cultured on untreated and plasma-coated nanofibers for 1, 3 and 7 days. Figure 6: Percentage of metabolically active Schwann cells cultured for 1, 3 and 7 days on untreated and plasma- coated PCL nanofibers (MTS analysis). Figure 3: SEM images of the thiolated PCL nanofibers after immersion in water for 24 h at 37˚ C. Figure 4: Average diameter of the thiolated PCL nanofibers before and after immersion in water for 24 h at 37˚ C (BW: before water immersion; AW: after water immersion). Figure 1: SEM images of untreated and plasma coated PCL nano- fibers at different discharge powers and treatment times. Improved cell adhesion, proliferation and viabil- ity on plasma-coated PCL nanofibers compared to untreated nanofibers Treatment time Discharge power Methodology • Reactor: dielectric barrier discharge (DBD) environmentally friendly, homogeneous coating • Studied parameters: precursor flow rate, chamber pressure, discharge power and treatment time. Conclusion Contact Pegah Zahedifar PhD researcher- Biomedical Engineering Department of Applied Physics Faculty of Engineering and Architecture - Ghent University Sint-Pietersnieuwstraat 41 - B4, B-9000 Ghent, Belgium E-mail: Pegah.Zahedifar@UGent.be Figure 2: Evolution of the nanofiber average di- ameter as a function of plasma treatment times and discharge powers. Deposition of thiol-rich coatings on nanofibrous scaffolds via atmospheric pressure DBD plasma for tissue engineering applications Pegah Zahedifar, Rouba Ghobeira, Sheida Aliakbarshirazi, Rino Morent, Nathalie De Geyter Research Unit Plasma Technology (RUPT), Department of Applied Physics, Gent University, Sint-Pietersnieuwstraat 41, B4, 9000 Gent, Belgium Pegah.Zahedifar@ugent.be • Surface S-content of plasma polymerized layer • Thickness of the plasma polymerized layer Optimal plasma process parameters: precursor flow rate: 0.25 g/h, chamber pressure: 10 kPa, discharge power: 5 W and treatment time: 10 min Surface S-content of around 10 % Stable coatings in water at 37 ˚ C for 24 h Improved Schwann cell performances Discharge power: 5 W Treatment time: 10 min	poster
ASSESSING THE SUITABILITY OF NATURE-BASED CLIMATE CHANGE ADAPTATION TECNIQUES FOR COASTAL EROSION IN PRINCE EDWARD ISLAND, CANADA. Erin Nelson, Dr. Danika van Proosdij Saint Mary’s University, BSc. Environmental Science Will Flanagan Heather Nelson George NelsonAcknowledgementsConclusion • Always conduct a site visit in the decision-making process • Ground truth various reference areas Figure 6. A) the site using the MCA in GIS is suitable and moderate; B) the ground truthing, shows the site would be impossible due to a rocky foreshore • Weight the criteria used in the MCA according to its sensitivity • Encourage governments, NGOs, other groups to prioritize education and workshops regarding NbSRecommendationsAbstract • PEI is the most at-risk province for coastal erosion(1) • Millions of dollars of infrastructure are at-risk • Shifting protection methods to NbS is needed. Figure 1. Operation time vs. space required for structures(2) Figure 2. Example A) hard engineered structure; B) nature-based solution (3) • Tidal wetlands are known to be a great location for living shorelines, which are a type of NbS (4,5) • A multi-criteria analysis (MCA) with differing NbS outputs was completed in ArcGIS Pro • Encouragement and education of these soft protection measures are criticalIntroduction • Data collection Table 1. Parameters measured during on-site visits Table 2. Parameters gathered through desktop • Assessment framework • Tool comparison • Modified index creation and output using MCAMethodologyResultsConclusions • PEI is suitable for hosting NbS • Wetlands account for nearly 60% of the suitable areas Figure 5. Example of a marsh where NbS can be implemented • MCA is limited by data availability and weighted criteria • Lack of encouragement and education hinders NbS implementation Figure 3. Suitable sections of shorelines within PEI. Primarily noted within bays and estuaries. Figure 4. Clustering of impossible site locations from field visits in top-left corner. Majority of other sites are moderately suitable. Table 3. Total values of outputs from the tool assessment framework for all four categories. All of the categories are equally weighted at 25%. Table 4. North Shore GIS (desktop and field) outputs for on-site locations compared with tool outputs from the two interactive tools that characterize PEI to the highest degree. Table 5. South Shore GIS (desktop and field) outputs for on-site locations compared with tool outputs from the two interactive tools that characterize PEI to the highest degree. Table 6. Suitability breakdown of the PEI coastline for NbS. All segments are moderately suitable unless they are determined to be impossible or inconclusive Table 7. Suitable shoreline area breakdown by shore types. A) B)References 1. Lemmen, D.S., Warren, F.J., James, T.S. and Mercer Clarke, C.S.L. editors (2016): Canada’s Marine Coasts in a Changing Climate; Government of Canada, Ottawa, ON, 274p.Lerman, S.B., Turner, V.K., Bang, C. (2012). Homeowner association as a vehicle for promoting native urban biodiversity. Ecology and Society 17(4). http://dx.doi.org/10.5751/ES-05175-170445 2. Bridges, T. S., J. K. King, J. D. Simm, M. W. Beck, G. Collins, Q. Lodder, and R. K. Mohan, eds. 2021. International Guidelines on Natural and Nature-Based Features for Flood Risk Management. Vicksburg, MS: U.S. Army Engineer Research and Development Center. Retrieved September 19th, 2021, from http://dx.doi.org/10.21079/11681/41946 3. Woods Hole Group, Inc. (2017). Living shorelines in New England: state of the practice. The Nature Conservancy. Retrieved March 6th, 2022, from https://www.northeastoceancouncil.org/wp-content/uploads/2018/12/Final_StateofthePractice_7.2017.pdf 4. Connecticut Department of Energy and Environmental Protection. (2018). Living on the shore: tidal wetlands. Retrieved October 7th, 2021, from https://portal.ct.gov/DEEP/Coastal-Resources/Living-on-the-Shore-Brochure/Tidal-Wetlands 5. Leonardi, N., Carnacina, I., Donatelli,	poster
Download the poster windeurope.org/tech2021 #WindTech21 H = 100m H = 142m V2_FCR ZX V2 V1 Figure 2 shows a comparison of wind speed measurements between lidar systems and meteorological mast for two measurement heights. Devices with similar measurement strategies have little difference in the calculated linear regression. For the higher altitude, R2 improves between 0.04 - 0.1 for all devices. The influence of the flow correction FCR is negligible. Statistical comparison of the lidar measurement error of different wind lidar profilers in complex terrain Martin Hofsäß1, Oliver Bischoff1, Doron Callies2, Dominic Clement2, Tobias Klaas-Witt2, Carolin Schmitt3, Po Wen Cheng1 1Stuttgart Wind Energy (SWE), University of Stuttgart, Germany; 2Fraunhofer IEE, Kassel, Germany; 3EnBW, Stuttgart, Germany PO.158 Replace with QR code Replace with QR code 1. Klaas, Tobias; Emeis, Stefan (2021): The five main influencing factors on lidar errors in complex terrain 2. Hofsäß, Martin; Clifton, Andrew; Cheng, Po (2018): Reducing the Uncertainty of Lidar Measurements in Complex Terrain Using a Linear Model Approach. In: Remote Sensing 10 (9), S. 1465 3. Bradley, Stuart; Strehz, Alexander; Emeis, Stefan (2015): Remote sensing winds in complex terrain - a review. In: Meteorologische Zeitschrift (24) Measurement campaign • 29.03.2022 – 07.08.2022 • Meteorological mast top height 142 𝑚 • Windcube V2 FCR • Windcube V1 • Zephir ZX300 This section shows the relative lidar error per wind direction sector. The error varies, among other things, over the direction due to the complexity of the terrain. Based on the results obtained so far, the following can be concluded: With some small offset, all instruments show a similar pattern of relative error with respect to wind direction. The relative error differs in absolute values but not in the variation over the altitude. Abstract/Problem description Results #3 Wind direction-wise lidar error Results #1 Comparison of the linear regression Summary & Outlook Measurement campaign setup + site characteristics Acknowledgments & References This work was part of the research project “LoTar” which was funded by the German Ministry for Economic Affairs and Climate Action under the code number 03EE3052. Results #2 Wind speed-wise lidar error The evaluations in this work show that there can be differences in the determination of wind conditions in complex terrain between lidar devices of different type. However, our findings are based on only one measurement campaign. Currently, data from another measurement campaign with the same lidar devices at a different location are being evaluated. Figure 1: (a) View of the measurement setup from north to south; (b) site topography with isohypses; (c) sector-wise wind conditions of the filtered data. Figure 3 shows the relative lidar error versus wind speed. The relative lidar error is calculated for each lidar system for every wind speed bin with the following equation: Figure 4: Comparison of the mean relative lidar error over the wind direction for a 10°sector width. The meteorological mast is used as reference system. The coloured area along the lines represents the standard deviation. Figure 3: Comparison of mean relative lidar error over horizontal wind speed. The measuring mast is used as the reference system. The coloured area represents the standard deviation. In flat terrain with homogeneous flow conditions, the so called lidar measurement error of commercial lidar profilers is usually negligible for the determination of the 10-minute mean wind speed and wind direction. However, in complex terrain with inhomogeneous flow, this is different and may result in a lidar measurement error. The influence of different measurement strategies or devices on the lidar error in complex terrain has not yet been systematically investigated. Within the framework of the LoTar project, this question is being investigated in the course of several measurement campaigns. The challenge of	poster
Mobile HealthApplications:A StudyonAwareness, Attitude and Practice among Medical Students in Sarawak JulianValerieJohnJembai1,CharleneWongYiLin1,NurAliaMuhammadAmirBakhtiar1,SitiNursurayaMdLazim1,KuanPei Xuan2, Chua PinFen1 1Faculty of Medicine and Health Sciences, University Malaysia Sarawak, Malaysia , 2Digital Health Research and Innovation, Institute for ClinicalResearch, Malaysia Poster No. P-88 NMRR-20-2834-57731 Introduction In tandem with the Fourth Industrial Revolution (4IR), integrated mobile Health (mHealth) applications (apps) are important for the rapidly evolving digital healthcare. However, there are limited studies exploring on mHealth apps especially among medical students. Thus, we aim to assess the awareness, attitude and practice of mHealth apps among medical students. Methodology We conducted a cross-sectional study among medical students in a government university in Sarawak from January to April 2021. Validated questionnaires on basic demographics, awareness, attitude and practice on mHealth apps (medical education, health and fitness and COVID-19 management) were administered to all consented students. Results More than half of the respondents had high awareness for mHealth apps (medical education (61.8%), health & fitness (76.3%) and COVID-19 management (82.7%) (Fig. 1). Positive attitude towards these apps were observed (97.2%, 98.4% and 97.5% respectively). However, less than half of the respondents have installed the medical education apps (n=89, 35.7%) and health and fitness apps (n=97, 39%) (Fig. 2). The practice of medical education apps was significantly associated with household income of the respondents (p<0.05) whereby the usage was seen most in T20 category (Table 1). Results Respondents’ uncertainty to choose suitable apps was the most common barrier reported to the use of medical education apps (n=110, 68.8%) and health and fitness apps (n=112,73.7%) (Fig. 3). 61,8% 76.3% 82.7% 0.00% 20.00% 40.00% 60.00% 80.00% 100.00% Fig. 1 Respondents Awareness on mHealth Apps Medical Education Apps Health and Fitness Apps COVID-19 Management Apps Fig. 3 Barriers for Not Using Medical Education and Health and Fitness apps Discussion/Conclusion The medical students had good awareness and attitude towards mHealth apps. However, the practice of using mHealth apps was relatively low. Thus, efforts to address the barriers and the promotion of use of mHealth apps are necessary. Acknowledgement We would like to thank University Malaysia Sarawak (UNIMAS) and the Director General of Health Malaysia for the permission to present this poster. We would also like to acknowledge and thank Dr Gajendra Singh and Dr Prince Peprah for their permission and advice in using the questionnaires for this study. References 1. Castro E Melo, J., & Faria Araújo, N. M. (2020). Impact of the Fourth Industrial Revolution on the Health Sector: A Qualitative Study. Healthcare informatics research, 26(4), 328–334. https://doi.org/10.4258/hir.2020.26.4.328 2. Kayyali, R., Peletidi, A., Ismail, M., Hashim, Z., Bandeira, P., & Bonnah, J. (2017). Awareness and Use of mHealth Apps: A Study from England. Pharmacy (Basel, Switzerland), 5(2), 33. https://doi.org/10.3390/pharmacy5020033 3. Peprah, P., Abalo, E. M., Agyemang-Duah, W., Gyasi, R. M., Reforce, O., Nyonyo, J., Amankwaa, G., Amoako, J., & Kaaratoore, P. (2019). Knowledge, attitude, and use of mHealth technology among students in Ghana: A university-based survey. BMC medical informatics and decision making, 19(1), 220. https://doi.org/10.1186/s12911-019-0947-0 4. Singh, G., & Alva, S. (2019). A Survey on Usage of Mobile Health Apps among Medical Undergraduates. Community Medicine and Public Health Care, 6, 1-6. https://doi.org/10.24966/CMPH-1978/100053 5. Subhash, T. S., & Bapurao, T. S. (2015). Perception of medical students for utility of mobile technology use in medical education. International Journal of Medicine and Public Health, 5(4). 66 152 160 183 97 89 0 50 100 150 200 COV	poster
We have synthesized and tested about 50 designs using our new Autobreak and Simulation tools. All data collection is complete, and we are drafting the manuscript. The only pending item before we publish is to complete our web-based software tool (Cadnano Toolkit) to make the tools available to the community. This should take about 6 weeks. Screenshots of the frontend Cadnano Toolkit (CTK ) interface, built with VueJS. The backend API is built with Python, Flask, and nginx. E A B C D F G	poster
2) ML model training Input features Geographical location Time information Meteorological data Target variable GNSS ZWDs Prediction of atmospheric parameters at the Geodetic Prediction Center of ETH Zurich Benedikt Soja, Laura Crocetti, Marcel Iten, Shuyin Mao, Matthias Schartner Institute of Geodesy and Photogrammetry, ETH Zurich Ionospheric modeling[2] • The ionosphere is the ionized part of the Earth’s upper atmosphere, which is a significant error source in space geodetic techniques Tropospheric modeling[1] Ionospheric spatial modeling Ionospheric temporal modeling • ML-based GIMs offer improved spatio-temporal resolution and accuracy compared to traditional spherical harmonics-based models, enhancing the positioning accuracy in single-frequency GNSS applications. 2) ML model training 1) GNSS ionospheric VTEC monitoring 3) ML-based GIMs with uncertainty Space weather indices ML-based GIMs of previous days Forecasted ML-based GIMs Flowchart of ML-based global ionospheric spatial modeling 1) Ionospheric vertical total electron content (VTEC) estimation using GNSS 2) ML model training 3) GIMs generation using ML models Flowchart of ML-based global ionospheric temporal modeling • The troposphere, Earth’s lowest atmospheric layer, can be monitored using Global Navigation Satellite Systems (GNSS) • Zenith wet delay (ZWD) is highly correlated to the amount of water vapor in the atmosphere • GNSS measures zenith total delay, which is split into a zenith hydrostatic delay and a zenith wet delay • ML-based global ZWD model is interesting for meteorological studies • Accurate ZWD predictions are required to improve real-time navigation applications Geodetic Prediction Center (GPC) Tropospheric spatio-temporal modelling 1) GNSS ZWD monitoring + meteorological data 3) ML-based global ZWD predictions ZWDs [mm] for 1st of January 2024, 00:00 UTC • Forecasted GIMs based on ML approach can be used for real-time GNSS applications [1] Crocetti, L., Schartner, M., Zus, F., et al. (2024). Global, spatially explicit modelling of zenith wet delay with XGBoost. J Geod, 98(23). https://doi.org/10.1007/s00190-024-01829-2 [2] Mao, S., Kłopotek, G., Pan, Y., & Soja, B. (2024). Global Ionospheric Modeling Using Multi-GNSS: A Machine Learning Approach. IGARSS 2024-2024 IEEE International Geoscience and Remote Sensing Symposium, (5774-5777). https://doi.org/10.1109/IGARSS53475.2024.10641532 • Global Ionospheric Maps (GIMs) are widely used products to correct ionospheric delays in radio signals • GPC at ETH Zurich provides predictions of geodetic parameters for applications in geodynamics, climate monitoring, and navigation • GPC relies on machine learning techniques to create accurate spatio-temporal models integrating geodetic and environmental data • GPC provides models of the troposphere and ionosphere focus of this poster • Products on GPC are freely available https://gpc.ethz.ch	poster
DEVIN HIGGINS Digital Library Programmer higgi135@mail.lib.msu.edu AARON COLLIE Digital Curation Librarian collie@mail.lib.msu.edu LUCAS MAK Catalog and Metadata Librarian makw@mail.lib.msu.edu SHAWN NICHOLSON Assistant Director for Digital Information nicho147@mail.lib.msu.edu Metadata provides not only a basis for access to resources, but a body of knowledge in itself. Because an ETD collection is generally produced at a single institution, its metadata can:  Model interdisciplinary connections on campus  Show departmental collaborations  Suggest disciplinary directions and information flows  Provide a “portrait” of academic activity METADATA LINKED DATA LEGEND department publication history authority stream outside institutions author advisor category subject “NODES” (CIRCLES) — Categories applied to ETDs by their authors “EDGES” (LINES) — Connections between categories that appear together in ETD metadata SIZE AND THICKNESS of nodes and edges indicates frequency of occurrence across dataset. COLORS indicates affinity groups. Linguistics Biochemistry Microbiology Religion Parasitology Curriculum development Computer science Plant sciences Plant pathology Animal behavior Natural resource management Biomechanics Operations research Architectural engineering Native American studies Astrophysics Management Sociology of education Business Limnology Ocean engineering European history Nuclear chemistry Entrepreneurship Sustainability Early childhood education Black history Chemical engineering Web studies Energy Ethics Area planning and development Physics Behavioral sciences Economic history Organic chemistry Environmental economics Modern history Comparative literature South Asian studies Educational leadership Horticulture Recreation and tourism Hispanic American studies Teacher education Kinesiology Higher education Labor relations Counseling psychology Electrical engineering Mechanics Forestry Baltic studies Ecology Nursing Social research South African studies Robotics Physical anthropology Environmental management Fisheries and aquatic sciences Morphology Middle school education Pathology Education Agriculture Environmental philosophy Regional studies Materials Science Technical communication Statistics Animal sciences Economics, Labor Geographic information science and geodesy Marketing Law African American studies Alternative energy Higher education administration Health sciences Biogeochemistry Religious history Economic theory Artificial intelligence Physical chemistry Geotechnology Neurosciences Biology African studies Electromagnetics Public health Entomology Engineering Secondary education Immunology Wildlife management Foreign language instruction Cellular biology Toxicology Health education Nanotechnology Astronomy Biomedical engineering Caribbean literature Rhetoric Asian American studies Clinical psychology Education finance Asian studies Physical geography Latin American literature Applied mathematics Educational administration Religious education Paleoecology Systematic biology American studies Social work Pedagogy Chemistry Multicultural education Archaeology Cultural anthropology Forensic anthropology Economics, Commerce-Business Aesthetics Molecular biology Mass communication Dance Communication Conservation biology Gender studies Packaging Animal diseases Design Public administration Environmental education Zoology Criminology Sociology Social structure Architecture Social sciences education Home economics Philosophy Genetics Mechanical engineering Cognitive psychology Obstetrics and gynecology Multimedia Education policy GLBT studies Philosophy of education Textile research Soil sciences Music Political Science Educational evaluation Medicine Medical ethics Veterinary medicine Biophysics Remote sensing Polymer chemistry Nutrition Nuclear physics Organization theory Finance Military studies Optics English as a second language Epidemiology Ophthalmology Latin American studies Educational tests and measur	poster
SEARCH FOR THE STERILE NEUTRINO WITH STEREO : ENERGY RECONSTRUCTION Adrien Blanchet (adrien.blanchet@cea.fr) on behalf of the STEREO collaboration CEA-Saclay, IRFU, 91191 Gif-sur-Yvette, FRANCE THE STEREO EXPERIMENT Stereo aims at measuring neutrino spectra at several distance from the reactor core. A clear pattern of oscillation would head toward the hypothesis of a new sterile neutrino ﬂavor, solving the Reactor An- tineutrino Anomaly (RAA). Two key aspects required for the experi- ments are : • Accurate knowledge of detector’s response • Efﬁcient topology cuts for background rejection MOTIVATIONS Phase-I of data taking have presented two challenges regarding energy reconstruction : • Deals with different light collection efﬁ- ciency for each cell • Mitigate signiﬁcant variations of the detec- tor’s response due light leaks evolution Date [MM/DD/YY] 10/31/16 12/31/16 03/02/17 [%] ij L 0 5 10 15 20 Cell2->Cell3 Cell6->GCBack Cell3->GCD19 Cell5->Cell6 Calibration coefﬁcients Ci and light leaks Lij have been measured three times a week to keep track of the detector response. METHOD We used a matrix formalism to recon- struct events energy : Qj = X i=cells EiCiLij = X i=cells EiMij. DATA/MC COMPARISON AND SYSTEMATICS ESTIMATION Data/MC : Sub-percent agreement for Mn peak anchoring after ﬁne tuning Accurate reproduction of detectors response in MC • Independent set of events needed to test energy reconstruction • Using neutron capture gamma peaks (n-H or n-Gd) • Simulating neutron from realistic distribu- tion of vertices • Fitting capture peak with crystalball Sub-percent time stability Date [MM/DD/YY] 11/25/16 12/25/16 01/24/17 02/23/17 Relative Deviation [%] 3 − 2 − 1 − 0 1 2 3 n-Gd peak n-H peak FIND MORE Get more information at https://arxiv.org/abs/ 1804.09052 FINE TUNING 1. Using 835 keV gammas from 54Mn source, deployed at 5 different heights in 3 cells for phase 1 and 5 for phase 2 2. Start from ﬁrst order Ci and Lij 3. Raw selection of full E deposition (Eneighb. < 100 keV) 4. Using reference Eref built from the true deposited energy of the MC and con- volved by the detector resolution 5. Measure reconstructed energy shifts and correct Ci and Lij iteratively : δCi = Ci(Erec i −Eref)/Erec i , and δLij = −Cj(Erec i −Eref)/(EiCi(1 −LijLji)). RESULTS Percent level agreement between MC and Data using calibration-independent neutron capture gamma peaks Energy scale controlled at 1% level Source Cell-to-cell Cell-to-cell correlated uncorrelated Eref - 0.2% 54Mn anchor - 0.3% Stability 0.4% - Data-MC - 1.% Total 0.4% 1.1%	poster
Automated Clean up Method for the determination of PCDD/Fs in Long Term MSWI emissions Andrea Colombo1, Marco Lodi1, Simone Caimmi2, Gianluca Rossetti3, Andrea Manni3* 1Istituto di Ricerche Farmacologiche Mario Negri IRCCS, Department of Environmental Health Science, Via La Masa 19, 20156 Milan, Italy andrea.colombo@marionegri.it 2Environ-Lab, via don Bosco 3, Genzone (PV), Italy simonecaimmi@envirolabsrl.it 3*Chemical Research 2000 Srl, Via Santa Margherita di Belice 16, Rome, Italy info@cr2000.it Introduction The officially Reference European Standard method with respect to the determination and verification of compliance with the legal limits of PCDD/Fs in industrial atmospheric emissions is UNI EN 1948 entitled: Emissions from a fixed source - Determination of the mass concentration of PCDD / PCDF and dioxin PCBs similar - Parts 1 - 2 and 3 respectively related to sampling, extraction and purification and finally the identification and quantification of PCDD / PCDF. The recent introduction of EN 1948-5 addressed the principles and minimum requirements for long-term sampling of PCDD/Fs. It offers the advantage to cover all operation periods of the investigated plant, such as start-up and shot-down when levels of PCDD/Fs might be considerably higher. Long Term sampling involves larger volumes increasing the difficulty in removal of many potentially interfering chemicals. Reference methods for the quantitative analysis of PCDD/Fs involve successive clean-up steps on various chromatographic adsorbents (multi-layer silica, Florisil, alumina, activated carbon) which considerably increases the time needed for analysis. The objectives of this study were to provide a simplified clean-up procedure, capable of working on the long-term sample extract, through the assessment of an automated clean-up system based on gel permeation chromatography combined with an in-line concentration system and solid phase modules able to manage the acid silica/neutral silica and basic alumina purification. The system processes the samples in series. A further purpose with the introduction of an automated clean-up system is to reduce the gap between short–term sampling and on line monitoring, actually not available for the determination of PCDD/Fs in stack emissions. Experimental details Extraction 28 samples which were spiked with a mixture of 13C-labelled PCDD/Fs standards (Wellington Laboratories, Canada) and extracted by an ASE 300 (Dionex Inc. Sunnyvale, CA, USA) using the following instrumental parameters: System Pressure: 1500 psi Oven Temperature: 80 °C Oven Heatup Time: 5 min Static Time: 15 min Solvent: Dichloromethane Flush Volume: 60% of extraction cell volume Nitrogen Purge: 1 MPa (150 psi) for 60 s Clean up Clean up was performed by the means of an automated system composed by three modules shown in figure 1: GPC, SPE and evaporation (J2 Scientific, MI, USA). The used procedure is reported in the flowsheet below (fig.2): Instrumental Analysis The pollutants were detected by a GC coupled with a high-resolution mass spectrometer, operating in the electron impact ionization (EI+) mode, at 10,000 resolution power. A capillary column (60 m x 0.20 mm x 0.25m) with splitless injection was used. The PCDD/F temperature program for analysis was 160°C for 1 min, 2.5°C/min increase until 300°C, 300°C maintained for 6 minutes. The ions were scanned in the selected ion-monitoring (SIM) mode. The ions monitored were tetra- chlorinated congeners and M+2 and M+4 for penta-, hexa-, hepta- and octa- chlorinated congeners. Peaks were accepted if the isotopic ratio was within 15% of the corresponding ratio in the internal standard (IS). Limits of detection (LOD) were calculated individually for each sample on the basis of a signal-to-noise ratio of 3:1. Field and analytical blanks were run covering the whole sampling and analytical procedure. Blank PCDD/F samples showed no peak. Results and Discussion PCDD/F concentrations at the MSWI chimney ranged from 0.00	poster
THE ROLE OF PROTEIN SUMOYLATION DURING VULVAL MORPHOGENESIS AND ANCHOR CELL INVASION ALEKSANDRA FERGIN, Gabriel Boesch, Evelyn Lattmann, Charlotte A. Lambert, Alex Hajnal FINDINGS Protruding vulva phenotype [%] [degron::FLAG::SMO-1] SUMOYLATION plays crucial role in the VPCs in securing proper vulva formation. Application of auxin-inducible degradation (AID) system in a tissue-specific manner TIR1 Cul1 E2 Skp1 Rbx1 Target protein degron auxin Ub Ub Ub Ub Ub Ub Tissue-specific promoter TIR1 mCherry SL2 degron GEI-17 GFP FLAG LoxP GEI-17 degron SMO-1 FLAG LoxP Generation of tissue-specific degradation drivers cdh-3p::TIR1::SL2-mCherry egl-17p::TIR1::SL2::mCherry bar-1p::TIR1::SL2::mCherry Generation of degron-tagged target proteins Endogenously integrated by CRISPR/Cas9 control 1mM auxin eft-3p::TIR1::mRuby; GFP::FLAG::degron::GEI-17 control 1mM auxin 0 20 40 60 80 100 ✱✱✱✱ Validation of auxin-inducible degradation system Degradation of GEI-17 in somatic tissues leads to abnormal vulva phenotype [%] egl-17p::TIR1::SL2::mCherry; GFP::FLAG::degron::GEI-17 control 1mM auxin Example of tissue-specific degradation of GEI-17 in primary VPCs Degradation of GEI-17 in somatic tissues leads to various phenotypes Degradation of GEI-17 in the AC results in defective dorsal lumen opening control 1mM auxin 0 2 4 6 8 10 ✱✱✱✱ control 1mM auxin 0 20 40 60 80 ✱✱✱✱ AC shift [o] BM shift ratio control 1mM auxin 0 20 40 60 80 100 ✱✱ BM breaching defect [%] control 1mM auxin 0 20 40 60 80 100 ✱✱✱✱ control 1mM auxin 0 20 40 60 80 100 ✱✱✱✱ Morphogenesis defect [%] AC fusion defect [%] control 1mM auxin 0 20 40 60 80 100 ✱✱✱✱ AC polarity defect [%] control 1mM auxin 0 2 4 6 8 ✱✱✱ Dorsal lumen diameter [µm] Degradation of GEI-17 in the VPCs leads to defects in cell-fate specification bar-1p::TIR1::SL2::mCherry; degron::FLAG::GEI-17; egl-17::YFP P6.p P6.px P6.pxx 1 mM auxin control egl-17::YFP L4.1 L4.1 L4.4 eft-3p::TIR1::mRuby; GFP::FLAG::degron::GEI-17 AC polarity defect multiple AC misplaced AC BM breaching defect AC BM 1mM auxin P6.p control P6.p 1mM auxin P6.px control P6.px 1mM auxin P6.pxx control P6.pxx 1mM auxin 0 50 100 150 200 250 ✱✱ ✱✱✱ ✱✱✱✱ Mean intensity of in P6.p-P6.pxx METHODS Integrated by mos1-mediated Single Copy Insertion (mosSCI) RESULTS Degradation of GEI-17 results in toroid formation defects during vulval morphogenesis control auxin 0.0 0.2 0.4 0.6 0.8 1.0 ✱✱✱✱ Diameter ratio VulB/VulA AC BM INTRODUCTION INTRODUCTION To study how the loss of protein sumoylation affects vulval development and AC invasion, we developed tools to block sumoylation in a tissue-specific and temporally controlled manner. For this purpose, we have been using the auxin-inducible tissue-specific protein degradation system to down- regulate a degron-tagged SUMO E3 ligase (GEI-17) or a degron-tagged SUMO (SMO-1) in different tissues of the worm. We generated transgenic animals expressing a modified Arabidopsis thaliana TIR1, an E3 ubiquitin ligase specific for the degron tag, under the VPC and the AC specific promoters. Tissue-specific degradation of sumoylation pathway components during the AC invasion OR AC BM VPCs 1mM auxin control cdh-3p::TIR1::SL2::mCherry; GFP::FLAG::degron::GEI-17 BM eft-3p::TIR1::mRuby; degron::FLAG::GEI-17; ajm::GFP 1 mM auxin control ajm::GFP eft-3p::TIR1::mRuby; degron::FLAG::GEI-17; ajm::GFP Toroid fusion defect [%] control auxin 0 20 40 60 80 100 ✱✱✱ VulD fusion defect [%] control auxin 0 20 40 60 80 100 ✱✱ no TIR1 eft-3p::TIR1::mRuby bar-1p::TIR1::SL2::mCherry egl-17p::TIR1::SL2::mCherry cdh-3p::TIR1::SL2::mCherry 0 20 40 60 80 100 control 1mM auxin ✱✱✱✱ ✱✱✱✱ ✱✱✱✱ ✱✱ degron FLAG LoxP Pelisch et al. Mol Cell. 2017 Jan 5;65(1):66-77. P6.p P5.p P7.p	poster
Model of Cluster Members ψcl Model of Field stars ψfs ψ(m, c) = (1 −ffs) ψcl(m, c \|Θcl) + ffs ψfs(m, c) A comprehensive method to model the CMD of open cluster as a mixture of cluster members and field stars. Mixture model of open clusters in CMD Lu Li, Zhengyi Shao Shanghai Astronomical Observatory, Chinese Academy of Sciences (Li & Shao, in prep.) A catalog of properties of open clusters. Including age, [Fe/H], distance, extinction AV, mass function and binary fraction . αMF fb Mass Function:	poster
Modular publishing Modular publishing Modular publishing https://researchequals.com https://researchequals.com https://researchequals.com Overlay journals Overlay journals Overlay journals	poster
INVESTIGATING THE DYNAMICS OF TRANSLATION READTHROUGH IN LIVE CELLS Kelsey Bettridge, Agnes Karasik, and Nicholas R. Guydosh \| Laboratory of Biochemistry and Genetics, NIDDK, NIH, Bethesda MD The possible mechanisms by which translational readthrough occur References and Acknowledgements 1. Young, David J., et al. "Rli1/ABCE1 recycles terminating ribosomes and controls translation reinitiation in 3′ UTRs in vivo." Cell 162.4 (2015): 872-884. 2. Loughran, Gary, et al. "Evidence of efficient stop codon readthrough in four mammalian genes." Nucleic acids research 42.14 (2014): 8928- 8938. 3. Bidou, Laure, et al. "Sense from nonsense: therapies for premature stop codon diseases." Trends in molecular medicine 18.11 (2012): 679- 688. 4. Wilschanski, Michael, et al. "Gentamicin-induced correction of CFTR function in patients with cystic fibrosis and CFTR stop mutations." New England Journal of Medicine 349.15 (2003): 1433-1441. 5. Wu, Bin, et al. "Translation dynamics of single mRNAs in live cells and neurons." Science 352.6292 (2016): 1430-1435. 6. Yan, Xiaowei, et al. "Dynamics of translation of single mRNA molecules in vivo." Cell 165.4 (2016): 976-989. 7. Boersma, Sanne, et al. "Multi-Color Single-Molecule Imaging Uncovers Extensive Heterogeneity in mRNA Decoding." Cell(2019). 8. Wangen, Jamie R., and Rachel Green. "Stop codon context influences genome-wide stimulation of termination codon readthrough by aminoglycosides." Elife 9 (2020). We would like to thank Dr. Marvin Tanenbaum for the gift of Moontag-containing cell strains. Additionally, thanks to Agnes Karasik for development of reporters used in this poster, and initial data collection and data collection optimization. Controls to verify translation status of signals induction of reporter puromycin treatment translation inhibition removes ribosomes from mRNA inducing expression of reporter shows gradual increase in translation events Moontag/Suntag5-7 are repeat epitopes recognized by fluorescent nanobodies. RNA is visualized using PP7 stem loops and fluorescently-labelled coat proteins. UGAC stop codon no stop codon moontag suntag RNA mRNA first ORF second ORF (A)n x12 DNA (A)n x12 Why use single molecule reporters? Can directly correlate multiple simultaneous signals over time. Single molecule reporters allow us to directly visualize readthrough in real time Comparing real data to simulations suggests “burst-like” readthrough Modeling different readthrough mechanisms via stochastic simulations Different stop codons have unique readthrough propensities8. Can we detect this using our single molecule reporters? : readthrough ratio: (∆t readthrough) (total traj len) on events threshold Future experiments no stop UGAC 3’UTR translation frequency 100% 75% 50% 25% We can detect 3’UTR translation events and see differences between stop codon contexts. Stochastic readthrough model shows a single, Gaussian like distribution 1 Investigate more stop codon contexts, including programmed stop codon sequences and premature stop codon contexts 2 Knockdown recycling factors to determine each factor’s contribution to readthrough dynamics Termination factor depletion can lead to ribosomes in the 3’UTR 1 stop codon 60s subunit termination factor normal ribosome recycling AAAAAA main ORF 3’UTR Ribosomes are recycled at stop codons with the help of termination factors. When those are depleted, ribosomes undergo readthrough1. loss of recycling factors readthrough into 3’UTR AAAAAA main ORF Some genes have programmed readthrough signals 2 specialized readthrough sequence Some genes encode readthrough sequences to make C- terminal extensions2. Treatment with aminoglycosides can induce readthrough of both normal and premature stop codons 3 C-terminal extension AAAAAA main ORF readthrough into 3’UTR/ORF AAAAAA normal stop codon OR premature stop codon 3’UTR OR remainder of main ORF Many human genetic diseases are caused by premature stop codons within the coding region3. Treatment of cells with am	poster
observation network: a ground truth for ultra-high resolution satellite SST in the Mediterranean nearshore and coastal ocean CAL/VAL for the highly dynamic nearshore areas: cost-effective design ? Nathaniel Bensoussan1, Vincent Rossi1, Christel Pinazo1, Joaquim Garrabou1,2 and T-MEDNet network Successful Coastal Climate Change Observation Network Build and maintain an operative and cost-effective climate change coastal observation network based on collaborative approaches Ground truth for UHR SST? Make the most of in-situ and UHR satellite SST for marine conservation and coastal management Source: Joint analysis of CMEMS EO and T- MEDNet data series. Copernicus OSR#3. TEMPERATURE HF Water column Build relevant data sets for CAL/VAL at the appropriate granularity in the highly dynamic coastal and nearshore areas. Joint analysis of satellite-in-situ data to enhance knowledge on coastal thermal regimes and heat stress while investigating surface to depth connections. Explore the role of fine scale processes in the modulation of marine heatwaves and ecological impacts. Informed science evidence-based conservation strategies to face climate change challenges in coastal area over broad ecological and socio-economics settings. [23 Marine Protected Areas] BUILDING SYNERGIES 2007- 2016 A decade of accelerated SST warming Ocean Warming ULTIMATE GOAL Marine 2017 HEATWAVES # Collaborative observation network Joining local actions in pan- Mediterranean Observation Network # Unique long-term coastal T° series around the Mediterranean Sea • Baselines on thermal regimes • Seasonal cycle • High-frequency dynamics 16 SUSTAINED COOPERATION [17 Marine Res. Labs] Fill knowledge gaps on coastal thermal regimes: long-term and high-frequency time series • Sustained observations Downwelling Upwelling • Across environmental and variability gradients Source: Bensoussan et al. (2019) Copernicus Ocean state report #3, using CMEMS L4REP at 4 km 20 000 000 70 STANDARD PROTOCOLS – Essential Climate, Ocean and Ecosystem variables Box 1 Box 1 Accuracy: 0.21°C Resolution: 0.01°C 2004 2006 2008 2010 2012 2014 2016 2018 Year Depth (m) nbensoussan@gmail.com 1Mediterranean Institute of Oceanography, MIO-AMU-CNRS-IRD, Marseille, France 2Institute of Marine Science, ICM-CSIC, Barcelona, Spain 40	poster
OPPOSING INCENTIVES FOR RESEARCH COLLABORATION – A CASE-STUDY Charlotte Wien, Asger Væring Larsen and Bertil Dorch – University Library of Southern Denmark 0000-0002-3257-2084 0000-0002-9967-2637 0000-0003-2594-6778 The Danish Bibliometric Research Indicator (BFI) is part of the performance-based model for the distribution of a special pool of baseline funding for universities and public research institutions in Denmark. BFI rewards the research publications published in the most recognized scientific journals, and gives a bonus for publications done through inter-institutionary collaboration. Credits given to universities are fractionalized between the participating universities. So far credits are not assigned to the individual authors but only to their institutions. However, it turns out that research collaboration is associated with a higher number of citations than single authorship which may present the author with two opposing incentives for research collaboration. University of Southern Denmark has been quite successful in its strategy: According to data from SciVal the number of publications per year has been steadily increasing. From 2010 to 2015 there has been a steady increase in the number of publications where one or more authors were affiliated with University of Southern Denmark: 2010 the university produced 1873 publications – in 2015 this had increased to more than 3000. However, while the number of publications has increased, so has the average number of authors per publication. Data drawn from PURE confirm this picture. We chose University of Southern Denmark (www.sdu.dk) as case. SDU comprises five main fields: Humanities, Science, Engineering, Social Sciences and Health Sciences. The number of researchers is approximately 1,200 and the university has about 18,000 students. Over the recent years it has been ranked between number 300-350 on lists like THE and QS. According to its strategy which was formulated in 2012 one of its primary goals is to forward faculty’s participation in international cooperation including sharing of authorships. As such, our home institution seems to be quite a ‘typical case’ in the Nordic countries. It is argued in the evaluation report of the Danish BFI that the influence of the BFI is strongest at the universities where the BFI is used for distribution of funds internally. The reason for this is that the individual faculty members then feel more inclined to understand the system and thus becomes capable of using it. At University of Southern Denmark since BFI is used for budgetary purposes internally (Sievertsen and Schneider 2012:34). Thus studying University of Southern Denmark provides a so-called ‘most likely scenario’. Data from Pure was extracted using the built-in report module. The number of peer reviewed research articles and reviews, number of internal and external authors on those publications, and publication year was recorded. The data were saved in excel format and will be made available at time of publication of this article. SciVal (www.scival.com) was used to extract publication data from 2010 to 2015 from the Scopus database. We recorded the publication type, publication year and number of authors. We only extracted data for articles, letters, reviews and conference papers. The list of publications was stripped of duplicate publications based on DOI and title. In case a duplicate had different publication type e.g. article and conference paper the article was kept as the analysis is only concerned with articles. Bibliography: Aboukhalil, R. (2015). "The rising trend in authorship." The Winnower. Biggs, S. (2013). "Editorial: R and K strategies and the proliferation of scientific papers." Pacific Conservation Biology 19(2): 92-93. Faurbæk, L. (2008). "Notat til: Styregruppen for den bibliometriske forskningsindikator." 14-07-2016, from http://ufm.dk/forskning-og-innovation/statistik- og-analyser/den-bibliometriske-forskningsindikator/fraktionering/beslutning-	poster
1 SETI & Evo-SETI July 15-16, 2023. RIMINI (ITALY) Congress Centre https://en.riminipalacongressi.it/ International Conference organized by the International Academy of Astronautics (IAA) Scientific Organizers: Mike Garrett & Claudio Maccone Call for Papers out soon.	poster
The DTARPS-S analysis starts with 0.9 million TESS Year 1 FFI light curves extracted and preprocessed by the DIAmante project (Montalto+ 2020). ARIMA and TCF are applied and dozens of features provide input into a Random Forest classifier trained towards injected exoplanets (and away from injected eclipsing binaries) to identify 7743 possible transiting systems. A conservative, multistep vetting process then gives 462 high-purity DTARPS-S candidates plus 177 in a Galactic Plane list. DTARPS-S procedure is described in Melton+ 2024a and 2024b with source tables and graphics. See the poster: DIAmante TESS AutoRegressive Planet Search: Overview and Methodology for more immediate details on the procedure. DIAmante TESS AutoRegressive Planet Search (DTARPS) Results from the DTARPS-S Catalog Elizabeth Melton1, Andrew Pellegrino2, Eric Feigelson2, Marco Montalto3, Yash Gondhalekar4 1Rose- Hulman Institute of Technology 2Pennsylvania State University 3 INAF – Osservatorio Astrofisico di Catania 4Birla Institute of Technology and Science Pilani AutoRegressive Planet Search Papers Caceres, G. A., Feigelson, E. D., Babu, J. G., et al., Augoregessive Planet Search: Methodology, 2019, AJ, 158, 2, 57 Caceres, G. A., Feigelson, E. D., Babu, J. G., et al., Autoregressive Planet Search: Application to the Kepler Mission, 2019, AJ, 158, 58 Gondhalekar, Y., Feigelson, E. D., Caceres, G. A., A Study of Two Periodogram Algorithms for Improving the Detection of Small Transiting Planets, 2023, ApJ, 959, 16 Melton, E. J., Feigelson, E. D., Montalto, M., et al., DIAmante TESS AutoRegressive Planet Search (DTARPS). 1. Analysis of 0.9 Million Light Curves, 2024, AJ, 167, 202 Melton, E. J., Feigelson, E. D., Montalto, M., et al., DIAmante TESS AutoRegressive planet Search (DTARPS). 2. Hundreds of New TESS Candidate Exoplanets, 2024, AJ, 167, 203 Melton, E. J., Feigelson, E. D., Montalto, M., et al., DIAmante TESS AutoRegressive planet Search (DTARPS). 3. Understanding the DTARPS-S Candidate Transiting Planet Catalogs, 2024, AJ, in review Montalto, M., et al. A search for transiting planets around FGKM dwarfs and subgiants in the TESS full frame images of the Southern ecliptic hemisphere, 2020, MNRAS, 498, 172 Planetary Occurrence Rates Our careful analysis of ARPS performance on injections, known exoplanets and False Positives, allows us to estimate occurrence rates for TESS FGK. DTARPS-S occurrence rates are consistent with those from Kepler except in the hot Neptune region. Hundreds of hot Neptunes! 1. Training set False Positive Rate of 0.043% is supported by very few known EBs misclassified by the Random Forest. The DTARPS-S Candidates in the Neptune desert have a specificity (True Negative Rate) of 91%. 2. After vetting, there are only 42 known False Positives in the 462-object DTARPS-S Candidate catalog and Galactic Plane list. These include 22 EBs and 5 blended EBs. Comparison with the Prsa et al 2022 catalog of probable eclipsing binaries upheld the high specificity (94%) of the DTARPS methodology. 3. Application of the TRICERATOPS vetting and validation tool suggests the DTARPS-S precision (retrieved fraction) is 50-60%. 4. Reconnaissance spectroscopy of a limited subsample of DTARPS-S Candidates suggests that less than half, and possibly fewer than a third, of the catalog is contaminated by EBs. 5. Planetary occurrence rates estimated from the DTARPS-S Candidates does not exceed estimated from rates obtained from Kepler Confirmed Planets except in the Neptune desert. 6. DTARPS-S planet candidates with radii > 15 R that are likely inflated by stellar heating are largely restricted to insolation fluxes in excess of 300 𝑆𝑆⊕. Future Work ARPS is now being applied to Year 2 TESS data (DTARPS-N) with similar results to DTARPS-S. Application to the full TESS mission dataset, particular ecliptic pole regions is planned (Pellegrino+). ARPS methodology is being improved: XGBoost instead of Random Forest to reduce False Positive rates; improved blended EB	poster
NUTRIM School of Nutrition and Translational Research in Metabolism Introducing WikiPathways to link molecular pathways to Adverse Outcome Pathways Marvin Martens1, Egon Willighagen1 and Chris T Evelo1,2 1 Dept. of Bioinformatics, BiGCaT, Maastricht University, Maastricht, The Netherlands 2 Maastricht Centre for Systems Biology (MaCSBio), Maastricht University, Maastricht, The Netherlands Results Conclusion Most of the molecular and cellular Key Events, and the Key Event Relationships that connect these, on AOP Wiki describe molecular pathways by free-text that are already present on WikiPathways.org or as part of it. Clear descriptions of the Key Events with correct use of ontologies are required to allow linking the Key Events and Key Event Relationships to the molecular pathways and for WikiPathways to become a supportive database for AOPs and assisting in the implementation of omics approaches in regulatory risk assessment. Future work will need to focus on linking AOP Wiki Key Events with their corresponding molecular pathways and entities by improving the ontology annotations, linking these to the Pathway Ontology used in WikiPathways and introducing link-outs on the AOP Wiki. References [1] Ankley GT, Bennett RS, Erickson RJ, Hoff DJ, Hornung MW, Johnson RD, et al. Adverse outcome pathways: A conceptual framework to support ecotoxicology research and risk assessment. Environ Toxicol Chem. 2010 Mar 1;29(3):730–41. [2] Leist M, Ghallab A, Graepel R, Marchan R, Hassan R, Bennekou SH, et al. Adverse outcome pathways: opportunities, limitations and open questions. Arch Toxicol. 2017;91(11):3477–505. [3] Vinken M, Knapen D, Vergauwen L, Hengstler JG, Angrish M, Whelan M. Adverse outcome pathways: a concise introduction for toxicologists. Arch Toxicol [Internet]. 2017 Nov 28;91(11):3697–707. [4] Marx-stoelting P, Braeuning · A, Buhrke · T, Lampen · A, Niemann · L, Oelgeschlaeger · M, et al. Application of omics data in regulatory toxicology: report of an international BfR expert workshop. Arch Toxicol [Internet]. 2015;89:2177–84. [5] Tralau T, Oelgeschläger M, Gürtler R, Heinemeyer G, Herzler M, Höfer T, et al. Regulatory toxicology in the twenty-first century: challenges, perspectives and possible solutions. Arch Toxicol [Internet]. 2015 ;89:823–50. [6] Nymark P, Rieswijk L, Ehrhart F, Jeliazkova N, Tsiliki G, Sarimveis H, et al. A Data Fusion Pipeline for Generating and Enriching Adverse Outcome Pathway Descriptions. Toxicol Sci. 2018;162(1):264–75. Correspondence to: Marvin Martens, BiGCaT ORCID: 0000-0003-2230-0840 marvin.martens@maastrichtuniversity.nl @mmarvinm2 Maastricht University Dept of Bioinformatics http://www.bigcat.unimaas.nl T +3143 388 1343 Background Adverse Outcome Pathway concept The Adverse Outcome Pathway (AOP) has become a useful tool to support regulatory decision making for chemical compounds. AOPs provide a mechanistic representation of toxicological effects, from the initial molecular interaction of a chemical towards an adverse outcome on a biological level relevant for risk assessment (Figure 1A). This will lead to more rapid and cost-effective, high-throughput methods to aid regulatory risk assessment and serving as a basis for generating integrated approaches to testing and assessment [1,2]. To guide the increasing development and use of AOPs, the OECD, JRC and US EPA together launched the AOP knowledge base (Figure 1B) [2,3]. Figure 1: Graphical representation of the Adverse Outcome Pathway concept (A) and the modules of the AOP knowledge base (B). A B AOP knowledge base AOP Wiki Effectopedia Intermediate effects DB AOP Xplorer e. AOP.Portal Objective Our research question is: How can Adverse Outcome Pathways be supported by molecular pathway knowledge (to allow the use of omics approaches)? Figure 3: AOP Wiki statistics tree. Pink nodes indicate elements of predefined vocabularies or identifiers. Figure 2: The Adverse Outcome Pathway portal on WikiPathways.org (left). This portal has a growing	poster
10 0 10 1 10 2 10 3 0 0.25 0.5 log size of signal subgraph misclassification rate incoherent estimator ˆL n b=0.41 ˆL i nc=0.27 ˆL ˆπ = 0.5 size of signal subgraph # signal−vertices coherent estimator ˆL c oh=0.16 200 400 600 800 1000 10 20 30 0.16 0.3 0.4 0.5 10 0 10 1 10 2 10 3 0 0.16 0.25 0.5 log size of signal subgraph misclassification rate some coherent estimators size of signal subgraph # star−vertices zoomed in coherent estimator 400 500 600 15 18 21 0.16 0.3 0.4 0.5 coherent signal subgraph estimate vertex vertex 20 40 60 20 40 60 threshold coherogram 0.04 0.14 0.29 0.55 20 40 60 0 10 20 30 10 0 10 1 10 2 10 3 0 0.25 0.5 0.75 1 log size of signal subgraph misclassification rate incoherent estimator size of signal subgraph # star−vertices coherent estimator 200 400 600 800 1000 10 20 30 0.18 0.3 0.5 0.7 0 20 40 60 80 100 0 0.5 1 # training samples missed−edge rate 0 20 40 60 80 100 0.1 0.2 0.3 0.4 0.5 # training samples misclassification rate coh inc nb Connectome Inference • MR Connectome Automated Pipeline (MRCAP) [1] to infer connectomes • Vertices are neuroanatomical gyral regions [3], edges are estimated tracts using FACT [4] • 49 subjects from the Baltimore Longitudinal Study on Aging; 25 male, 24 female The top two panels depict the relative performances of the incoherent (left) and coherent (right) classiﬁers as a function of their hyper- parameters. The middle two depict misclassiﬁcation rate (left) for a few different choices of # of signal vertices and (right) a zoomed in depiction of the top right panel. The bottom left panel shows the estimated signal subgraph, and the bottom right shows the coherogram. Together, these bottom panels suggest that the signal subgraph for these data is neither particularly coherent or incoherent. (below): The figure below visualizes the twelve signal subgraph nodes. Each subplot shows the signal subgraph induced by one of the 12 signal vertices estimated using the coherent classifier. There are 360 edges in the signal subgraph. Synthetic Data Analysis • Simulations as true to real data as possible suggest model is not wholly unreasonable • Even under true model, we only expect about 50% of the identiﬁed edges are true signal edges with <50 samples • With only a few more samples, both misclassiﬁcation rate and missed-edge rate drop precipitously Model & Classiﬁer • Joint graph/class model • Each edge is an independent binary random variable • A subset of edges comprise the signal subgraph • Bayes plug-in classiﬁer is asymptotically optimal • Robust estimators have better convergence properties than the MLE Connectome Classification: Statistical Graph Theoretic Methods for Analysis of MR-Connectome Data Joshua T. Vogelstein1, William R. Gray1,2, John A. Bogovic1, Susan M. Resnick3, Jerry L. Prince1, Carey E. Priebe1, R. Jacob Vogelstein1,2 1Johns Hopkins University, 2Johns Hopkins University Applied Physics Laboratory, 3National Institutes of Health http://openconnectomeproject.org \| {joshuav, willgray}@jhu.edu Monday, November 14, 11	poster
Anti-Fouling Biofouling Observations with STRAW Pathfinder Biological Models Biofouling and Sedimentation Sedimentation and Biological Fouling at the Future Site of the Pacific-Ocean Neutrino Experiment Braeden Veenstra for the P-ONE Collaboration Presented by Jakub Stacho Introduction ❖The Pacific-Ocean Neutrino Experiment (P-ONE) is a cubic kilometre scale neutrino telescope that is under construction. [1] ❖P-ONE will be located in the Cascadia Basin, 200 km off the coast of Vancouver Island, at a depth of 2.66 km. ❖The detector is being optimized for searches for high energy astrophysical neutrinos. ❖The first string will be deployed in 2025, and the five-string demonstrator will be deployed in following years. ❖STRings for Absorption Length in Water (STRAW) was a pathfinder instrument deployed in 2018 and recovered in 2023. [2] ❖STRAW made measurements of the ambient light spectrum and attenuation length of the water. [3] ❖Nutrients settle on infrastructure that is placed in natural water. ❖Microbes use these nutrients to colonize surfaces and form what is called a biofilm [5]. ❖The effect is more prominent on upwards facing surfaces, as these are exposed to organic material and sediments. ❖Biofilms reduce the efficiency with which currents remove debris and allow for larger organisms to grow [6][7]. ❖In the case of a neutrino telescope, this causes the upwards facing modules to become less transparent over time. ❖Ambient light due to bioluminescence was monitored continuously [3] ❖Most downlooking STRAW PMTs showed negligible growth. [8] ❖The ratio of upwards to downwards PMT counts was used to estimate the efficiency evolution (thick band shows 1𝝈-confidence interval) [9] ❖This was verified using flasher measurements (data points) [9] POCAMs were LED based flasher units used for calibration SDOMs consisted of one upwards and one downwards facing PMT. Biofilm formation Marine Snow and sediment sticks Secondary Colonization References ❖The gompertz and logistic growth models were fit to data from each STRAW module. These are parameterized by a relative growth rate, carrying capacity and inflection time. [10][11] ❖Fit parameters are used to estimate the time where fouling becomes significant, the relative efficiency extrapolated to 10 years and rate of efficiency loss for each model. Confidence intervals for these estimates are shown, using SDOM3 data as an example. UV-C is well motivated for fouling mitigation[12] Thin coatings are the current industry standard for biofouling prevention. Optically transparent options are available [13] Anti-fouling strategies are currently under investigation for future P-ONE moorings. [1] M. Agostini et al. Nat. Astron, 4:913–915, 2020. [2] M. Boehmer et al. JINST, 2019. [3] N. Bailly et al. Eur. Phys. J. C, 2021. [4] On-deck photographs by F. de Leo Cabrera [5] B. Gottenbos, H.C van der Mei, H. Busscher. Methods in Enzymology, 310:523– 534, 1999. [6] C.C. de Carvalho. Front. Mar. Sci., 5, 2018. [7] M. Herzberg and M. Elimelech. J. Membr. Sci., 295:11–20, 2007. [8] Ocean Networks Canada. SeaTube Pro. https://data.oceannetworks.ca/SeaTube, 2023. [9] P. Hatch, K. Holzapfel, R. Li, C. Spannfellner, and B. Veenstra. PoS(ICRC2023), volume 444, page 1166, 2023. [10] E. Tjørve and K. M. C. Tjørve. Journal of Theoretical Biology, 267:417–425, 2010. [11] K. M. C. Tjørve and E. Tjørve. PLOS ONE, 12:e0178691, 2017. [12] M. Detty, R. Ciriminna, F.V. Bright and M. Pagliaro. Acc. Chem. Res., 47:678–687, 2014. [13] B. Salters and R. Piola. Mar. Tech. Soc. J. 51: 59-70, 2017. 80 m 1000 m 37 m 110 m 70 m 50 m 30 m SDOM1 SDOM2 SDOM3 SDOM4 SDOM5 POCAM1 POCAM2 POCAM3 [4] [4] Preliminary Preliminary [3]	poster
This project has received funding from the European Union’s Horizon 2020 research and innovation programme under grant agreement No 730041. www.h2020-newton.eu 4. HOW THE SUSCEPTOMETER WORKS? To measure the complex susceptibility of rocks with sufficient sensitivity, the instrument is designed with a zero method based on temporal measurements. This is an original an innovative system to both generate and retrieve the signals at different frequencies to cover the wide range of susceptibility of natural rocks. The other challenge is the use of magnetic amplifiers to achieve the range of frequencies of work. This project intends to modernize a well known but poorly used technology opening new frontiers of applications like space exploration due to the recent progress in magnetic materials manufacturing. Funded by – NEW portable multi-sensor scienTific instrument for non-invasive ON-site characterisation of rock from planetary surface and sub-surfaces 1. THE PROBLEM Many of the celestial bodies, as for instance the Earth, the Moon and Mars, have an internal magnetic field. On the Moon and Mars, this magnetic field is now purely due to the remanent signature of the crust, magnetized by a past global magnetic field. However, the exact characteristics of this magnetization and how they relate to the ancient dynamo remain unexplored. To date systematic magnetic surveys on Mars and Mercury have been only performed by satellites, while on the Moon sparse surface measurements were just performed during the Apollo era and revealed an important variability over kilometre scales. Worldwide experts [1] in planetary magnetism strongly recommend magnetic prospections on ground with rovers to obtain detailed magnetic signatures and rocks susceptibilities prior to sample-return missions. However, they have not been performed so far for the inadequacy of magnetic instrumentation with the magnetic noise of the landed platforms and the required light weight for space exploration. 2. THE SOLUTION This work proposes a first and unique technology capable of performing a complete characterization of the rocks based on a magnetic instrument suite. This suite includes: a recurrent vector magnetometer, a highly innovative susceptometer with a power supply system and a very sophisticated frequency generation and shift detection. The sensor head includes the susceptometer and the magnetometer. The susceptometer is a ferrite with H shape (to perform a differential measurement, increasing the sensitivity) and integrates a magnetic amplifier to have a significant frequency range. The device is capable to measure real and imaginary part of susceptibility. NEWTON Consortium 3. INSTRUMENT REQUIREMENTS An exhaustive analysis of available literature has been done to compile the magnetic parameters of the rocks most representative of the Earth, Mars and the Moon. Other parameters such as mass susceptibility and saturation remanence of the rocks has also been considered. This study has allowed to define the instrument requirements to perform measurements of the magnetic susceptibility, environment magnetic field and paleomagnetic parameters on the Earth, Mars, Moon and other solid bodies. This document reflects the NEWTON Consortium view. The Union is not liable for any use that may be made of the information contained therein. Fig. 1 Solar System. Fig. 2. Block diagram of the susceptometer. Fig. 3. Mass susceptibility of a number of Moon samples. Data are given as the log of the susceptibility in 10-9 m3Kg-1. M. Díaz-Michelena, J. de Frutos, A.A. Ordóñez, M.A. Rivero and J.L. Mesa (1), L. González and C. Lavín (2), C. Aroca, M. Sanz, M. Maicas, J.L. Prieto, P. Cobos and M. Pérez (3), R. Kilian and O. Baeza (4), B. Langlais and E. Thébault (5), J. Grösser and M. Pappusch (6) (1) Instituto Nacional de Técnica Aerospacial (INTA), Madrid, Spain, (2) TTI, Santander, Spain, (3) Universidad Politécnica de Madrid (UPM), Madrid, Spain, (4) Universitat Trier (UT), Trier, Germ	poster
Age-relations for low-mass stars Rocio Kiman (1,2,3), Jacqueline K. Faherty (2), Kelle L. Cruz (1,2,3,4), Jonathan Gagné (5), Ruth Angus (2,4,6), Sarah J. Schmidt (7), Andrew W. Mann (8), Daniella C. Bardalez Gagliuﬃ (2), and Emily Rice (1,2,9) 1) Graduate Center, City University of New York (CUNY), 2) American Museum of Natural History, 3) Hunter College, CUNY, 4) Center for Computational Astrophysics, Flatiron Institute, 5) Université de Montréal, 6) Columbia University, 7) Leibniz-Institute for Astrophysics Potsdam, 8) The University of North Carolina at Chapel Hill, 9) Macaulay Honors College, CUNY I. We are entering a new era that requires low-mass star ages II. While M dwarfs ages are extremely difﬁcult to calculate, we found 892 age-calibrators III. We found the ﬁrst empirical age-activity relation for Hα emission for M dwarfs IV. Future work: By combining different age-indicators in a Bayesian algorithm we plan to improve the estimation of M dwarf ages. https://rkiman.github.io/ M dwarfs are the most numerous stars in the Galaxy1 and are likely to host most small, rocky, and potentially habitable Earth-like exoplanets2 As the ideal exoplanets to characterize are the ones with known age, knowing the age of the host M dwarfs is key to taking full advantage of legacy missions such as TESS, JWST and the Nancy Grace Roman Space Telescope. As current available methods cannot be used to estimate M dwarf ages, empirically-calibrated relations for age-related properties are needed. We compiled a calibration sample of M dwarfs with Hα line strength measurements from the literature: 871 members of young associations identiﬁed with Banyan Σ3: 21 co-moving with white dwarfs with ages calculated using wdwarfdate4 We found: • The active fraction changes with mass and with age. Its evolution changes according to color. • The Hα line strength decreases with increasing age for M dwarfs. • We ﬁt the age-activity relation with a broken power-law, but we did not have enough stars to precisely constrain the braking point or the slope of the decrease after 1 Gyr. References: 1) Bochanski et al. 2010, AJ, 139, 2679; 2) Dressing & Charbonneau 2015, ApJ, 807 3) Gagné et al. 2018, ApJ, 856, 23 4) Kiman et al. in prep. With a proof of concept using a simulated star we show that the age estimation improves (blue) when combining Hα line strength (orange), kinematics (green) and rotation period (red).	poster
SN 2019gsc: a faint type Iax supernova discovered by ATLAS S. Srivastav1, G. Leloudas2, S. J. Smartt1, J. Gillanders1, D. B. Malesani3, J. Hjorth3, M. Huber4, K. C. Chambers4 et al. 1Astrophysics Research Centre, Queen's University Belfast, BT7 1NN, United Kingdom 2DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, 2800 Kgs. Lyngby, Denmark 3DARK, Niels Bohr Institute, University of Copenhagen, Lyngbyvej 2, 2100 Copenhagen, Denmark 4Institute for Astronomy, University of Hawai‘i, 2680 Woodland Drive, Honolulu, HI 96822, USA krishnamurthy@mps.mpg.de; lagg@mps.mpg.de; solanki@mps.mpg.de; castellanos@mps.mpg.de Summary TARDIS Fits Spectral Evolution Introduction SNe Iax are a subclass of the thermonuclear supernova family with the following distinctive characteristics: • Early spectra blue and hot, with weak Si II and prominent Fe III features, akin to the 1991T-like subclass (Foley+ 2013). • Expansion velocities considerably lower (# km s# ) than those for the rest of the SN Ia family (# km s# ). • Lower rise times and post-maximum decline rates on the higher side relative to normal SNe Ia (Stritzinger+ 2015). • Lower peak luminosities relative to normal SNe Ia, although there’s a large scatter (# ), eg. Magee+ (2017). • Generally found in star-forming, late-type host environments, akin to SNe IIP and 1991T/1999aa-like SNe Ia (Jha 2017). ∼2000 −7000 −1 ∼10000 −1 −19 ≲MV ≲−14 Light Curves and Colour Curves • Disc. 2019-06-2.36 UT • Disc. mag: # (ATLAS cyan band) • # • # • # • # • # 19.7 ± 0.2 Mpeak* g ≈−13.6 ± 0.2 Mpeak* r ≈−13.8 ± 0.2 Δm15(g) = 1.65 ± 0.25 Δm15(r) = 0.91 ± 0.11 Δm15(i) = 0.80 ± 0.07 *for negligible host reddening Fig 1: Pan-STARRS1 target, reference, diﬀerence and colour composite images Of the ﬁeld for SN 2019gsc. Fig 2: Pan-STARRS1 # light curves of SN 2019gsc along with ZTF # and # -band magnitudes and upper limits. grizy g r Fig 3: Light curve (# ) and colour curve (# ) comparison between SN 2019gsc and faint Iax SNe 2010ae (Stritzinger+ 2014) and 2008ha (Foley+ 2009). # was assumed for SN 2010ae. gri g −r E(B −V)host = 0.3 Bolometric Light Curve • Host reddening was assumed to be negligible for SN 2019gsc. • # was assumed for SN 2010ae. SN 2019gsc parameters: • # • # • # erg • # days • # • # erg E(B −V)host = 0.3 MNi ≈1.2 −2.1 × 10−3 M⊙ Mej ≈0.1 −0.3 M⊙ E51 ≈0.01 −0.02 trise ≈10 mpeak bol ≈−13.3 ± 0.2 Lpeak bol ≈6.3 × 1040 Fig 4: Quasi-bolometric (# ) and blackbody ﬁt (# ) bolometric light curves of SN 2019gsc, along with those of SNe 2010ae and 2008ha. Also plotted is the best-ﬁtting Arnett-Valenti model (Valenti+ 2008) for each of the events. SuperBol (Nicholl 2018) was used to construct the bolometric light curves. grizy 1000 −25000 Å Fig 5: Early spectral evolution of SN 2019gsc, compared with spectra of SNe 2010ae and 2008ha at similar epochs. SN 2019gsc features show expansion velocities between # km s# , intermediate to SNe 2010ae and 2008ha. 3000 −4000 −1 Fig 6: The NOT spectral time series of SN 2019gsc, ﬁt with a self-consistent ejecta model computed using the 1D Monte Carlo radiative transfer code TARDIS (Kerzendorf & Sim 2014). An exponential density proﬁle was assumed, with uniform chemical abundance throughout the ejecta. Only the time- dependent parameters were tweaked for each individual epoch, following Barna+ 2018. The density proﬁle of the ejecta model has a low exponent, requiring signiﬁcant amounts of material at higher velocities. • At # , SN 2019gsc is among, and potentially the faintest thermonuclear supernova yet observed. • The # yield is a very modest # . • Ejected mass # , consistent with a sub-# progenitor or a WD deﬂagration leaving a bound remnant. • Photospheric spectra show a host of narrow P-Cygni features, with velocities between # km s# . Mpeak g ≈−13.6 ± 0.2 56Ni 0.001 −0.002 M⊙ Mej ≈0.1 −0.3 M⊙ MCh 3000 −4000 −1	poster
Case Study: Pikunda The study area is of special importance as it represents a north to south transect from the savannas in the southern Central African Republic into the heart of the rainforest in the south (Seidensticker 2016) (Fig. 1). The initial phase of pottery production in the southern half of the study area, the western parts of the Congo Basin, is represented by the Imbonga style, which is only attested for in isolated finds. The oldest well- established pottery style is named after the sites of Pikunda and Munda and dates into the 2nd c. BC to 3rd c. AD (Fig. 2). During the Late Iron Age, the Ngoko style-tradition establishes at the western fringes of the study area. In the northern part, south of the Ubangi bend, the regional sequence starts with the contemporaneous Batalimo-Maluba style. References: CAU, M.-A. at al. 2004. Exploring automatic grouping procedures in ceramic petrology. J. Arch. Sci. 31: 1325–38. ; PERSITS, F. et al. 1997. Maps showing geology, oil and gas fields and geological provinces of Africa. Open-File Report 97-470- A. USGS. ; QUINN, P.S. 2013. Ceramic Petrography: The Interpretation of Archaeological pottery & Related Artefacts in Thin Section. Oxford: Archaeopress. ; SEIDENSTICKER, D. 2016. Archaeology and History in Iron Age Settlements in the Congo Basin, in K. Sadr et al. (ed.) African Archaeology Without Frontiers: 114–26. Johannesburg: Wits University Press. ; WOTZKA, H.-P. 1995. Studien zur Archäologie des zentralafrikanischen Regenwaldes: Die Keramik des inneren Zaïre-Beckens und ihre Stellung im Kontext der Bantu-Expansion. Africa Praehistorica 6. Köln: Heinrich-Barth-Institut. ZAM 85/101:14 ITN 87/101:11 SUN 87/101:87 PIK 87/1-9:7 MTB 85/101:65,101 MLD 87/103:12 MBN 85/101:30 SUN 87/101:72 APPROACHING TRANS-GENERATIONAL TRAINING NETWORKS IN CENTRAL AFRICA Using ceramic petrography to retrace provenance and technology throughout two millennia Dirk Seidensticker Potters’ traditions within the Congo Basin Rainforest are still vibrant today and the result of a supposedly more than two millennia-long transfer of knowledge. While for the past decades' pottery finds were used to establish sequences of stylistically interrelated pottery groups and to derive regional chrono-historical frameworks, the way these communities of practice transmitted their approaches and expertise throughout generations is still unknown. The first study focusing on petrographic characterizations of ceramics from the north-western parts of the Congo Basin showed distinct phases of similar clay procurement and processing. Of special interest is the site of Pikunda (PIK). In the late 1980s, multiple archaeological features were excavated and ethnographic observations on potters’ production showed a particular chaîne opératoire, comprised of coiling, internal scraping, and external beating. Clay procurement and preparation were not recorded though. Department of Archaeology dirk.seidensticker@ugent.be Acknowledgments: The Faculty Research Fund (CWO) of the Faculty of Arts and Philosophy of Ghent University funded the preparation of thin-sections as well as the participation in the course on Scientific Approaches to Archaeological Ceramic Analysis (13-18 July 2020) by P. Quinn. Thanks go to Dimitri Teetaert (UGent) for aiding with the initial identification. Figure 1: Geological Map (Persits et al. 1997) of the study area with archaeological sites (black dots). Sites selected for petrographic and geochemical analysis are highlighted. Colored circles correspond to grouped thin-sections (Fig. 3-4). Figure 2: Chronology of pottery styles. Bars with grey gradient represent radiocarbon dated (little dots show median ages) and dashed bars relatively dated styles. Colored circles correspond to grouped thin-sections (Fig. 3-4). Figure 4: Grouping of characteristics observed within the studied thin-sections. Figure 5: Pit features from trench PIK 87/1 (Excavation and 14C-dates, examples of pottery, macro- and microscopic fabri	poster
A IMPACT OF VESSEL TRAFFIC ON UNDERWATER SOUNDSCAPE AND MARINE MAMMALS IN THE PEARL RIVER DELTA Man Ieng Wong 1 Lindsay Porter 2 Miguel Repas Goncalves 3 Raquel O. Vasconcelos 1 1 Institute of Science and Environment, University of Saint Joseph, Macau S.A.R., China (raquel.vasconcelos@usj.edu.mo) 2 Southeast Asia Marine Mammal Research, Hong Kong S.A.R, China. 3 Strix, Portugal Presence of Indo-Pacific Finless Porpoise did not change after cessation Comparison of mean ± SEM of DPM of Indo- Pacific Finless Porpoise in dry and wet seasons before and after high-speed ferry cessation (Student’s t-tests, n.s.) Hong Kong - On 04.02.2020 the Hong Kong- Macau high-speed ferry service stopped due to the COVID-19 pandemic. This is believed to have significantly changed the aquatic soundscape of South Lantau Island. We aim to investigate the changes in marine biodiversity and occurrence of the Indo- Pacific finless porpoise and the Indo-Pacific humpback dolphin in Hong Kong waters associated with high-speed ferry cessation. Method Between January 2019 and January 2021 we collected 1,372 daily recordings from Passive Acoustic Monitoring stations (SoundTrap ST300HF, Ocean Instruments, NZ) deployed at 6 locations in Mong Tung Wan, Tai Lo Chau, Fan Lau and Peaked Hill. Locations were selected based to their proximity to the Hong Kong-Macau high- speed ferry lane. Acoustic Entropy (H) and Acoustic Complexity Index (ACI) were used as proxies for biodiversity changes using R/Seewave 2.1.6. Detection Positive Minutes (DPM) were used to measure presence of cetaceans (clicks and whistles) using PAMGuard 2.01.05. Our greatest gratitude goes to WWF Hong Kong for providing recording data to make this project feasible. MIW and ROV research supported by FDCT, Macao. The waters of Hong Kong S.A.R. are home to the Indo-Pacific Finless Porpoise (Neophocaena phocaenoides) and the Indo- Pacific Humpback Dolphin (Sousa chinensis) which depend on sound to communicate and for orientation. However, these species are exposed to noise pollution from heavy marine traffic and construction activities. Presence of Indo-Pacific Humpback Dolphin increased after cessation Comparison of mean ± SEM of DPM of Indo- Pacific Humpback Dolphin in dry and wet seasons before and after high-speed ferry cessation (Student’s t-tests, : p<0.05; n.s.) This work is the first attempt to determine the impact of noise pollution on two key resident marine mammal species in one of the busiest estuaries of the world, as well as to evaluate the potential application of ecoacoustic metrics in assessing habitat biodiversity in the Pearl River Delta. Biodiversity changed after cessation Comparison of median ± 95% CI of ACI and H index before and after high-speed ferry cessation (Mann-Whitney test, * p<0.01, * p<0.0001). A significant change in the ACI and H values after ferry cessation suggests increase in biodiversity and soundscape complexity. * * * * ** * *	poster
The He I 10830 line in exoplanets, triggered by coronal emission Jorge Sanz-Forcada1, Manuel López-Puertas2 , Lisa Nortmann3, Manuel Lampón2 Introduction Despite of early efforts back in 2000 to find the He I 10830 line (actually a triplet) in transiting exoplanets, it was not until 2018 that the line was finally observed in an exoplanet. An increasing number of detections in transiting exoplanets is allowing us to trace an unambiguous relation between this line and the incoming XUV irradiation from the corona of the star. The stellar radiation below 504 Å ionizes He atoms in the planet atmosphere, producing the He I 10830 Å triplet after recombination takes place. This line is becoming a useful tool to measure the effects of photoevaporation in planets, and even to detect the presence of winds. In contrast with the H Lyman-α line, the He triplet is not absorbed by the interstellar medium, posing it as the best tracer of photoevaporation for the future. The analysis of the stellar coronal emission is essential to predict the line detection in exoplanets. The careful work carried out in the X-exoplanets database provides an easy, and reliable, way to calculate the expected He-ionizing XUV stellar flux. 1Centro de Astrobiología (CAB, CSIC-INTA), Spain; 2Instituto de Astrofísica de Andalucía (IAA-CSIC), Spain; 3Institut für Astrophysik, George-August-Universität, Gottingen jsanz@cab.inta-csic.es Figure 3. Coronal model (Emission Measure Distribution, EMD) of AU Mic. The upper panel shows the coronal model, with a solid black thick line (dashed if uncertain determination of EMD). Thin colored lines are indicative of the emissivity functions of the spectral lines, with the ions numbered below, weighted by the EMD. In the lower panel it is shown the observed-to-predicted line fluxes ratio for the measured spectral lines. Color code of the elements is the same in both panels. Figure 5. He I 10830 equivalent width (EW) against XUV (5-504 A) coronal irradiation at the planet orbit. The latter is expressed as its ratio over the gravitational potential of the planet, in Jovian units, for a tighter relation. Figure 4. X-ray luminosity as measured in a sample of X- exoplanets, against modeled EUV luminosity, in two spectral ranges relevant for ionization processes in the planet atmosphere Figure 2. He I 10830 triplet as observed in WASP-69 b (Nortmann et al. 2018) during transits. Vertical lines mark the positions of the three lines. Note that this triplet is produced in the planet, and not in the star. A 3% absorption was detected in the line during the transit. The X-exoplanets project (Sanz-Forcada+ 2011) observes planet- hosting stars in X-rays to carefully model its corona, in order to predict the EUV spectral response. Figure 4 includes stars present in the original X-exoplanets sample, with the addition of other planet-hosting stars, some of them analyzed in the CARMENES and the PanCET projects. Best fit to the current sample provides useful X-ray to EUV relations: log LEUV, H = (0.793 ± 0.058) log LX + (6.53 ± 1.61) [100-920 Å] log LEUV, He = (0.856 ± 0.042) log LX + (4.38 ± 1.16) [100-504 Å] CONCLUSIONS • He I 10830 is a line that is formed in the exoplanets atmosphere triggered by coronal radiation • A tight relation between X-ray and EUV luminosities allows for a quick calculation of the ionizing irradiation reaching a planet atmosphere. If no X-ray flux is available it is still possible to use a relation between rotation period and X-ray flux to have an estimate. • A careful analysis of high-resolution X-ray and UV spectra provides the best coronal models. Tighter relations are expected to be constrained in the future as the X-exoplanet sample improves its quality. Other relations that use X-ray surface flux (Chadney+ 2015, King+ 2018) instead of X-ray luminosity (using a very small sample of stars) seem to fail when applied to the X-exoplanets sample. Figure 1. He I levels diagram, from Zirin (1988) X The He line triplet needs	poster
STUDY OF PROTON-NUCLEUS INTERACTIONS IN THE DsTau(NA65) EXPERIMENT AT THE CERN-SPS  ABSTRACT: The DsTau (NA65) experiment at CERN was proposed to measure an inclusive differential cross-section of Ds production, and its decay branching ratios in p-A interactions. The DsTau detector is based on the nuclear emulsion technique providing an excellent spatial resolution for detecting short-lived particles like charmed hadrons. The first results of the analysis of the pilot-run data are presented. The accuracy of the proton interaction vertex reconstruction is reported. A high precision in vertex reconstruction allows one to measure the proton interaction length and charged particle multiplicities accurately in a high-track density environment. The measured data have been compared with several Monte Carlo event generators in terms of multiplicity and angular distribution of charged particles. The results presented in this study can be used to validate event generators of p-A interactions. Elena FIRU* on behalf of the DsTau (NA65) Collaboration *Institute of Space Science – subsidiary of INFLPR PHYSICS GOALS STUDY OF TAU NEUTRINOS Tau neutrino is one of the least studied particles • only a few measurements: i. Direct 𝜈𝜏beam: DONUT (DIS) - first direct evidence of tau- neutrino interaction ii. Oscillated 𝜈𝜏: OPERA (DIS), Super-K (QE), IceCube (DIS) • cross section error >50% (DIS) due to systematic uncertainty in 𝜈𝜏production A new precise measurement of the ντ cross section • test lepton universality • new physics effects in ντ CC interactions Future ντ measurements • SHiP: high statistics measurement at the SPS • reduce statistical uncertainty from 33% in DONuT • indirectly FASER DATA PROCESSING full surface scanning is done to accumulate all charged tracks segments by Hyper Track Selector (HTS) • HTS scans emulsion tracks with the speed of 5000 cm2⁄h Preselect events in the precession measurement to search for small angle decay of Ds→𝜏 ALIGMENT AND TRACK RECONSTRUCTION reconstructed visual of a Ds decay candidate alignment algorithm - very precise - sub micron track reconstruction - positions and angular correspondences average efficiency is higher than 95%. proton beam tracks were checked in detail processing in sub-volumes 1.5 cm x 1.5 cm x 30 plates not interacted protons Computing infrastructure protons interacted in the last tungsten yellow line segments show the trajectories of charged particles in the emulsion films June 16-22, 2024 Milan, Italy EXPOSURE AT SPS, CERN DETECTOR ASSEMBLY AT CERN NUCLEAR EMULSIONS FILMS PRODUCTION detector assembly take place at CERN Dark room DEVELOPMENT AT CERN take place at dark room of the CERN Emulsion Facility PRIMARY VERTEX RECONSTRUCTED for estimation of vertex reconstruction efficiency, the true vertex position is compared with the reconstructed Monte Carlo DATA ANALYSIS a sample from 2018 pilot run data is used for proton interaction characterization measurement of interaction length in tungsten in presented Summary: ●DsTau(NA65) experiment aims to study tau neutrino production by Ds decays ●2018 pilot run data sample is analyzed to study proton interactions in tungsten ●proton interaction length in tungsten is measured for the first time, results will be submitted for publication ●data analysis of physics runs data is going on References: 1. Aoki S, Ariga A., Ariga T., all, Development of proton beam irradiation system for the NA65/DsTau experiment, Journal of Instrumentation, Volume 18, October 2023 2. Ariga, A. Status and plans of the DsTau Experiment, SPSC Open session June 2021 3. A. M. Guler, NA65(DsTau): study of tau neutrino production in p-A interactions, PoS TAUP2023 (2024) 157 4. Ariga, A. DsTau status report 2023 (https://cds.cern.ch/record/2868526/files/SPSC-SR-334.pdf) 5. E. Yüksel, NA65/DsTau: Study of Tau Neutrino Production in p-A interactions, 31st International Workshop on Deep Inelastic Scattering, April 2024, Grenoble, France Cross section measureme	poster
Glitch Flow Francesco Sarandrea°, Lorenzo Asprea°, Elia Cellini ,Federica Legger°, Sara Vallero° * INFN,° Virgo Collaboration, University of Turin A Digital Twin to simulate transient noise in the Virgo interferometer f § §	poster
MATERIALES Y MÉTODOS Las prácticas agroforestales como mecanismo de adaptación al cambio climático Mosquera-Losada MR1, López-Díaz ML2, Ferreiro-Domínguez N1, Rodríguez-Rigueiro FJ1, Arias Martínez D1, Santiago-Freijanes JJ1, Coello J3, Papadopoulou P4, Rigueiro-Rodríguez A1 1Escola Politécnica Superior. USC. Campus de Lugo. Benigno Ledo s/n. 27002, Lugo, España; 2 Centro Universitario de Plansencia. Universidad de Extremadura. Virgen del Puerto 2, 10600, Plasencia, España; 3Centro Tecnológico Forestal de Cataluña, Ctra. de St. Llorenç de Morunys, Solsona, España; 4Faculty of Agronomy University of Thessaloniki, 54124, Thessaloniki, Greece mrosa.mosquera.losada@usc.es RESULTADOS (GALICIA) CONCLUSIÓN: Existe una importante variabilidad genética que debe ser evaluada y que permite al agricultor, tras una adecuada selección y uso, una mejor adaptación al cambio climático y por ende incrementar la resiliencia de sus explotaciones. AGRADECIMIENTOS Investigación financiada por el Programa de Desarrollo e Innovación H2020 a la red temática europea Agroforestry Innovation Networks (AFINET, nº727872), el Ministerio de Economía y Competitividad (CTM2016-80176-C2-1-R) con nombre “Sistemas agroforestales para la producción de cereal como estrategia de adaptación y mitigación al cambio climático en el ámbito de la península ibérica” (AGFCLIMA) y la XUNTA DE GALICIA, Consellería de Cultura, Educación e Ordenación Universitaria (“Programa de axudas á etapa posdoutoral DOG nº122, 29/06/2016 p.27443, exp: ED481B 2016/071-0”). Este trabajo se llevó a cabo por la USC para contribuir a los objetivos de la Global Research Alliance sobre gases de efecto invernadero en la agricultura (www.globalresearchalliance.org). La información mostrada no debe ser considerada como que representa el punto de vista de la Alianza en global o sus representantes. - Cataluña - Extremadura - Galicia INTRODUCCIÓN Los eventos extremos asociados al cambio climático pueden causar la destrucción de la cosecha. Los sistemas agroforestales, específicamente los silvoarables, han demostrado ser un sistema de uso sostenible de la tierra que favorece la adaptación al cambio climático. Sin embargo, la sombra generada por el arbolado puede reducir la productividad del cultivo. OBJETIVO Evaluar en tres condiciones climáticas distintas (Extremadura, Galicia y Cataluña) la capacidad de diferentes variedades de cereales a adaptarse a condiciones de sombra. En la fase de invernadero se sembraron diferentes variedades de cereales (diseño de bloques al azar) en condiciones de plena luz y de sombra artificial (30 y 50%) Las variedades mejor adaptadas a las condiciones de sombra en el invernadero se establecieron en el campo bajo especies arbóreas de diferente edad Los resultados se analizaron con ANOVA INVERNADERO - Cebada - Triticale - Trigo Maíz, centeno y trigo CAMPO - Extremadura (Nogal, Encina) - Galicia (Nogal , Castaño) - Cataluña (Nogal) NOGAL CASTAÑO	poster
Tool Studies 2.0 Zum Potenzial von Trans formern für die Erkennung und Klassifikation von Soft ware-Tools in DH-Publikationen VON KNOCHEN 1. Digitale Tools und die Digital Humanities? Software-Tools spielen in den Digital Humani ties eine zentrale Rolle, ja, sind geradezu gen re-prägend für diese Disziplin. Aufbauend auf Vannevar Bushs früher Vorstellung von Maschi nen als “Erweiterungen des menschlichen Geistes” und J. C. R. Lickliders Folgekonzept ein er “Mensch-Computer-Symbiose” ist deren Rolle und ihre erkenntnistheoretischen Implikationen immer wieder diskutiert worden. 2. Forschungsansatz Ziel der Forschung ist die Ana lyse von Toolnennungen in den Digital Humanities und deren Zusammenhänge in der Wis senschaftsdisziplin. RAUMSCHIFFEN* ZU 3. Von Daten zu Trainingsdaten 4. Klassifikationsmodelle 5. Erste Einsätze der Modelle Manuel Burghardt, Nicolas Ruth, Andreas Niekler Computational Humanities Group, Universität Leipzig 3737 englische Veröffentli chungen aus drei DH Jour nals, veröffentlicht zwis chen 1966 und 2020. Durch die Synthese ver schiedener Toolsammlungen (z.B. TaPOR) wird eine manuell gesäuberte Liste von 246 gängigen Tools erzeugt, die möglichst keine ambigen Namen enthält. Mit Hilfe der Liste und einer Wör terbuch-basierten Suche werden Das Labeling teilt sich in zwei Ansätze. Binär: Tool vs. Kein Tool Mehrklassig: Toolober kategorie einer Taxono mie Finale Datensätze Binär 11.211 Negativ- und 7.687 Positivbeispiele Um Korpora nach Toolnennungen durchsuchen zu können, muss ein Klas sifikakationsmodell entwickelt werden. Naive Ansätze erwiesen sich als un tauglich. Das kontextsensitive Potenzial von Transformer-basierten Sprach modellen muss erprobt werden. Sprach modell RoBERTa Fine-tuning binär Fine-tuning mehrklassig 0,99 0,94 - 0,99 F1 F1 Sequenz, Label – Paare erzeugt. Die Sequenzen bestehen aus {15 to kens, tool, 15 tokens} Im Folgenden wurde der initiale Datensatz aus 3737 Publikationen per Sliding Window in 750.210 Sequenzen geteilt und diese mit beiden Modellen klassifi ziert. Bei 1,93% wurde eine Toolnennung erkannt. Mehrklassig no_tool: 11.211 Programming Lan guages/Packages: 2102 Text Analysis Tools: 1325 ... (text analysis, plattforms and communication, program ming languages, ...) {...} Binär Toolnennungen erkennen und Tools extrahieren Erweiterung von TaPOR Mehrklassig 1970 1980 1990 2000 2010 Welche Toolkategorien sind wie dominant im Laufe der Zeit? 2020 1970 1980 1990 2000 2010 2020 text analysis tools network analysis tools visualization tools platforms and communication exhibition, collection & edition plat forms authoring, annotation, editing, pub lishing platforms programming languages Stanley Kubricks 2001: A Space Odyssey behandelt in seiner Passage Dawn of Man auf essayistische Weise die Beziehung zwischen Mensch und Werkzeug. In einer zentralen Sequenz verwandelt sich ein Knochen zu ei nem Raumschiff und visualisiert damit diese Verhätlnis. *	poster
Energetic particles and the solar cycle: Impact of solar magnetic field amplitude and geometry on SEPs and GCRs diffusion coefficient B. Perri1, A. Strugarek2, A. S. Brun2, V. Réville3 and E. Buchlin4 1 Centre for Mathematical Plasma Astrophysics, KU Leuven, Celestijnenlaan 200b-box 2400, B-3001 Leuven, Belgium 2 Université Paris Saclay and Unviersité de Paris, CEA, CNRS, AIM, F-91190 Gif-sur-Yvette, France 3 IRAP, Université de Toulouse III-Paul Sabatier, CNRS, CNES, Toulouse, France 4 Université Paris-Saclay, CNRS, Institut d’astrophysique spatiale, 91405, Orsay, France Abstract • Réville V, Velli M, Panasenco O, Tenerani A, Shi C, et al., 2020, ApJ, 246(2): 24 • Shalchi A, Bieber JW, Matthaeus WH, 2004, ApJ, 604(2): 675-686 • Spruit HC, 1981, vol. 450, Jordan S, (Ed.) NASA Special Publications, pp. 385-413 • Zank GP, Matthaeus WH, Bieber JW, Moraal H, 1998, J. Geophys. Res., 103(A2): 2085 • Bieber JW, Matthaeus WH, Shalchi A, Qin G, 2004, Geophys. Res. Lett., 31(10):L10, 805 • Chhiber R, Subedi P, Usmanov AV, Matthaeus WU, Ruffolo D, Goldstein ML, Parashar TN, 2017, ApJ, 230(2): 21 • Heber B, Potgieter MS, 2006, Space Sci. Rev, 127(1-4): 117 • Jokipii JR, Parker EN, 1970, ApJ, 160:735 • Mignone A, Bodo G, Massaglia S, Matsakos T, Tesileanu O, Zanni C, Ferrari A, 2007, ApJ, 170(1): 228 Get the article here! Hey, that’s me! doi/10.1051/swsc/2020057 SEPs (Solar Energetic Particles) are correlated with the 11-year solar cycle due to their production by flares and interaction with the inner heliosphere, while GCRs (Galactic Cosmic Rays) are anti-correlated with it due to the modulation of the heliospheric magnetic field. The solar magnetic field along the cycle varies in amplitude but also in geometry, causing diffusion of the particles along and across the field lines; the solar wind distribution also evolves, and its turbulence affects particle trajectories. We combine 3D MHD (magnetohydrodynamic) compressible numerical simulations to compute the configuration of the magnetic field and the associated polytropic solar wind up to 1 AU, with analytical prescriptions of the corresponding parallel and perpendicular diffusion coefficients for SEPs and GCRs. First, we analyze separately the impact of the magnetic field amplitude and geometry for a 100 MeV proton. By varying the amplitude, we change the amplitude of the diffusion by the same factor, and the radial gradients by changing the spread of the current sheet. By varying the geometry, we change the latitudinal gradients of diffusion by changing the position of the current sheets. We also vary the energy, and show that the statistical distribution of parallel diffusion is different for SEPs and GCRs. Then, we use realistic solar configurations, showing that diffusion is highly non-axisymmetric due to the configuration of the current sheets, and that the distribution varies a lot with the distance to the Sun, especially at minimum of activity. With this model, we are thus able to study the direct influence of the Sun on Earth spatial environment in terms of energetic particles. Fig. 1: Time evolution of the count rate of >70 MeV protons at Earth (black), by Voyager 1 (red) and Voyager 2 (green) (Heber & Potgieter 2006). We see the anti-correlation with the 22-yr cycle. Modeling the solar wind We solve the ideal MHD equations up to 1 AU using the multi- physics code PLUTO with a polytropic wind model (Mignone +2007, Réville+2015a, Perri+2018). Wind reference case D1 (dipole of low amplitude): Fig. 2: Meridional cut of the wind solution for case D1 (dipole of low amplitude). The colorscale represents the Mach number projected on the normalised magnetic field. The white lines are the poloidal magnetic field lines (Perri+2020). Modeling the cosmic rays diffusion We focus on the diffusivity term in the Fokker-Planck equation for cosmic rays (CRs) transport and implement them in post-processing (Parker 1965, Jokipii & Parker 1970, Zank+1998, Shalchi +2004): We also need to model the w	poster
Closing the feedback loop With the improved calibration of the ALMA observation we are able to trace in the detailed morphology and kinematics of the filaments of cold molecular gas of and the CND in the central regions of NGC 1275. The data clearly show how kpc-sized filaments flow towards the CND and how they are accreting onto the CND, building it up in mass. This on-going formation of the CND is further confirmed by the non-regular kinematics of the outer regions of the CND which suggest that the gas there is not in a kinetically relaxed state due to the arrival of new filaments. This allows us to complete the picture of the gas cycle in NGC 1275. Several authors have suggested that in NGC 1275 we observe a mixture of heating and cooling processes in the gaseous medium driven by the AGN, and how these processes could be connected to AGN fuelling (Salomé et al. 2006; Lim et al.2008; Scharwächter et al. 2013). Multi-phase outflows driven by the jets, cool as they rise, leading to formation of colder gas filaments (Qiu et al. 2020). Earlier studies have proposed these filaments may fall back and accrete onto the CND and eventually fuel the AGN (Salomé et al. 2006; Lim et al 2008), similar as in models of AGN-driven accretion models (Gaspari et al. 2017). This would close the feedback and fuelling loop of the AGN. Our results from ALMA provide the observational evidence that this process is indeed occurring. Molecular gas feeding 3C 84 Past observations with a resolution of about 1 kpc of the cold molecular gas in the regions of NGC 1275 hosting the radio-loud AGN 3C 84, have shown that it is primarily concentrated in three radial filaments aligned in the east-west direction that could be radially in-falling gas and feeding a CND (Lim et al. 2008; Ho et al. 2009). However, the relatively low spatial resolution does not allow to separate these large filaments from the CND and to establish whether the filaments are actually accreting onto the CND. Using the much better resolution of ALMA (∼50 pc), Nagai et al. (2019) were able to identify a rotating CND of cold molecular gas in NGC 1275. However, due to bandpass calibration issues due to the strong flux of 3C 84, their data cube suffers from strong imaging artefacts which prevent investigating the possible connection between the filaments and the CND. Here we present results from re-processing these ALMA observations, using a different bandpass calibration scheme which resulted in much improved image quality (see Fig. 5). This has allowed us to clearly detect, with 50 pc resolution, the detailed distribution and kinematics of the molecular gas in the central kpc region of NGC 1275. The main results are shown in Figs 1, 2 and 3 where we present the integrated line emission and the velocity field of the CO(2-1). They show that the distribution and the kinematics of the molecular gas are much more complex than perceived from the Lim et al. and Ho et al. data. Furthermore, they separate the filaments and the CND for the first time and allow us to study the connection between the CND and the molecular gas in the central regions of NGC 1275, and how the large filaments are feeding the CND. Closing the feedback-feeding loop of the radio galaxy 3C 84 Tom Oosterloo1,2, Raffaella Morganti1,2 & Suma Murthy3 1ASTRON, the Netherlands Institute for Radio Astronomy, Oude Hoogeveensedijk 4, 7991 PD Dwingeloo, The Netherlands. 2Kapteyn Astronomical Institute, University of Groningen, Postbus 800, 9700 AV Groningen, The Netherlands 3Joint Institute for VLBI ERIC, Oude Hoogeveensedijk 4, 7991 PD Dwingeloo, The Netherlands. Gas accretion by a galaxy’s central super massive black hole (SMBH) and the resultant energetic feedback by the accreting active galactic nucleus (AGN) on the gas in and around a galaxy, are two tightly intertwined but competing processes that play a crucial role in the evolution of galaxies. Observations of galaxy clusters have shown how the plasma jets emitted by the AGN heat	poster
. The Formation of Catastrophically Cooling Outflows in Star-forming Regions via Non-equilibrium Radiative Cooling Ashkbiz Danehkar, M. S. Oey, and William J. Gray Department of Astronomy, University of Michigan, 1085 S. University Ave, Ann Arbor, MI 48109, USA Supported by NASA HST-GO-14080.002-A and HST-GO-15088.001-A. E-mail: danehkar@umich.edu ABSTRACT Multiwavelength surveys of star-forming regions suggest the presence of catastrophically cooling outflows. Mechanical feedback from super star clusters in starburst regions can produce cooling galactic-scale outflows, but outflows predicted by the adiabatic models cannot lead to strong cooling seen in several star-forming galaxies such as M82 and NGC 2366. We simulate starburst- driven outflows using the MAIHEM non-equilibrium cooling package built on the hydrodynamics code FLASH to determine the existence domains of catastrophic cooling, in the parameter space of the metallicity, mass-loading, kinetic heating efficiency, and ambient density. Although the metallicity has a major role in cooling, radiative cooling is significantly enhanced by increasing mass- loading and decreasing kinetic heating efficiency. Our results demonstrate the significance of radiative cooling for star-forming regions, where coolants could be responsible for the build-up of cold molecular hydrogen (H2) clumps leading to the star formation. Chevalier R. A. and Clegg A. W. 1985 Natur 317 44 Danehkar A., Oey M. S. and Gray W. J. 2021 ApJ, arXiv:2106.10854 Ferland G. J., Chatzikos M., Guzmán F. et al 2017 RMxAA 53 385 Fryxell B., Olson K., Ricker P. et al 2000 ApJS 131 273 Gray W. J., Oey M. S., Silich S. and Scannapieco E. 2019 ApJ 887 161 Heckman T. M., Armus L. and Miley G. K. 1990 ApJS 74 833 Leitherer C., Ekström S., Meynet G. et al 2014 ApJS 212 14 Oey M. S., Herrera C. N., Silich S. et al 2017 ApJL 849 L1 Oey M. S. and Massey P. 1995 ApJ 452 210 Silich S., Tenorio-Tagle G. and Rodríguez-González A. 2004 ApJ 610 226 Smith L. J., Westmoquette M. S., Gallagher J. S. et al 2006 MNRAS 370 513 Turner J. L., Consiglio S. M., Beck S. C. et al 2017 ApJ 846 73 Weaver R., McCray R., Castor J., Shapiro P. and Moore R. 1977 ApJ 218 377 REFERENCES CONCLUSION INTRODUCTION Starburst-driven galactic-scale outflows usually appear in starburst regions, which are created by stellar winds from OB associations in super star clusters (e.g., Heckman et al. 1990; Oey & Massey 1995). The physical properties of starburst-driven outflows have been modeled using the adiabatic assumptions (Weaver et al. 1977; Chevalier & Clegg 1985). According to Weaver et al. (1977), this type of outflows has four regions: (1) freely expanding wind, (2) hot bubble, (3) shell, and (4) ambient medium (see Fig. 1). The adiabatic solutions of the fluid model obtained by Chevalier & Clegg (1985) indicate that the density and temperature profiles in the freely expanding wind region decline with radius r as see Fig. 1. The semi-analytic radiative solutions studied by Silich et al. (2004) imply that there are departures from the adiabatic solutions (Fig. 1), i.e. catastrophic cooling. Observations of some starburst galaxies such as M82 and NGC 2366 support the presence of catastrophic cooling in some regions (Smith et al. 2006; Oey et al. 2017; Turner et al. 2017). FIG 1. From Left to Right, a schematic view an galactic-scale starburst-driven outflow, temperature and density profiles with 4 different regions refined by Weaver el al. (1997), followed by the analytic adiabatic and radiative solutions from Silich et al. (2004). HYDRODYNAMIC SIMULATIONS We conducted hydrodynamic simulations of starburst-driven outflows generated by feedback from a spherically symmetric super star cluster (SSC) characterized by the cluster radius (Rsc), mass deposition rate (Ṁ), wind terminal velocity (V∞), and stellar ionizing fields described by ionizing luminosity (Lion) and spectral energy distribution (SED) surrounded by ambient medium (density namb and temperature	poster
Function of the C-terminal domain of Hkr1, a signaling mucin of Saccharomyces cerevisiae in the context of bud site selection and resistance to the cell wall integrity disruptor HM-1 killer toxin Toshihiro Kondo, Ukyo Suzuki and Shin Kasahara* Food Microbiology Unit, School of Food & Agricultural Sciences, Miyagi University, Sendai, JAPAN *Correspondence; kasahara@myu.ac.jp 1886B Fig. 1 The killer toxin called HM-1 produced by L. mrakii kills some other yeasts such as S. cerevisiae. See the clear zone around growing L. mrakii. HM-1 is known as a cell wall integrity disruptor for sensitive yeasts, also inhibits cell wall b-glucan synthesis. HM-1 is a relatively small protein, consists of 88 amino acids and is very stable at high temperature (over 100℃), high and low pH (4 to 11). by Ryotaro Ozawa Lindnera mrakii (syn. Williopsis saturnus var. mrakii or Hansenula mrakii) produces a proteinous killer toxin called HM-1 which kills sensitive yeasts including Saccharomyces cerevisiae. HKR1 (Hansenula mrakii killer toxin-resistant gene 1) was originally isolated from the genome of S. cerevisiae as a gene whose overexpression overcame the cytocidal effect of HM-1. The gene product Hkr1 is a large, highly glycosylated mucin-like type I transmembrane protein containing an N- terminal signal peptide sequence, Ser/Thr-rich repetitive sequences and a putative transmembrane domain. Calcium binding EF hand and leucine zipper motives were found in its cytoplasmic tail. It also functions as an osmosensor in the high osmolarity glycerol (HOG) MAP kinase pathway. We previously reported that only the partial sequence of Hkr1 endowed HM-1 resistance to the cells, then first in this study, the minimum sequence of Hkr1 required for HM-1 resistance was determined by serial deletions. Apparently the extracellular HMH (Hkr1-Msb2 Homology) domain in addition to the cytoplasmic tail was indispensable for HM-1 resistance. Also we observed that the cells overexpressing partial HKR1 showed altered budding patterns. The haploid S. cerevisiae cells mainly select bud sites in an axial pattern, but bipolar and randomized patterns were often observed in the presence of HM-1. The mutant cells lacking the cytoplasmic part of Hkr1 showed an aberrant budding pattern, too. It is well studied that a series of BUD gene products, Bud1/Rsr1, Bud2, Bud5 and so forth are required for proper bud-site selection in S. cerevisiae. Since both overexpression and disruption of HKR1 gave rise to abnormal budding patterns, Hkr1 might regulate budding coordinately with those proteins, or possibly interacting with some other factors. Moreover, we found that the budding pattern of haploid S. cerevisiae cells grown under the influence of HM-1 was also affected, suggesting that HM-1 perturbed the bud-site selection process. HM-1 has been studied as a cell wall integrity disruptor and believed to inhibit the synthesis of cell wall polysaccharides, but we now postulate that it may target other cellular events such as bud site selection and cell polarity regulation. Our observations could provide important pieces of information to understand the mechanism of the cytotoxicity of HM-1 and the function of Hkr1, especially its cytoplasmic domain in bud site selection as well as cell wall integrity of S. cerevisiae. vector only overexpression of “A” driven by PGAL1 − ＋ − ＋ − ＋ 100 (%) 50 HM-1 killer toxin carbon source monopolar other (deformed) overexpression of “A” driven by PADH1 1120 SFGYSSSSISSIKLSKETIPASKSVSNTQERITSFTSTLRANSQSEKSEGRNSVGSLQSSHISSNPSLST 1190 NTKVDSKSLSRKVSKTMGENGEETGLTTTKTQYKSSSETSGSYSRSFTKISIGPATTAVQTQASTNSVFT 1260 APALSTYPTTPYPSPNSYAWLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGF 1330 TAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSYRSGSSTTTLSPKSISSLS 1400 VVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSVAEVYFPTEAVTYLQQLILDEN 1470 STLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGDGGYVPSLTSSSVLDSSKGNSQNIDGTYKYGALDDFI 1540 NSFTDSASAGMYAVKIIIFLIVLTIGVLLWLFVAFFAFRHRNILLKRHPRNCIGKSLNNE	poster
In ALMA cycle 6, our team performed a large survey with ALMA (ALCS; ALMA lensing cluster survey; PI: K. Kohno). [Target: 33 clusters (HFF, CLASH, RELICS), Total area: 133 arcmin2, Depth: ~7µJy (source plane)] We perform multi-component SED analysis, utilizing the UV to millimeter photometries. ・Dust temperature Thanks to the deep ALMA observation, the ALCS sample exhibits a wider range in dust temperatures than conventional SMG samples (ALESS and AS2UDS). ・Dust mass ALCS established a nearly “dust mass selected” sample across z=0.5–6. This trend is the same as previous SMG samples, but ALCS probes the lower dust mass range thanks to the lensing effect. LMA Lensing Cluster Survey: Full SED Analysis of z=0.5-6 Lensed Galaxies Detected by Millimeter Observations A Ryosuke Uematsu (Kyoto Univ.), Yoshihiro Ueda (Kyoto Univ.), Kotaro Kohno (The Univ. of Tokyo), Yoshiki Toba (NAOJ), Satoshi Yamada (RIKEN), Ian Smail (Durham Univ.), Hideki Umehata (Nagoya Univ.), Seiji Fujimoto (The Univ. of Texas), Bunyo Hatsukade (The Univ. of Tokyo), Yiping Ao (Purple Mountain Observatory), Franz E. Bauer (Univ. Catolica), Gabriel Brammer (DAWN), Miroslava Dessauges-Zavadsky (Univ. of Geneva), Daniel Espada (Univ. de Granada), Jean-Baptiste Jolly (MPE), Anton M. Koekemoer (STSI), Vasily Kokorev (Univ. of Groningen), Georgios E. Magdis (DAWN), Masamune Oguri (Chiba Univ.), Fengwu Sun (Univ. of Arizona) Uematsu et al. submitted Sub/millimeter galaxies are a key population for the study of galaxy evolution because the majority of star formation at high redshifts occurred in galaxies deeply embedded in dust. To search for this population, we have performed an extensive survey with ALMA, called the ALMA Lensing Cluster Survey (ALCS). This survey covers 133 arcmin2 area and securely detects 180 sources at z~0.5–6 with a flux limit of ~0.2 mJy at 1.2 mm (Fujimoto et al. 2023). Here we report the results of multi-wavelength spectral energy distribution (SED) analysis of the whole ALCS sample, utilizing the observed-frame UV to millimeter photometry. We find that the majority of the ALCS sources lie on the star-forming main sequence, with a smaller fraction showing intense starburst activities. The ALCS sample contains high infrared-excess sources (IRX=log (Ldust/LUV)>1), including two extremely dust-obscured galaxies (IRX>5). We also confirm that the ALCS sample probes a broader range in lower dust mass than conventional SMG samples in the same redshift range. We identify six heavily obscured AGN candidates that are not detected in the archival Chandra data in addition to the three X-ray AGNs reported by (Uematsu et al. 2023). The inferred AGN luminosity density shows a possible excess at z=2–3 compared with that determined from X-ray surveys below 10 keV. 1. Sub/millimeter Galaxy High-redshift dusty star-forming galaxies (DSFGs) are a key population to elucidate the galaxy evolution, because the majority of star formation at high redshifts occurred in galaxies deeply enshrouded by dust. DSFGs are characterized by the prominent far-infrared (FIR) emission from dust heated by stars. At high redshifts, the peak of the dust emission is shifted to the millimeter band in the observed frame, where the selection function is nearly constant across z=1–8 (cf. negative K-correction). Hence, sub/millimeter observations are a powerful tool to study hight-redshift DSFGs (→ sub/millimeter galaxy [SMG]). 2. ALMA Lensing Cluster Survey Comparison of ALCS and other ALMA surveys 4. Dust properties By the SED analysis, we identify six AGN candidates that are not detected in the archival Chandra X-ray data. → X-ray upper limits indicate that they are heavily obscured (Compton-thick) AGNs. Their inferred AGN luminosity density in high-z ultra-/luminous infrared galaxies (U/LIRGs; ) shows a possible excess at z=2—3 compared with the result of X-ray surveys below 10 keV (Ueda+14). → A significant fraction of AGNs at this epoch may be heavily obscured and missed in previous X-ray	poster
Modeling starspots on low mass star GJ 1243 observed by TESS Kamil Bicz, Robert Falewicz, Małgorzata Pietras Astronomical Institute, University of Wrocław, Kopernika 11, 51-622 Wrocław, Poland Email: bicz@astro.uni.wroc.pl Abstract Quasi-periodic modulations of the stellar light curve may result from dark spots crossing the visible stellar disc. Since the release of the ﬁrst TESS sector the possibility of examining such quasi-periodic modulations by assumed dark spots has increased. Thanks to this observations we tried to detect starspot coverage of low mass stars with visible variability of their luminosity. Using the light curves from TESS satellite and the new, BASSMAN package to ﬁt spot models of different complexities, will constructed starspots distribution on individual stars. These models will then be tested to reveal a connection between the starspots and the stellar ﬂares, in order to provide insight into the overall stellar magnetic ﬁeld. Here we present results of modeling of starspots on GJ 1243 with our new tool and compare the results with the previous reconstructions of the spatial distribution. Introduction GJ 1243 (also known as TIC273589987) is fully convective M4.0V dwarf at a distance 11.95 pc, with mass 0.24 M⊙, radius 0.27 R⊙, effective temperature 3261 K (MAST catalog1) and rotation period equal P = 0.592596 ± 0.00021 day [1]. GJ 1243 also has estimated differential rotation parameter of equal 0.012 ± 0.002 rad/day [1] (for the Sun α⊙= 0.2 rad/day). This star was observed only during two, lasting ∼27 days periods, namely TESS sectors 14 and 15. We selected 33433 individual bright- ness measurements (with 2-minute cadence) acquired over approximately 47 days of observations. Due to very low differential rotation shear and very slow changes of the minimal ﬂux phase mainly in sector 15 (Fig. 1) we estimated spottedness of each sector separately without taking differential rotation into account. Small changes in phase of minimal ﬂux of GJ 1243 are more likely caused by evolution of one of the spots than the differential rotation. There are no signiﬁcant changes in phase of maximal ﬂux value. In our analysis we assumed inclination i = 32◦estimated by analysis of spectral observations of this star at wavelengths from 3600 ˚A to 10000 ˚A and Kepler long cadence data [11]. We estimated the amplitude of GJ 1243 normalized ﬂux as 1.00741 by phasing the light curve from sector 14 and 15 and taking the maximal value of averaged phased data. 1690 1700 1710 1720 1730 TBJD [days] 0.0 0.2 0.4 0.6 0.8 1.0 Phase 1.00 1.01 1.02 1.03 1.04 1.05 1.06 Normalized flux Figure 1: Mapping of relative ﬂux (pixel shade, from dark to light) as a function of rotation phase and time for all TESS data of ﬂux vs. time and phase. Red dots with ﬁtted third degree polynomial represent minimal signal in phases and green dots with ﬁtted linear function represent maximal signal in phase. Methods To model starspots on analysed star we used software BASSMAN (Best rAndom StarSpots Model calculAtioN) written in Python 3, by K. Bicz and designed to model starspots on stellar surface using its observational light curve. BASSMAN recreates light curve of spotted star by ﬁtting spot(s) model to data maximising the log probability of star with spots model and is sampling matched model using Markov chain Monte Carlo by ﬁtting contrasts, sizes, stellar longitudes and latitudes of spot(s). The program uses numerous ready-made software packages to model the spots on the star: starry [4], PyMC3 [7], exoplanet [3], theano [12]. We compare our results with analytical solution for average temperature of the spots on a star with effective temperature Teﬀusing [6]: Tspot = 0.751Teﬀ−3.58 · 10−5T 2 eﬀ+ 808 (1) and to estimate percentage of stellar surface covered by spots we use [5, 10]: Aspot Astar = 100% · ∆F F " 1 − Tspot Teﬀ 4#−1 (2) where (∆F/F) is normalized amplitude of light variations, Tspot is mean temperature of spots esti- mated from equation 1 and T	poster
Unified access to cancer proteogenomics data Caleb M. Lindgren, Hannah Boekweg, David W. Adams, Sadie Tayler, CPTAC Investigators, Samuel H. Payne Department of Biology, Brigham Young University, Provo, UT, USA Abstract We present a new method for data sharing across large collaborations to improve reproducibility and transparency, by creating a Python package that serves as an interface (API) to the multi-omics characterization of tumors from NCI’s CPTAC program. Introduction Cancer data has many audiences, including clinicians, biologists, data scientists and patients. Sharing data and analyses across these diverse audiences is challenging. In particular, we want to simplify the link between data and analysis scripts to enable easier data exploration. We embed NCI’s CPTAC data into a software API. Each tumor type describes samples with clinical, omics, and imaging data. Conclusions The cptac Python package brings cancer data to dispersed collaborative groups. Our package incorporates multiple data sets and lowers the entry barrier, expanding our audience while improving reproducibility and transparency. Acknowledgments: National Cancer Institute (NCI) CPTAC award U24 CA210972. Contact: calebmlindgren@gmail.com; hannahboekweg@gmail.com; sam_payne@byu.edu https://payne.byu.edu github.com/PayneLab @byu_sam Results A Python package, cptac, facilitates access to all CPTAC data. Using the package as the single point of data access unifies and simplifies analysis methods across diverse consortia. Current tumor types include: colon, ovarian, endometrial, renal, breast, lung adeno, glioblastoma and head/neck. Comparing clinical attributes Comparing histology with acetylation Mutation effects on the proteome Comparing multi-omics data Features ●One step installation via pip ●Consistent data and formats across cancers ●Data presented in Pandas dataframes, meaning no need for writing parsers ●API facilitates joining across data types ●Seamlessly works with numeric and graphing libraries (numpy, pandas, matplotlib, seaborn, etc.) ●Versioned data releases ●Package automatically checks that it's up to date, and that the latest version of the data is installed Loading data tables	poster
Problema y preguntas de investigación • La memoria de trabajo (MT) permite el mantenimiento a corto plazo de información relevante para el individuo en situaciones de interferencia y/o procesamiento concurrente (Baddeley, 2012). • Es un importante predictor de la comprensión lectora (CL) durante la niñez, llevando a considerar que las intervenciones que busquen mejorar el funcionamiento de la MT podrían generar mejoras en dicha habilidad (i.e., transferencia lejana) (Peng et al., 2018). • Los estudios que evalúan los efectos de estas intervenciones sobre el desempeño en lectura en niños todavía son escasos y la evidencia no es concluyente (Reina-Reina et al., 2024). Entrenamiento de la memoria de trabajo en niños: efectos sobre la comprensión lectora Metodología Diseño y procedimiento. Experimental con pre-test, post-test y grupo control (GC) activo. Participantes aleatorizados al grupo de entrenamiento (GE; n=26) o GC activo (n=25). Se evaluó su desempeño en CL en la fase pre-test y post-test (inmediatamente finalizada la intervención). La intervención consistió en 8 sesiones de 10 min cada una, dos veces por semana en días no consecutivos. Participantes. Muestra intencional (n=51), desarrollo típico, estudiantes de 2do y 3er grado de primaria en una escuela de gestión privada de Mar del Plata (33 niñas; edad M=7.96, DE=0.50 años). Instrumentos. CL. Prueba Comprensión de textos del Test de Lectura y Escritura en Español LEE (Defior Citoler et al., 2006). Se presentan tres textos breves, seguidos de diversos ítems sobre su contenido. Entrenamiento de MT. Tarea informatizada de entrenamiento de la MT visoespacial para niños (Vernucci et al., 2023, ver Figura 1). Se presentan secuencias de estímulos en una matriz de 4x4 celdas. Se debe recordar cada localización, modificándola en la fase de respuesta, indicando la celda adyacente a la derecha de la ubicación original, manteniendo el orden de presentación. Dificultad adaptativa. Vernucci, S.1,3, Demartini, C.1, Aydmune, Y.1,3, Burin, D.2,3, & Canet Juric, L.1,3 santiagovernucci@conicet.gov.ar (1) Instituto de Psicología Básica, Aplicada y Tecnología (IPSIBAT), (2) Facultad de Psicología (UBA), (3) CONICET. Objetivo Evaluar los efectos de transferencia lejana a corto plazo sobre el desempeño en CL de una intervención sobre MT en niños de edad escolar. Conclusiones e implicancias Se observó un efecto de transferencia lejana a corto plazo: los niños que recibieron el entrenamiento de la MT mejoraron su desempeño en CL en mayor medida que los del GC. Se aporta evidencia preliminar en favor de la posibilidad de mejorar el desempeño en esta habilidad a través del entrenamiento de la MT, aunque debe evaluarse el mantenimiento de este efecto para valorar si el mismo resulta duradero. Durante el primer ciclo de primaria los niños están en pleno desarrollo de sus habilidades de lectura (Peng et al., 2018); una intervención breve enfocada en la capacidad de almacenamiento y procesamiento simultáneo de información en la MT podría resultar de utilidad para favorecer el desarrollo de la CL. Resultados • Se implementó un ANOVA mixto de medidas repetidas y se observó efecto de interacción Grupo × Fase, F(1, 49)= 8.54, p= .005, η2p= 0.15 (ver Figura 2). • Las comparaciones por pares indicaron mejoras de pre- test a post-test tanto del GE como del GC (ambos, p< .001). Las mejoras del GE fueron de una magnitud mayor (d= 1.81) que las del GC (d= 0.85). • En la fase post-test, el GE registró un mejor desempeño que el GC, p= .006, d= 0.80. Figura 1. Tarea de entrenamiento de MT visoespacial. Ejemplo de un ensayo con una amplitud de dos estímulos, incluyendo fase de presentacióny respuesta. Figura 2. Puntuación en la tarea de CL, según grupo y fase. Las barrasindican errorestándar.	poster
Chungnam National UniversityThemeasurementsystemwasconstructedwithaPTOtorquemeter(PTOFlansch,SerialNo.70246,MicroManner,Germany)usingatelemetrymethodtomeasurethetorqueandrotationspeedofthePTOdrivingshaftMETHODSRESULTSDept. of Biosystems Machinery Engineering, Chungnam National Univ. BackgroundObjectiveAgricultural tractorSimulation softwareSeverity Analysis of 75kW Agricultural tractorPTO gear Using a field dataMeasurement systemSafety factor simulationMethodField dataPTOgeardesignforagriculturalapplicationsusestheempiricalmethodbecauseofthewiderangeofloadfluctuationsinagriculturalfieldThePTOgearisanimportantpartoftheagriculturaltractorthattransmitsthepowertovariousimplementsThefielddatameasuredduringtherotarytillagewastransformedintotheequivalenttorqueandequivalentrotationspeedField data during rotary tillage and baler operation was obtained through a sensor attached on the PTO shaftWhen the PTO gear is designed, considering the field operation type and severity is necessaryThe maximum, minimum, and average torque and standard deviation during the rotary tillage are 258.17, 0.01, 100.40, and 47.92 Nm. The rated torque of the 75kW agricultural tractor is 269.87 Nm. In addition, the maximum, minimum, and average rotation speed and standard deviation during the rotary tillage are 2555, 1971, 2372, 123 rpm.ThecontactandbendingsafetyfactorsofthePTOdrivinggearanddrivengearduringbaleroperationaregreaterthanthoseduringtherotarytillageandattheratedtorqueKim, Y.J., Chung, S.O., Park, S.J., Choi, C.H., 2011a. Analysis of power requirement of agriculturaltractor by major field operation. J. Biosyst. Eng. 36 (2), 79–88.Kim, Y.J., Lee, D.H., Chung, S.O., Park, S.J., Choi, C.H., 2011b. Analysis of power requirement ofagricultural tractor during baler operation. J. Biosyst. Eng. 36 (4), 243–251.Lee, D.H., Kim, Y.J., Chung, S.O., Choi, C.H., Lee, K.H., Shin, B.S., 2015. Analysis of the PTO load ofa 75kW agricultural tractor during rotary tillage and baler operation in Korean upland fields.J.Terramech. 60, 75-83.A PTO gear was modeled using Romax_Designerand simulated using real field dataThe contact safety factor of the PTO gear during rotary tillage is 1.32 times greater than that during baler operation, while that at the rated torque is 1.53 times greater. The bending safety factor during rotary tillage is 1.62 times greater than that during baler operation, while that at the rated torque is 2.11 times greaterSimulation conditionEquivalenttorque(Nm)Equivalent speed(rpm)Rotarytillage156.552334Baleroperation115.582367Ratedcondition269.872300Equivalent torque෍෍To calculate the equivalent torque and equivalent rotation, the measured data during rotary tillage were divided into 8 levels considering the maximum torque and minimum torque range. The equivalent torque and equivalent rotation speed during the rotary tillage are 156.55 Nm, 2,334 rpm.PTOgearof75kWagriculturaltractorwassimulatedattheratedtorqueconditionandequivalenttorqueduringtherotarytillageconditionsafetyfactorsofPTOgearwerecomparedunderthetwoconditionswhicharerealtorqueconditionandratertorquecondition	poster
Multimesh / cut FEM simulation of Stokes flow around a propeller. [Johansson, Larson, Logg, 2015] Mesh of the Deathstar generated with FEniCS mshr. Tetrahedral mesh generated from a simple CSG description with FEniCS mshr. History The starting point for the FEniCS Project was the combination of the C++ finite element li- brary DOLFIN and the FIAT Python module for tabulation of finite element basis functions. In 2003, the developers of DOLFIN and FIAT joined forces in the creation of the FEniCS Project, which lead to a rapid development of novel technologies for automated finite element code generation, realized in the FEniCS components FFC, UFL and UFC. In 2011, version 1.0 was released and accompanied by the 700-page FEniCS book - one of Springer’s most downloaded and most cited books in the mathematics category in recent years. The release of 1.0 marked the first stable version of FEniCS and presented to users a well-designed, intui- tive and effective user interface for solution of general nonlinear systems of partial differential equations. Since the release of 1.0, most efforts have been directed towards improving the parallel scaling of FEniCS. With the release of 1.5 in early 2015, FEniCS has matured and of- fers cutting edge parallel performance on a range of hardware. Examples fenicsproject.org Authors: Martin Alnæs, Simula Research Laboratory \| Jan Blechta, Charles University in Prague \| Patrick Farrell, University of Oxford \| Johan Hake, Simula Research Laboratory \| Johan Hoffman, KTH \| Johan Jansson, KTH \| Niclas Jansson, KTH \| August Johansson, Simula Research Laboratory \| Claes Johnson, KTH \| Benjamin Kehlet, Simula Research Laboratory \| Robert C. Kirby, Baylor University \| Matthew Knepley, University of Chicago \| Miroslav Kuchta, University of Oslo \| Hans Petter Langtangen, Simula Research Laboratory \| Anders Logg, Chalmers University of Technology \| Kent-Andre Mardal, University of Oslo and Simula Research Laboratory \| Andre Massing, Simula Research Laboratory \| Mikael Mortensen, University of Oslo and Simula Research Laboratory \| Harish Narayanan, Simula Research Laboratory \| Chris Richardson, University of Cambridge \| Johannes Ring, Simula Research Laboratory \| Marie Rognes, Simula Research Laboratory \| Ridgway Scott, University of Chicago \| Ola Skavhaug, Simula Research Laboratory \| Andy Terrel, University of Chicago \| Garth N. Wells, University of Cambridge \| Kristian Ølgaard, Aalborg University \| References: R. C. Kirby. Algorithm 839: FIAT, a new paradigm for computing finite element basis functions, ACM Transactions on Mathematical Software (2004). R. C. Kirby and A. Logg. A compiler for variational forms, ACM Transactions on Mathematical Software (2006). M. S. Alnæs, A. Logg, K.-A. Mardal, O. Skavhaug and H. P. Langtangen. Unified framework for finite element assembly, International Journal of Computational Science and Engineering (2009). A. Logg and G. N. Wells. DOLFIN: Automated finite element computing, ACM Transactions on Mathematical Software (2010). K. B. Ølgaard and G. N. Wells. Optimisations for quadrature representations of finite element tensors through automated code generation, ACM Transactions on Mathematical Software (2010). A. Logg, K.-A. Mardal, G. N. Wells et al. Automated Solution of Differential Equations by the Finite Element Method, Springer (2012). M. S. Alnæs, A. Logg, K. B. Ølgaard, M. E. Rognes, G. N. Wells. Unified Form Language: A domain-specific language for weak formulations of partial differential equations, ACM Transactions on Mathematical Software (2014). Acknowledgement: We gratefully acknowledge the following grants that have supported the development of FEniCS: Center of Excellence grant awarded to the Center for Biomedical Computing at Simula Research Laboratory by the Research Council of Norway, grant no. 179578/F30. Patient-Specific Mathematical Modeling with Applications to Clinical Medicine: Stroke and Syringomyelia, Research Council of Norway, grant no. 209951.	poster
POLIX – The Thomson scattering X-ray polarimeter Hemanth Manikantan*, Biswajit Paul, Rishin Puthiya Veetil, Vikram Rana, Gopala Krishna M R, Rajagopala G., Sandhya, Mamatha T S, Dhi- raj K Dedhia, Nirmal Iyer, Sujay Mate, Krishnamurthy S, Irshad Md, Pooja Verma, Harikrishna Sahu, Ketan Rikame, Shirisha Vissom, Meena G, Varun Bahal and Shreenandini Anand Raman Research Institute, Sadashivanagar, Bangalore, Karnataka 560080, India U R Rao Satellite Centre, Vimanapura, Bengaluru, Karnataka 560017, India hemanthm@rri.res.in 1. Introduction POLIX is the primary scientific payload on the upcoming Indian X-ray astronomy mission XPoSat. POLIX is a Thomson scattering X-ray polarimeter working in the 8-30 keV energy band designed to study the polarised X-ray emission from various celestial X-ray sources. Being a dedicated X-ray polarization mission in this unexplored energy band, POLIX is poised to give us glimpses of a new frontier in high-energy astrophysics and allow in-depth investigations of the astrophysical processes in neutron stars and black hole sources. In this poster, we intend to brief the principle of operation and instrument configuration. Tests and calibration of the position-sensitive X-ray proportional counters are also described, along with some key scientific prospects of POLIX. 2. The principle of operation Thomson scattering is the dominant scatter- ing mechanism in the 10-30 keV energy band. The electron scattering cross-section for incom- ing polarized photons is anisotropic in the plane normal to the incoming radiation. POLIX al- lows the source photons to scatter from a pure Beryllium scatterer block, and four surrounding X-ray proportional counters detect the scattered X-rays. The satellite spins at 0.2 rpm along the viewing axis of the POLIX to reduce systematic errors from different detectors. The azimuthal variation of scattered X-ray flux signifies the lin- ear polarization direction. 3.Mechanical configuration A collimator restricts the FOV, and a Beryllium scatterer is placed below the collimator. Multi- wire proportional counters with wires oriented vertically to the scatter plane are employed to detect the scattered photons in POLIX [1]. Each proportional counter has a wire frame, accom- modating 12 anode cells grouped into 2 different detector channels of 6 cells each. The housing is filled with 800 Torr of a gas mixture containing 90 % Xe, 9 %Ar, and 1 % Methane. The My- lar window opening towards the scatterer-side allows X-rays to pass into the detectors and sup- ports the gas pressure. Identification of the cell in which scattered X-ray is incident facilitates determining the azimuthal distribution of scat- tered X-ray photons. 5. Charge division Identifying the anode cell on which the X-ray is detected is the key to finding polarization di- rection. Six high resistance Nichrome wires in a proportional counter are connected in series, making one channel. The method of charge di- vision is utilized to identify the cell in which the X-ray is absorbed. 4. Wireframe High resistivity Nichrome wires having thickness of 25 µm surrounded by cathode layer consti- tutes an anode cell. 12 main anode cells of di- mensions 3 × 3 × 30 cm surrounded by 30 veto cells having dimensions 1.5 × 1.5 × 30 cm are present. High DC voltage is applied as bias to the wires. The primary electrons deposited by an incident photon are accelerated to the anode wire leading to avalanche and the resultant de- posited charge is detected at both ends of the channel. 6. Specifications Parameter Description Photon collection area 640 cm2 Energy range 8-30 keV Field of view 3◦× 3◦ Modulation factor 40% 7. Spectral calibration 55Fe and 109Cd radioactive sources, having an emission complex at 6 keV and a line at 22.1 keV, respectively, are used for the position and spectral calibration of the proportional counters. X-rays are shined at three different locations on top of each wire. The histograms of the ratio of pulse heights (Ratio hist	poster
a) b) Methods & Materials Abstract Current literature measurements of dielectric constants of nanoparticles reveal contradictory results for nanoparticles with a size smaller than 100 nm depending on the measurement method used [1-3]. In [3] an increasing dielectric constant up to a factor of 3 for decreasing size of the nanoparticles is reported. In [2] the dielectric constant stays constant as a function of particles size. In this work a measurement method is developed eliminating the influence of the topography and of the effective area of the tip-sample capacitor. Experiment Parameters Height above particle (z) is 20 nm to 40 nm CoCr coated AFM-Probes used: SSS-MFMR from Nanoworld (𝑟𝑇𝑖𝑝= 15 𝑛𝑚) MFM_HC from NTM-DT (𝑟𝑇𝑖𝑝= 40 𝑛𝑚) DC-Voltage applied to the tip (𝑉𝐷𝐶) is varied from -4 V to 4 V PS-NP provided by Alpha Nanotech Inc. and Fraunhofer IMM [4] ranging from 27 nm to 122 nm in diameter PMMA-NP provided by Fraunhofer IMM [4] ranging from 70 nm to 300 nm in diameter NPs diluted in water are drop casted onto p-Si dies Measurement data is fitted using MATLAB Results Conclusion & Outlook A measurement method is developed which suppresses topographic crosstalk and which is independent of the effective area of the tip-sample capacitor. Dielectric constant of PS-NP and PMMA-NP is observed to be constant as a function particle size. With the knowledge of the dielectric constant of nanoparticles it is now possible to create and validate methods for data fusion of EFM and AFM to determine the dielectric constant in lift mode measurements as well. Literature [1]M. Fuhrmann, A. Musyanovych, R. Thoelen, and H. Moebius, "Determination of the dielectric constant of non-planar nanostructures and single nanoparticles by electrostatic force microscopy," Journal of Physics Communications, vol. 6, no. 12, 2022 [2]L. Fumagalli, D. Esteban-Ferrer, A. Cuervo, J. L. Carrascosa, and G. Gomila, "Label-free identification of single dielectric nanoparticles and viruses with ultraweak polarization forces," Nat Mater, vol. 11, no. 9, pp. 808-16, Sep 2012 [3]M. Descoteaux, J. P. Sunnerberg, and C. Staii, "Quantitative characterization of dielectric properties of nanoparticles using electrostatic force microscopy," AIP Advances, vol. 10, no. 11, 2020 [4] A. Musyanovych, J. Dausend, M. Dass, P. Walther, V. Mailänder, K. Landfester (2011): Criteria impacting the cellular uptake of nanoparticles: A study emphasizing polymer type and surfactant effects, Acta Biomaterialia, Volume 7, Issue 12 Figure1: Capacitor model using linear mode Figure 3: Phase shift as a function of DC-Tip-Voltage (blue) and fitted model (red) Figure 4: Dielectric constant as a function of particle size 𝐴𝑒𝑓𝑓,𝑒𝑥𝑝= 𝜋 2 3 𝑤ℎ 2 Δφ = − 𝑄 𝑘𝜀0(𝑉𝐷𝐶−𝑉𝐶𝑃𝐷)2 𝐴𝑒𝑓𝑓,𝑒𝑥𝑝 𝑧+ 𝑑 𝜀𝑃 3 − 𝐴𝑒𝑓𝑓,𝑒𝑥𝑝 𝑧+𝑑3 (1) Influence of particle size of polymer nanoparticles on the static dielectric constant Lukas Lehnert1, Benjamin Baumann1, Marc Fuhrmann1, Anna Musyanovych2, Ronald Thoelen3, Hildegard Möbius1 1Department of Computer Sciences and Microsystem Technology, University of Applied Sciences, Zweibrücken, Germany, 2Chemistry Division, Fraunhofer IMM, Carl-Zeiss-Str. 18-20, 55129 Mainz, Germany 3Institute for Materials Research, Hasselt University, Martelarenlaan 42, 3500 Hasselt, Belgium E-Mail: lukas.lehnert@hs-kl.de Probe is kept at a constant height (Linear Mode) to eliminate topographic crosstalk [1] Tip-surface capacitor is assumed to be a plate capacitor with an effective area depending on the FWHM of the topography scan across the particle Change of dielectric constant results in phase shift change (1) used to model phase shift Figure 2: 116 nm PS-NP: a)Topography, b) Phase shift Si NP 𝐴𝑒𝑓𝑓,𝑧+𝑑 𝑧 𝑑 𝐴𝑒𝑓𝑓,𝑧+𝑑 𝑧 𝑑 𝐶1 𝐶2 𝐶0	poster
Martina Boscolo(1, 3), Gabriel O Paz(1) y Andrea P Goldin(1, 2) (1) Laboratorio de Neurociencia, Universidad Torcuato Di Tella. (2) Consejo Nacional de Investigaciones Científicas y Tecnológicas, Ministerio de Ciencia, Tecnología e Innovación, Argentina. (3) martiboscolo@gmail.com * Igual contribución Proximidad: es la similitud entre las habilidades utilizadas en el entrenamiento con videojuegos y el aspecto al cual se generalizan. - Muy cercana: e.g. cuando se modifica el rendimiento de un jugador en el mismo videojuego. - Cercana: e.g. mejoras visuoespaciales luego de jugar a un videojuego de disparos. - Distante/Lejana: e.g. cuando el entrenamiento afecta el rendimiento académico. Temporalidad: considera la persistencia del aprendizaje. - Corto plazo: hasta 14 días. - Mediano plazo: entre 15 y 59 días. - Largo plazo: a partir de dos meses. Videojuegos con evidencia de entrenamiento vs. más populares. La edad media de los participantes fue de 11,3 años (SD = 3,8). En promedio, el porcentaje de participantes de género femenino fue de 43% (SD = 16,1). No hubo estudios en esta revisión hechos en muestras 100% compuestas por mujeres. El número máximo de mujeres fue de 67%. Figuras (1) País de origen de los participantes (2) Género de los videojuegos estudiados (categorías no exclusivas) (3) Rango etario de los participantes en cada artículo. ●Funciones Ejecutivas (FE) ●Conductas de toma de riesgo, agresivas, impulsivas y delictivas ●Atención y habilidades visuoespaciales ●Alfabetización y lectoescritura ●Pensamiento matemático ●Empatía, conductas prosociales, teoría de la mente Referencias 1. Foley, L., & Maddison, R. (2010). Use of active video games to increase physical activity in children: a (virtual) reality? Pediatric exercise science, 22(1), 7-20. / 2. Rideout, V. J., Foehr, U. G., & Roberts, D. F. (2010). Generation M2: Media in the lives of 8-to 18-year-olds. Henry J. Kaiser Family Foundation. / 3. Bavelier, D., Green, C. S., Han, D. H., Renshaw, P. F., Merzenich, M. M., & Gentile, D. A. (2011). Brains on video games. Nature Reviews Neuroscience, 12(12), 763-768. / 4. Choi, E., Shin, S. H., Ryu, J. K., Jung, K. I., Kim, S. Y., & Park, M. H. (2020). Commercial video games and cognitive functions: video game genres and modulating factors of cognitive enhancement. Behavioral and Brain Functions, 16(1), 2. / 5. Granic, I., Lobel, A., & Engels, R. C. (2014). The benefits of playing video games. American Psychologist, 69(1), 66. / 6. Green, C. S., & Seitz, A. R. (2015). The impacts of video games on cognition (and how the government can guide the industry). Policy Insights from the Behavioral and Brain Sciences, 2(1), 101-110. / 7. Vogel Ciernia, A., Laufer, B. I., Dunaway, K. W., Mordaunt, C. E., Coulson, R. L., Totah, T. S., ... & Yasui, D. H. (2018). Experience-dependent neuroplasticity of the developing hypothalamus: integrative epigenomic approaches. Epigenetics, 13(3), 318-330. / 8. Pronk, N. P. (2021). Neuroplasticity and the role of exercise and diet on cognition. / 9. Diamond, A. (2013). Annual review of psychology, 64, 135-168. / 10. Vladisauskas, M., Belloli, L., Miguel, M., Cabral, D., Nin, V., Shalom, D., Fernández-Slezak, D., Goldin, A. (2021). Measuring Executive Functions with a computerized software: results for unsupervised interventions”. Article in preparation. / 11. Nation, M., Crusto, C., Wandersman, A., Kumpfer, K. L., Seybolt, D., Morrissey-Kane, E., & Davino, K. (2003). What works in prevention: Principles of effective prevention programs. American psychologist, 58(6-7), 449. / 12. Jaeggi, S. M., Buschkuehl, M., Jonides, J., & Shah, P. (2011). Short-and long-term benefits of cognitive training. Proceedings of the National Academy of Sciences, 108(25), 10081-10086 / 13. Wang, X., & Covey, T. J. (2020). Neurophysiological indices of the transfer of cognitive training gains to untrained tasks. Neurobiology of learning and memory, 171, 107205. / 14. The NPD Group (2020). Best Selling Video Games. / 15.	poster
Acknowledgements National Center for Combustion Research and Development, IIT Madras is funded by Department of Science and Technology, Govt. of India Objectives • To study the kinetic modeling for efficient design of thermochemical process for e-waste pyrolysis. • To understand the pyrolysate composition obtained from pyrolysis of e- waste under fast pyrolysis conditions. Conclusions UNRAVELLING THE PYROLYSIS KINETICS AND PRODUCT FORMATION FROM ELECTRONIC WASTE J.V. Jayarama Krishna, Suyash S. Damir, and Dr. R. Vinu Department of Chemical Engineering and National Center for Combustion Research and Development, Indian Institute of Technology Madras, Chennai – 600036, India Email:jayaramjv17@gmail.com Results and Discussions • The apparent activation energies calculated using KAS, FWO, and Vyazokin methods behave similarly with conversion and portray the existence of a complex multi-step reaction regime. The accuracy of the kinetic parameters was improved using DAEM. The quality of the fits obtained using DAEM is greater than 92% and 96% for DTG and conversion plots respectively. • The choice of five, six, and two Gaussians were made to describe pyrolysis behaviour of PCB, PCB : KB (1 : 1 wt./wt.), and KB respectively. • The mean activation energy and pre-exponential factor for PCB, PCB : KB (1 : 1 wt./wt.), and KB are in the range of 129-197, 131-202, 127-208 kJ mol-1 and 107-1012, 109-1013, 108-1013 s-1 respectively. Figure 6. Experimental and predicted DTG curves at 10 oC min-1 for (a) PCB, (b) PCB : KB (1 : 1 wt./wt.), and (c) KB samples. Experimental and fitted DTG curves at 20 oC min-1 for (d) PCB, (e) PCB : KB (1 : 1 wt./wt.), and (f) KB samples. Feedstock Characterization Table 1. Ultimate and Proximate analysis of E-waste 100 200 300 400 500 600 700 800 900 0.000 0.002 0.004 0.006 0.008 0.010 100 200 300 400 500 600 700 800 900 0.000 0.002 0.004 0.006 0.008 0.010 100 200 300 400 500 600 700 800 900 0.000 0.002 0.004 0.006 0.008 0.010 0.012 0.014 100 200 300 400 500 600 700 800 900 0.000 0.002 0.004 0.006 0.008 0.010 0.012 100 200 300 400 500 600 700 800 900 0.000 0.005 0.010 0.015 0.020 100 200 300 400 500 600 700 800 900 0.000 0.005 0.010 0.015 0.020 FitDTG=96.5% (a) Expt Model Peak1 Peak2 Temperature ( oC) d/dT (1/K) d/dT (1/K) d/dT (1/K) FitDTG=96% (b) Expt Model Peak1 Peak2 Peak3 Peak4 Peak5 FitDTG=97.6% (c) FitDTG=97.5% (e) (d) Expt Model Peak1 Peak2 Peak3 Peak4 Peak5 Peak6 Expt Model Peak1 Peak2 Peak3 Peak4 Peak5 Expt Model Peak1 Peak2 Peak3 Peak4 Peak5 Peak6 FitDTG=96.8% Temperature ( oC) FitDTG=96.5% (f) Expt Model Peak1 Peak2 100 120 140 160 180 200 220 240 0.00 0.02 0.04 0.06 0.08 0.10 0.12 100 120 140 160 180 200 220 240 0.00 0.02 0.04 0.06 0.08 0.10 0.12 0.14 100 120 140 160 180 200 220 240 0.00 0.05 0.10 0.15 0.20 0.25 0.30 197 kJ mol -1 190 kJ mol -1 180 kJ mol -1 168.5 kJ mol -1 Peak1 Peak2 Peak3 Peak4 Peak5 PeakSum Activation Energy (kJ mol -1) (a) 129 kJ mol -1 202 kJ mol -1 131 kJ mol -1 199 kJ mol -1 195 kJ mol -1 178.5 kJ mol -1 168.5 kJ mol -1 (b) Gaussian distribution function, f(E) (mol kJ -1) Peak1 Peak2 Peak3 Peak4 Peak5 Peak6 PeakSum 128 kJ mol -1 207 kJ mol -1 (c) Peak1 Peak2 PeakSum Aliphatic HC Aromatic HC N-Aromatic HC O-Aromatic HC Other Oxygenates Halogened compounds -30 -20 -10 0 10 20 0 10 20 30 40 50 60 (b) (a) Sd(%) Selectivity (%) PCB : KB 1 : 0 PCB : KB 3 : 1 PCB : KB 1 : 1 PCB : KB 1 : 3 PCB : KB 0 : 1 PCB : KB 1 : 3 PCB : KB 1 : 1 PCB : KB 3 : 1 0 5 10 15 20 25 30 35 40 0 1 2 3 4 0 5 10 15 20 0 5 10 15 20 0 5 10 15 20 0 5 10 15 20 C6H10O5 C18H20N2 C30H50 C15H16O2 C16H32O2 OP(OC6H5)3 C6H5OH (e) Retention Time(min) C12H13N C9H10 C10H11N C30H50 C8H8 C12H13N C9H10 C14H18O5 C14H18O5 C10H11N C13H12N2 C13H12N2 C8H8 (d) (c) Intensity(x10 7 ion count) C12H13N C9H10 C14H18O5 C14H18O5 C12H14 C30H50 C30H50 C14H18O5 C10H11N C13H12N2 C8H8 (b) C12H13N C9H10 C14H18O5 C12H14 C30H50 C14H18O5 C10H11N C13H12N2 (a) C8H8 100 200 300 400 500 600 700 800 900 0.0 0.2 0.4 0.6 0.8 1.0 100 200 300 400 50	poster
BASAL ANGIOSPERMS MONOCOTS EUDICOTS FLC VRN1 VRN2 FLOWERING FLOWERING FLOWERING FLOWERING FLOWERING BTC1 BBX19 FT1 FT2 AcFT2 FLC-independent THE MEMORY OF WINTER IN DIFFERENT PLANT GROUPS BOUCHÉ, WOODS, & AMASINO (2016) - PLANT PHYSIOLOGY POALES ASPARAGALES FABALES CARYIOPHYLLALES BRASSICALES H. vulgare (barley) T. aestivum (wheat) B. distachyon M. truncatula A. thaliana A. alpina C. flexuosa B. vulgaris (beets) A. cepa (onion) DISTINCT PLANT GROUPS EVOLVED DIFFERENT VERNALIZATION SYSTEMS. IN PERENNIALS, FORGETTING WINTER IS IMPORTANT TO SET THE LIFE BEHAVIOR. Find out more at http://dx.doi.org/10.1104/pp.16.01322	poster
Evento Pró Cátedra UNESCO em Economia Criativa e Políticas Públicas O Departamento de Administração e Contabilidade por meio dos grupos de pesquisa - Gestão e Desenvolvimento de Territórios Criativos (GDTEC) e Grupo de Estudos e Pesquisas em Organizações, Sustentabilidade e Tecnologia (GEPOST), estão organizando o evento presencial: Pró Cátedra UNESCO em Economia Criativa e Políticas Públicas Dia: 17/05/2022 (terça-feira) Local: Novo Auditório do CCH I – Anexo do Prédio dos Departamentos de Administração, Contabilidade e Economia Programação: PAINEL 1 NACIONAL - POLÍTICAS, SUSTENTABILIDADE E TURISMO ALTERNATIVO (JUSTO E CRIATIVO) Horário: 14h às 15h45 Coordenadora: Profa. Débora Schneider (UFFS) Apresentadora: Profa. Maria de Fátima Nóbrega (UFCG) - Políticas e Sustentabilidade: hoje... e amanhã? Apresentador: Prof. Layon Cezar (UFV) - Comercio Justo e potenciais diálogos com a economia criativa e turismo Debatedor: Prof. Marcos Knupp (UFOP) PAINEL 2 REGIONAL - AGENDAS, DESENVOLVIMENTO TERRITORIAL E DISTRITOS CRIATIVOS Horário: 16h às 17h45 Coordenadora - Profa. Carolina Lescura (UFOP) Apresentador 1 - Prof. Magnus Emmendoerfer (UFV) - Conectando Agenda Globais com desenvolvimento local - o lugar dos distritos criativos	poster
1. Adolescents are disempowered when it comes to their own mental wellbeing. Out- group experts construct finished interventions and treat adolescents only as recipients. How- ever, adolescents would be useful designers and co-creators of their own interventions. 2. Activities to improve mental wellbeing are presented predominantly language-based and lack customizability. Individual preferences and accessibility are rarely taken into account. How- ever, adolescents are highly heterogeneous, and intervention delivery needs to reflect that. During this 3-year project, a technological toolkit will be developed. With it, adolescents between the age of 14 and 18 will be able to construct applications, which will help them to improve their own mental health and wellbe- ing. They will be able to choose and customize components based on evidence-based posi- tive psychology interventions. Additionally, this toolkit will be geared towards accessibility, with emphasis on non-language based approaches. On completion, the toolkit will be field-tested with diverse Austrian youth. Developing an inclusive technological toolkit to support prevention approaches Supervisors Geraldine Fitzpatrick, Technische Universität Wien Stephen Brewster, University of Glasgow Background Summary Secondments Planned contributions Project plan Context analysis to understand how to use diverse, multimodal technology to support inclusiveness Set of proof-of-concepts interpreting ex- isting preventive approaches into non-lan- guage based mechanisms Ready-to-deploy toolkit, allowing adoles- cents to construct their own applications to support mental health and wellbeing Refined concepts and exploration of the design space, including first prototypes, of inclusive technology to support wellbeing Large-scale study with diverse Austrian youth into how engaging, fun, and poten- tially helpful the toolkit is » Sin & Lyubomirsky (2009) reviewed 51 positive psychology intervention studies with overall 4,266 participants and found significant impact on well- being; a suitable format of the intervention was found important for effec- tiveness. » Spijkerman, Pots & Bohlmeijer (2016) reviewed 15 randomised control trials, specifically for the effectiveness of online mindfulness-based interven- tions and conclude a significant effect on mental health. » Hollis et al. (2017) were able to identify 147 existing digital health inter- ventions, which primarily used computer, smartphones, internet and text messages as delivery mechanisms. » Silverstone et al. (2016) conclude a review of existing mental health tech- nologies by recommending a stronger use of multimodal solutions. » Clarke, Kuosmanen & Barry (2015) conclude a review of existing mental health technologies by pointing out the effectiveness of specifically mod- ule-based interventions for promotion of mental health. » Aye mind (n.d.) offers a toolkit to facilitate learning about mental health technology for young people. » Almirall & Chronis-Tuscano (2016) emphasize the necessity of adaptive in- terventions in support of child and adolescent mental health, because needs and preferences change over time. » Taylor, Leslie, Grampian & Boddie (2017) point towards high potential of wellbeing promoting technology for adolescents. » What types of barriers prevent adolescents from accessing existing interventions? » How can diverse technological modalities be used to support prevention approaches in an inclusive way? » What are common characteristics and com- ponents of existing preventive approaches and how can they be mapped onto a de- sign space? » What would be candidate technologies to realize the toolkit with? » What tools should the toolkit consist of? » What are the particular needs of different audiences of the toolkit? » How to make the toolkit fun and engaging for adolescents? Toni Michel, M.Eng. Mobile: +49 177 3075 023 Mail: toni.michel@tuwien.ac.at Twitter: @T__Michel Almirall, D., & Chronis-Tuscano, A. (2016). Ada	poster
Big Data Contrast Mining for Genetic Distinctions between Disease Subtypes Matt Spencer and Chi-Ren Shyu – University of Missouri Informatics Institute Manhattan Plot by Ikram, M. K., et al. (2010). Complex Disease Etiology Genome-Wide Association Studies find genetic loci (SNPs) that are enriched in a disease-affected population. However, the traditional GWAS approach is not suitable for complex diseases. This is due to the addition of two major challenges when searching for the genetic etiology of a complex disease: We are specifically interested in autism, which may involve a combination of these attributes. We need a way to examine associations between diseases and multiple genes, and to identify genetic differences between subgroups of the affected population. Etiology The cause of a disease or abnormal condition Complex Disease A disease or disorder which cannot be attributed to a single gene • Interactions among genes – e.g. two genes both have to be mutated in order to cause the disease • Multiple causes of the disease – e.g. two genes both cause disease regardless of the state of the other GWAS Associated Genome Regions Frequent Pattern Mining In this research, the items are SNPs within the genomes of autistic individuals. The resulting combinations indicate groups of rare-form SNPs most prevalent in children with autism. B C E H K M N O R U Y BOUNCY 1 1 1 1 1 1 BUYER 1 1 1 1 1 CHUNKY 1 1 1 1 1 1 HOCKEY 1 1 1 1 1 1 HONEY 1 1 1 1 1 MERCY 1 1 1 1 1 MONEY 1 1 1 1 1 MONKEY 1 1 1 1 1 1 RHYME 1 1 1 1 1 Transactions Items Sup (U, Y) = 3/9 No combination including M can possibly have a support higher than 4/9. Sup (M) = 4/9 Eliminating just one item (A) significantly reduces the number of combinations that need to be examined. A data mining technique that identifies common trends within a dataset. Items that don’t achieve a certain population prevalence (“Support”, or just “Sup”) are eliminated from future combinations. To address the challenge that complex diseases may have multiple causes, we use Contrast Mining. Contrast Mining 1. The population is divided into subpops based on one or more phenotypes. Nondysmorphic vs Dysmorphic : 464 : 80 FPM Contrast Mining 2. Frequent Pattern Mining identifies prevalent SNP combos for both subpops. 3. Prevalent combinations are compared to identify major discrepancies. High-Contrast Itemsets An itemset may be highly prevalent in a relevant subpop, even when that itemset does not pass the Min Sup threshold in the general population. This demonstrates the importance of Contrast Mining within heterogeneous populations. We plan to apply this Genomic Contrast Mining procedure to the SFARI dataset, searching for genetic distinctions between several known and suspected autism subgroups. We hope to identify genes that can ultimately be diagnostic for specific autism subtypes. This would lead to earlier and more specific diagnoses, allowing “Precision Medicine” treatments to be developed and administered to people with specific disease subtypes. We also plan to use SNP combinations to connect autism-related genes from animal models to genes previously unaffiliated with autism. The combined knowledge of genes relevant to autism in humans and those relevant to autism in rats can lead to discoveries unobtainable through the study of either organism individually. Future Work Acknowledgements This work is supported by the NIH 1T32LM012410-01 Training Grant. The computing infrastructure is supported by the NSF CNS- 1429294 Grant. The SFARI SSC data is provided by the Simons Foundation (SFARI award #26021565-08C000066 to J.M.). We use Apache Hadoop to store and manage genotype and intermediate data in a distributed fashion. We also use Apache Spark to perform computations, using the shared memory pool of many machines. To find associations between complex disease and multiple genes, we must generate combinations of SNPs to test for association. However, this leads to a explosion of SNP combinations. He	poster
01 E 02 MARÇO DE 2023 RESTAURAÇÃO COM CIÊNCIA DO RIO DOCE Da Dimensão Edáfica ao Sensoriamento Remoto LOCAL: SALA 236 - BLOCO I3, ICB (UFMG) Foto: Odirlei Simões Saiba mais e se inscreva! RESTAURAÇÃO ECOLÓGICA DO RIO DOCE WOKSHOP DE Design: Walisson Kenedy Siqueira	poster
19°0'0"E 18°E 17°E 16°E 15°E 14°E 13°E 45°N 44°N 43°N 42°N 41°N 40°N A B A -200 -1200 -500 (m) A B Slope section ADW NAdDW LIW -0 Deep water production area NAdDW LIW ADW 0 100 200 50 km Ionian Sea Tyrrhenian Sea Italy Adriatic Sea Me dit err an ea n Se a Adriatic Sea Pelagosa sill Otranto Strait Hotspot Ecosystem Research and Man's Impact On European Seas Final meeting 2012 Faro, Portugal, 11-14 September 2012 CONSIGLIO NAZIONALE DELLE RICERCHE Istituto di Scienze Marine 6 km N SE120 -850 -900 -950 -1000 m SE120 1 km E W E The reshaping of the South West Adriatic Margin by pervasive dense shelf water cascading A GIS-based methodology for quantitative geomorphological mapping Foglini F., Trincardi F., Campiani E. Istituto di Scienze Marine ISMAR – CNR, Bologna, Italy CONCLUSION 1. The morphological analysis suggests that the entire margin is undergoing a thorough re-shaping driven by the impact of a particular class of seasonally modulated bottom-trapped density cur- rents; 2. All these erosional and depositional features document how the dense shelf water cascading interacts with the pre- existing and markedly differentiated morphologies and sediment distribution; 3. The analysis of the bedform orienta- tion and spatial distribution make pos- sible to infer the pathway of the downslope-cascading bottom-currents. Trincardi, F., Foglini, F., Verdicchio, G., Asioli, A., Correggiari A., Minisini, D., Piva, A., Remia, A., Ridente, D., Taviani, M. 2007. The impact of cascading currents on the Bari Canyon System, SW-Adriatic Margin (Central Mediterranean). Mar. Geol., 246, Issues 2-4: 208-230. Trincardi, F., G. Verdicchio, and S. Miserocchi (2007), Seafloor evidence for the interaction between cascading and along-slope bottom water masse. J. Geophys. Res., 112, F03011, Verdicchio, G., Trincardi, F., 2006. Short-distance variability inabyssal bed-forms along the Southwestern Adriatic Margin (Central Mediterranean). Mar. Geol. 234: 271–292. The Southwest Adriatic Margin includes a steep and morphologi- cally complex continental slope stretching about 400 km from the Pelagosa sill to the Otranto strait. The area has been investigated through multibeam surveys accompanied by high-resolution seismic stratigraphic surveys investigating glacial and post-glacial deposits. After the end of the last glacial sea level low stand the North Adri- atic shallow shelf became progressively drowned as a consequence of the eustatic rise. Through its progressive drowning, this region became a shallow shelf and one of the Mediterranean key sites for the formation of dense shelf waters through wind-forced winter cooling. The dense waters formed through this process move to the south, along the western side of the Adriatic, and reach the South Adriatic slope across which they cascade hugging the sea floor and generat- ing a myriad of depositional and erosional effects such as: giant sediment drifts down to 1200m water depth, muddy and sandy sedi- ment waves, comet marks against pre-existing slide blocks, furrow fields, large scours at the shelf edge and large erosional moats against major morphological barriers. The fields of dominantly muddy sediment waves have a patchy distribution and appear to reflect the interaction between the down-slope path of the dense water and the presence of both morphological constraints to acceler- ate the flows and mobile sediment to be casted into wavy bedforms. Simplified intermediate- and deep-water circulation in the Adriatic Sea: NAdDW=North Adriatic Dense Water; LIW=Levantine Intermediate Water; ADW=Adriatic Dense Water. RESULTS Mud Wave fields Field A: The wave crests vary from slightly sinuous to bifurcated, with general ori- entation NE-SW. The wave heights are 10-30 m and the wavelengths in the region of 700-1300 m with wave crests up to 5500 m long. In cross section the sediment waves are asymmetric, with the depositional flank facing obliquely upslope. The opposite, downslope, flank is markedly less depositional	poster
Phinch: An interactive, exploratory data visualization framework for metagenomic datasets! Raw data Formatted data structured for visualization User Interface for setting filters for data parsing Start by building 2 - 4 visualizations. Can add more later. Each visualization will have it’s own controls to adjust presets. This can then be shared or saved as PNG to embed in research papers. Project Schematic! The sheer volume of data produced from environmental sequencing approaches (rRNA marker genes, metagenomes) requires fundamentally different approaches and new paradigms for effective data analysis. Scientiﬁc visualization represents an innovative method towards tackling current bottlenecks; in addition to giving researchers a unique approach for exploring large datasets, it stands to empower biologists with the ability to conduct powerful analyses without requiring a deep level of computational knowledge. ! ! Here we present Phinch, an interactive, browser-based visualization framework that can be used to explore and analyze biological patterns in high-throughput environmental datasets. Leveraging a close collaboration between UC Davis and Pitch Interactive (a data visualization studio in Berkeley, CA), this project takes advantage of standard ﬁle formats from computational pipelines in order to bridge the gap between biological software (e.g. QIIME) and existing data visualization capabilities (harnessing the ﬂexibility and scalability of WebGL and HTML5, and visualization-speciﬁc programming language such as Processing and D3).! ! Taxonomy Bar Bubble Chart Sankey Diagram Donut Partition Attributes Column Chart Bubble Chart By OTU http://phinch.org!	poster
Rohdaten Recherche zu Meta- und Kontextdaten von Institutionen/Personen/ Journalen/Verlagen/ Universität Aufnahme in die Datenbank Digitalisate kaum verwertbare Volltexte/ OCR Bearbeitung aller Journale nicht möglich Händische Erschließung über Inhaltsverzeichnisse/ Verzeichnung in Relationaler Datenbank Netzwerke des Wissens Thematische und personelle Relationen innerhalb der halleschen Zeitungen und Zeitschriften der Aufklärungsepoche (1688-1815) Anne Purschwitz Fragestellung Wie, wann, wo und warum wurde während der Aufklärung Wissen in Form öffentlicher Diskurse gesammelt, verbreitet oder genutzt – unterdrückt, vernachlässigt oder ignoriert? Wer waren die darin involvierten Aktanten und wie gestalteten sich die damit einhergehenden Netzwerke? Keiner der Ansätze allein würde eine solche Fülle von Daten berücksichtigen können und flexibel angepasste Interpretationen ermöglichen. Individuelle Anpassungsmöglich- keiten/Abfragen je nach thematischer, inhaltlicher oder zeitlicher Fokussierung. Verfahren zwingen Daten in allen ihren Widersprüchlichkei- ten und auch mangelnden Plausibilitäten ernst zu nehmen. In Visualisierungen Trennung von Bild und Geschichte – braucht Interpreta- tion, Kontext, Erklärung. Datengrundlage nur erweiterbar bei guter Dokumentation und Pflege. Generierung Gesamt- datensatz: umfang- reiche Datenerhebung (Metadaten, Informa- tionen zu Aktanten etc.). Vor- und Nachteile Vorteile Nachteile 360 in Halle begründete Zeitungen und Zeitschriften 1688-1815/ 1.300 Bände/ 3.900 Stück/ 2.800 Personen Beiden Verfahren innewohnende statistische Grundlagen ermöglichen Vergleichbarkeit. Preprocessing für TopicModelling sehr zeitaufwendig. Topic Modelling Praktische Anwendung Ähnlichkeit der Farben weist auf Ähnlichkeit der Themen hin/ farbige Punkte neben Dokumenten zeigen Themenzuweisung preprocessing Bereinigung Wortlisten/ Stoppwörter/ Sprachanpassungen/ Übersetzungen/ Normalisierung Schreibweisen/ Part-Of-Speech tagging Datengrundlage bibliographisch erfasste und mit Metadaten angereicherte Inhaltsverzeichnisse/ Nutzung des von Alexander Hinneburg entwickelten TopicExplorers Zielsetzung Identifizierung von Themen durch unüber- wachtes maschinelles Lernen Ergebnisse Topic Modelling Visualisierung einige Themen lassen Verständlichkeit in Wortlisten erkennen/ Themen können in ihrem zeitlichen Verlauf dargestellt werden offene Fragen entgegen Erwartungen ‚fehlen‘ Themen – z.B. ‚Aufklärung‘, Suche nach Ursachen, Erklärungen Abfragen für jedes Thema kann SQL-DB abgefragt werden/ welche Autoren und/oder Journale zu welchem Zeitpunkt involviert/erstellen hierarchischer Listen Überführung in NWA möglich Generierte Themen beinhalten keinerlei Interpretation Ergebnisse Entwicklungs- tendenzen Entwicklung des Pressemarktes in vier Zeitschnitten dominierende Journale Journale, die Vielzahl von Themen bedienen in zentralen Positionen/meist Rezensionszeitschriften ohne fachlichen Schwerpunkt/Naturkunde im Aufschwung/viel praktisches Wissen dominierende Themen zentrale Themen über Gesamtzeitraum: Rezensionen zu politischen Schwerpunkten/Rezensionen zu theologi- schen Schriften/beschreibende Artikel zur Natur und Geographie unterschiedlicher Länder/ Themen, die nur punktuell oder spät aufkommen am Rand des Netzwerks/ dynamische Modellierung ermöglicht Hinterfragen von Entwicklungen und Verschiebungen Layout: Katrin Sillmann Kombination Topic-Modelling und Netzwerk- analyse (NWA) Fragestellung Kann NWA bei der Erklärung der generierten Topics hilfreich sein? Inwiefern kann Einbeziehung zusätzlicher Metadaten durch NWA ge- lingen? praktische Anwendung Umwandlung Listen TopicExplorer in Knoten und Kanten/ ergänzen weiterer Eigenschaften/ Attribute/NWA-Tool Gephi/vielfältige Selek- tionsmöglichkeiten	poster
Effect of acorn feeding on quality and aromatic profile of dry sausages produced from Turopolje pigs D. Karolyi1, N. Marušić Radovčić2, H. Medić2, Z. Luković+, U. Tomažin3, M. Škrlep3 and M. Čandek Potokar3 1University of Zagreb, Faculty of Agriculture, Svetošimunska 25, 10000 Zagreb, Croatia, 2University of Zagreb, Faculty of Food Technology and Biotechnology, Pierottijeva 6, 10000 Zagreb, Croatia, 3Agricultural institute of Slovenia, Hacquetova ulica 17, 1000 Ljubljana, Slovenia; dkarolyi@agr.hr Turopolje pig (TP) is an endangered Croatian autochthonous breed typically reared in an outdoor production system linked to local oak forests and marsh meadows in Turopolje region in Central Croatia. To self-sustain TP breed the utilization of meat products with added value has recently been proposed in TREASURE project. So far little information is available on the quality attributes of TP meat products, including the effect of locally available feeding resources. Hence present study aimed to examine the quality and aromatic profile of dry-fermented sausages of TP that were reared in similar conditions but fed either conventional (CF) or acorn supplemented (AF) finishing diet. The quality of end product, pH and aw values, moisture, fat and protein content, fatty acid (FA) profile, oxidative stability, texture profile analysis (TPA), sensory evaluation and aromatic profile were determined. Data were analysed by TTEST or NPAR1WAY (for sensory data) procedure at an alpha level of 0.05. Compared to CF, AF sausages tended (P<0.1) to have higher moisture content and TPA chewiness, but generally had similar physicochemical, rheological and sensorial traits and FA composition, except for higher share of C14:0. Lipid oxidation, measured as 2-thiobarbituric acid-reactive substances, was more pronounced in AF than CF sausages. Aromagram showed terpenes as the most abundant volatiles (around 52% of the total area) in both types of sausages, followed by aldehydes (11-14%), aromatic hydrocarbons (6-10%), phenols (6-7%), alcohols (5-6%), acids (4-6%), Sulphur compounds (2- 5%), ketones (around 3%), esters (less than 2%) and aliphatic hydrocarbons (less than 1%). Compared to CF, AF sausages had less aromatic and aliphatic hydrocarbons and sulphur compounds, and more esters. These results suggest that acorn feeding may affect some properties of TP dry-fermented sausages but more research is needed. Funded by European Union’s H2020 RIA program (grant agreement no. 634476).	poster
. Sparger Overlay N2 N2 Methods Results The views expressed are purely those of the author(s) and may not in any circumstances be regarded as stating an official position of the European Commission. This poster is part of the European Joint Programme One Health EJP. This project has received funding from the European Union’s Horizon 2020 research and innovation programme under Grant Agreement No 773830. Effect of nitrogen gassing strategy on the in vitro cultured chicken caecal microbiota Ingrid Cardenas Rey1,2 • Teresita Bello Gonzalez1 • Kees Veldman1 • Arjan de Visser2 • Michael Brouwer1 1. Dept. of Bacteriology, Host-Pathogen Interaction and Diagnostics Development, Wageningen Bioveterinary Research, Lelystad, The Netherlands • 2. Laboratory of Genetics, Wageningen University and Research, Wageningen, The Netherlands. In vitro models are cost-efficient tools to study animal gut microbiota dynamics with controlled conditions without the ethical implications of animal studies. Nevertheless, the continuous optimisation of in vitro models is imperative to reduce experimental bias and generate reliable data. Here, we have tested the effect of two nitrogen gassing strategies (overlay vs sparger) on the chicken caecal microbiota composition over time using a continuous single-stage fermentation culture system. Conclusions Experimental conditions were set up identically in two bioreactors except for their anaerobic environment; in one nitrogen was supplied on the top of the culture (overlay) while in the other nitrogen was sparged directly into the culture (sparger). Bioreactors were inoculated with an identical cryopreserved pool of caecal content from adult chickens and the in vitro chicken caecal physiological conditions (temperature, pH, caecal movements, and reduced levels of oxygen) were real-time monitored overtime (Fig. 1). Samples were collected daily (day 0 - 8) for 16S rRNA gene sequencing and downstream analyses. Figure 2. Real-time monitored conditions (pH, temperature, dissolved oxygen (dO2)). Overlay and Sparger in light and dark colour, respectively. Figure 3. Alpha and beta diversity analyses of the in vitro chicken caecal microbiota in both bioreactors (overlay and sparger) a. Observed microbial richness over time (ASV; Amplicon sequence variant) b. Principal coordinate analysis showing changes in the microbial community composition over time c. Comparison of the top ten genera relative abundance over time. a b c In vitro simulated chicken caecal conditions remained stable over time (Fig. 2). Most variability was observed in the pH due to microbial activity. Microbiota analysis • Microbial richness fluctuated daily in both bioreactors (Fig. 3a). • Experiment time explained 63% of the compositional variation of the in vitro microbiota (p < 0,001) while the gassing strategy explained 4% (Fig. 3b). • Anaerobes as Butyricicoccus (Fig. 3c) and Lachnospiraceae were significantly higher (p < 0,001) in sparger than overlay. Contact: Ingrid.cardenasrey@wur.nl Acknowledgements Part of this work was funded by the Dutch Ministry of Agriculture, Nature and Food Quality. Our continuous single-stage in vitro model simulated the conditions necessary to closely reproduce the main taxa of the chicken caecal microbiota. However, our results also show that the choice of experimental settings, in our case gassing type, has an impact on the in vitro cultured microbial community composition over time. Thus, pre-testing optimisation and standardisation of in vitro systems should be considered as vital to reduce bias and draw meaningful conclusions. Further work: to study the effect of interventions (e.g. synbiotics) on the horizontal transmission of antimicrobial resistance genes in the in vitro chicken gut microbiota. Figure 1. Experimental set-up showing a. Origen of the initial caecal inoculum b. Two strategies of nitrogen delivery (sparger and overlay) on the in vitro chicken caecal microbiota.	poster
Introduction The feral population of primitive Soay sheep on the remote island of St Kilda, in the North Atlantic Ocean, provides a unique research resource where scientists have been studying related evolutionary genetics and population dynamics for decades. The island is covered in vegetation typical of many upland areas along the west coast of Britain. Research & Aim This study is specifically addressing unanswered questions associated with plant - herbivore interactions. The aim is to further validate the the application of faecal DNA metabarcoding to fully determine diet composition in herbivores. Further decision making & development of predictive models used for ecosystem conservation management. Support optimal grazing regimes within extensive sheep systems. Support reducing the need for anthelmintic drugs whilst improving animal nutrition via grazing management. Provide knowledge to avoiding over- exploitation and depletion of habitat resources. Knowledge gained will improve: Diet studies have not previously been undertaken on the island due to the challenges associated with determining diet composition by free ranging animals. However, as there are no competitors nor predators the population is naturally regulated and co-dependent on the availability of resources such as food availability and nutritional quality, providing an ideal system to study plant-herbivore interactions. Project Outputs Provide insight into how dietary preference of sheep differ at e.g. different ages and times of the year. This information will increase our understanding of interactions between diet choice, immunity, gut bacteria and parasite burden in both wild and domesticated herbivore populations. How can studying Soay sheep on St Kilda help conservation and farming in the Welsh uplands? H.E.Vallin* (a), M.D.Fraser, H.Hipperson (b) (a) Pwllpeiran Upland Research Centre, Aberystwyth University. (b) Department of Animal and Plant Sciences, University of Sheffield. Question: Can faecal DNA metabarcoding determine the quantitative composition of herbivore diets down to species classification? *hev1@aber.ac.uk Pwllpeiran Upland Research Centre, Aberystwyth University, Cwymystwyth, Aberystwyth, SY23 4AB, UK This project is funded by NERC Methods Regular non-invasive faecal sampling from known individuals for DNA meta-barcoding to determine botanical composition of consumed diet.	poster
Improving Data Stewardship with the DMPTool: Helping Libraries Promote Data Management Dan Phipps & Carly Strasser \| daniel.phipps@ucop.edu \| carly.strasser@ucop.edu This project is sponsored by With a little help from our friends: In brief: We received funds from the IMLS to build resources around the DMPTool for librarians. We want to equip librarians to provide data management services for their institution’s researchers and other stakeholders Project Goals: • Centralize existing resources • Provide outreach materials around the DMPTool • Build a community of sharing ideas & resources Why librarians? • Long-‐standing tradition of service & preservation • Opportunity to ﬁll data education void, provide valuable research support What is the DMPTool? Coming soon: DMPTool2 Deliverables Webinars & Course Certiﬁcate Outreach Kit Web Content 28 May Introduc/on to the DMPTool 4 June Learning about data management: Resources, tools, materials 18 June Customizing the DMPTool for your ins/tu/on 25 June Environmental Scan: Who's important at your campus 9 July Promo/ng ins/tu/onal services; EZID Outreach Made Simple! 16 July Health Sciences & DMPTool -‐ Lisa Federer, UCLA 23 July Digital humani/es and the DMPTool -‐ Miriam Posner, UCLA 13 Aug Data cura/on proﬁles and the DMPTool – Jake Carlson, Purdue How to give the data management sales pitch to various audiences Other tools and resources that work with/complement the DMPTool Beyond funder requirements: more extensive DMPs Case studies 1 – How librarians have successfully used the tool Case studies 2 – How librarians have successfully used the tool Outreach Kit Introduc/on Cer/ﬁca/on program introduc/on CERTIFICATION COURSE Free step-‐by-‐step web application for creating data management plans for funders Founding partners: DataONE; Digital Curation Centre; Smithsonian Institution; UC Curation Center, California Digital Library; UCLA Library; UC San Diego Libraries; University of Illinois; University of Virginia Libraries General & institution-‐ speciﬁc resources Funder-‐provided information & plan outline Suggested answers & help text Space to answer questions Log in with institution credentials Learn more at dmptool.org bitbucket.org/dmptool/main blog.dmptool.org dmptool.org For administrators: • Beber plan template granularity (discipline, funder, ques/on) • Beber ins/tu/on granularity (department, college, lab group, …) • Role-‐based user authoriza/on & access • Enhanced search and browse of plans • Access to metrics for repor/ng & follow-‐up For plan creators: • DMP life cycle management • Collabora/ve plan crea/on • Role-‐based user authoriza/on & access • Beber plan templates & resources Plus… • Ins/tu/onal branding • Open API DMPTool2: Responding to the Community Promotional Materials Presentation Templates Customizable LibGuides	poster
Cited literature: (1) Sullivan, L.M., Massaro, J.M. and D'AgosƟno, R.B., Sr. (2004). PresentaƟon of mulƟvariate data for clinical use: The Framingham Study risk score funcƟons. StaƟst. Med., 23: 1631-1660. (2) World Health Organizaton (2015). Guidelines for the prevenƟon, care and treatment of persons with chronic hepaƟƟs B infecƟon. ISBN: 978-92-4-154905-9. (3) Shimakawa, Y. et al. (2018). Development of a simple score based on HBeAg and ALT for selecƟng paƟents for HBV treatment in Africa. J. Hepatol. 69, 776–784. AﬃliaƟons: (1) Insitut Pasteur, Paris, France, (2) Vesƞold Hospital, Tønsberg, Norway, (3) University of Oslo, Oslo, Norway, (4) Bogodogo University Hospital Center, Ouagadougou, Burkina Faso, (5) University of Bern, Bern, Switzerland, (6) University of Zambia, Lusaka, Zambia, (7) University of Alabama at Birmingham, Birmingham, United States, (8) Tygerberg Hospital and Stellenbosch University, Stellenbosch, South Africa, (9) InsƟtute of InfecƟon, Veterinary and Ecological Sciences, Liverpool, United Kingdom, (10) Malawi-Liverpool-Wellcome Trust Clinical Research Programme, Blantyre, Malawi, (11) University of Cape Town, Cape Town, South Africa, (12) Yalgado Ouédraogo University Hospital Center, Ouagadougou, Burkina Faso, (13) Centre Regional de Recherche et de FormaƟon, Centre Hospitalier NaƟonal Universitaire de Fann, Dakar, Senegal, (14) Liverpool School of Tropical Medicine, Liverpool, United Kingdom, (15) Faculty of Medical Sciences, University of Jos, Jos, Nigeria, (16) Imperial College London, London, United Kingdom, (17) London School of Hygiene & Tropical Medicine, Banjul, Gambia, (18) University of Oxford, Oxford, United Kingdom, (19) The Francis Crick InsƟtute, London, United Kingdom, (20) University College, London Hospitals, London, United Kingdom, (21) Stellenbosch University Faculty of Medicine and Health Sciences, Cape Town, South Africa, (22) St. Paul's Hospital Millennium Medical College, Addis Ababa, Ethiopia, (23) Hopital Principal de Dakar, Dakar, Senegal. In sub-Saharan Africa, clinical reference standard to assess eligibility for treatment (HBV DNA PCR, transient elastography, liver biopsy) is oŌen restricted to naƟonal-level centers. To improve uptake of anƟ-HBV therapy, we need either signiﬁcant investment to make viral load tesƟng available even at peripheral health faciliƟes, or the development of simpliﬁed eligiblity criteria. Here, we found that a combinaƟon of platelet counts, AST and ALT levels - tests available even at low level health faciliƟes - can idenƟfy the majority of HBV-infected people in need of AVT. Our results suggest that even in the absence of upgrades in laboratory and radiology, decentralizaƟon of clinical staging for HBV-infected people may be realized in SSA. Conclusion Performance of diﬀerent guidelines and scoring systems, in the validation dataset. Because it relies on biopsy or liver sƟﬀness measurments, clinical reference standard (EASL 2017 guidelines) are only available in TIER4 level faciliƟes. Two eligibility evaluaƟon tools have already been proposed in the past years. WHO 2015 guidelines relies notably on viral load (VL) and are available at TIER3 level faciliƟes (or above). They fall short of detecting half of eligible persons (38% sensitivity), but keep high speciﬁcity (98%), leading to an overall AUROC of 0·68 [0·64–0·72]. TREAT-B scoring system requires HBeAg testing, and is thus available at TIER3 level facilities. It achieves 0·87 [0·84–0·90] AUROC, with 88% sensitivity and 86% speciﬁcity. Our simple scoring system, available in TIER2, achieves comparable results, with 0·83 [0·79–0·86] AUROC, 79% speciﬁcity, and 87% sensitivity in the validation dataset. However, it only relies on platelet and transaminases, and is thus available at TIER2 level faciltities Test n AUROC Se (%) Sp (%) TP FN FP TN HEPSANET scoring system 1452 0·83 [0·79, 0·86] 79 87 117 31 174 1130 WHO 2015 guidelines 1439 0·68 [0·64, 0·72] 38 56 98 92 28 1276 TREAT-B 1439 0·87 [0·84,	poster
This work is licensed under a Creative Commons Attribution 4.0 International License. © 2019 Department for International Development Institutions Institutions A comparative assessment of Ethiopia, Ghana, Kenya, Nigeria, Rwanda, Tanzania and Uganda Research environment The number of universities is booming to satisfy demand for higher education but the eﬀects on research are limited. No country meets the African Union goal of 1% GDP invested in research and development.¹ Governments see research as part of the broader science, technology and innovation agenda: only two countries have a research policy, but six have an STI policy. In many countries there is an opportunity to create stronger national research institutions: four countries have neither a research ministry nor a national research funder. Foreign R&D contributions play a large role in many African countries, but evidence on their economic impact is limited.¹ Most African countries have relatively few researchers: there is a need to make research a more attractive career option.¹ This data comes from a needs assessment study of the research systems in seven African countries, produced for the UK Department for International Development. The full set of infographics and the underlying analysis is available at http://bit.ly/SRIA2020 National research policy National STI policy 2/7countries 6/7 countries National research/STI funder Ministry/dep’t for research 3/7countries 3/7countries 0.0% 1.0% Ethiopia Ghana Kenya Nigeria Rwanda Tanzania Uganda 0% 70% Ethiopia Ghana Kenya Nigeria Rwanda Tanzania Uganda R&D Funding 0 S. Afr. 2.5 Ethiopia Ghana Kenya Nigeria Rwanda Tanzania Uganda No. Universities R&D Int’l Funding 0 600 Ethiopia Ghana Kenya Nigeria Rwanda Tanzania Uganda S. Afr. No. Researchers 1 UNESCO, “UIS Statistics,” 2019: http://data.uis.unesco.org Researchers/million inhabitants Universities/million inhabitants % of total R&D funding % of GDP	poster
Wohin mit… Sprachdaten? Bayerisches Archiv für Sprachsignale Repository Start Daten- management- plan? Dokumentieren Analysieren Sammeln Analysieren Sammeln ja nein §§§ Webdienst COALA • generiert CMDI Metadaten aus Tabellen • Ingest der Audio- und Annotationsdaten	poster
Discussion: Examples of the time series are shown in Figure 2. Images of Active Galactic Nuclei (AGN) sources generally become more compact with increasing frequency, as shown in Figure 3. It has often been assumed that VLBI source positions, as determined by measuring the source’s VLBI phase center, should be more stable at higher frequencies. This is the assumption we are testing with these comparisons. But we find that these comparisons are difficult to make and interpret due to the different nature of the X/S and K sessions and the different networks used. The X/S and K VLBA astrometry sessions mostly look at different sources. The IVS X/S R1, R4 and RDV/RV sessions have larger networks than the VLBA, particularly with better North-South extent and with baselines crossing the equator, leading to smaller declination uncertainties and less asymmetry. However, the East- West coverage of the IVS networks vs the VLBA are not so different, and the data gives a slight edge to K band in right ascension in terms of WRMS scatter. There is no reason to expect that the true average source position variability would be systematically greater in declination than right ascension and there is also no reason to expect that the true average source position variability would increase from the northern to the southern part of the sky. Therefore we attribute the larger WRMS scatter for K band in declination to be a network effect and we believe the indication is that the true position variability is less at K band than at X/S band. Figure 3: Near-simultaneous images of NRAO140/J0336+3218 at S (2.3 GHz), X (8.6 GHz), K (24 GHz) and Q (43 GHz) bands from a study of VLBA observations of 453 ICRF sources from April - June 2021 (Hunt et al, 2022, de Witt et al, 2022), which shows that VLBI images of ICRF sources become more compact with increasing frequency. Note how the jet in this example fades with increasing frequency. The VLBA synthesized beam is shown as the grey ellipse in each sub-figure. Conclusion: Sources do appear to be more stable at K than X/S band, on average. However our ability to measure and quantify this is limited by network differences and the limited amount of overlapping source data at the two bands. Acknowledgements: The authors acknowledge use of the Very Long Baseline Array under the US Naval Observatory's time allocation. This work supports USNO's ongoing research into the celestial reference frame and geodesy. The VLBA is operated by the National Radio Astronomy Observatory, which is a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc. K vs X/S comparisons: Both the X/S and K band data required some additional editing to remove positions that were very noisy or where there were too few observations in the session. For a source to be used we required that it be in at least 10 sessions with at least 10 observations in each session and have uncertainties of no more than 1.0 milli-arc-second (mas) in each session. Then, two methods were used to estimate the scatter for each source in each band. In the first method, weighted root mean squares (WRMS’s) about the mean of each source’s position were computed in RA and declination using the RA and declination formal errors for weighting. The WRMS’s of 417 common sources were then compared. Itn this method, ~56% of the sources exhibit less scatter in RA, but only ~36% exhibit less scatter in declination at K band. In the second method, a more complicated procedure was used to compute WRMS’s about the means by using the full covariance matrix for each session, but the results are similar. In this method, ~60% of the sources show less scatter in RA but only ~34% show less scatter in declination at K band. We show this graphically in Figure 1 for the second method where the logarithm of the ratio of the WRMS’s at K vs X/S is plotted vs declination for each matched source. Values greater than zero indicate less scatter in	poster
Jensen CL, Bibbo J, Rodriguez KE, O’Haire ME. The eﬀects of facility dogs on burnout, job-relatedwell-being, and mental health in paediatrichospitalprofessionals. Journal of Clinical Nursing. 2021 Maurice C, Engels C, Canouï-Poitrine F, Lemogne C, FromanKn I, Poitrine E. Dog ownership and mental health among community-dwelling older adults: A systemaKc review. Int J GeriatrPsychiatry. 2022 Ginex P, Montefusco M, Zecco G, Trocchia MaTessich N, Burns J, Hedal-Siegel J, Kopelman J, See Tan K. Animal-Facilitated Therapy Program: Outcomes from caring canines, a program for paKents and staﬀ on an in paKent Surgical oncology unit Clinical Journal of Oncology Nursing. 2018 Mueller MK, Gee N, Bures RM. Human-animal interacKon as a social determinant of health: descripKve ﬁndings from the health and reKrement study. BMC Public Health. 2018 SNOOPY the media)on dog at Ins)tut Curie: a team eﬀort Marguerite Nicodeme1, Maxime Cheron1, Elodie Labedade1, Hedi Chabanol1, Adeline Gigan;1, Philippe Mont1, Hind Baba Aïssa1, Caroline Gilbert2, Dörthe Nickel3, Isabelle Froman;n1, Virginie Bel3 1. Unité Recherche Plaies et Cicatrisa;on, Ensemble Hospitalier, Ins;tut Curie; 2. ENVA, UMR 7179 CNRS/MNHN; 3. Direc;on du Centre de Recherche, Ins;tut Curie To oﬀer to the project team and all Ins3tut Curie staﬀ a happy and friendly presence, in order to lighten the burden of busy days in terms of both work density and emo3onal load. REFERENCES EULIFE -Meeng June 6th, 2023 it’s &me for SNOOPYTHERAPY 2 MAIN OBJECTIVES Background situa.on High stress levels for medical professionals Suﬀering and lack of communica3on by pa3ents Post-Covid crisis – loss of social coherence METHODS hospital waing room consulta)on room Interac3ons with pa3ents FIRST RESULTS a two-year-old English seFer who was adopted from the SPA animal rescue center in 2022 Experts team A vet and animal behaviour expert at Na3onal Veterinary School A occupa3onal therapist and lecturer at Univ. Paris Est Créteil A professional dog trainer A team of 5 specially trained nurses NOOPY ? WHO IS WORKING TOGETHER TO BEAT CANCER A"er Curietherapy and Immunotherapy NOOPY FAMILY Research Care Genera3on & Preserva3on of knowledge Ins3tut created by Marie Curie in 1909 CONTEXT Envisioning the research centres of the future Choice of the dog Not too big Floppy ears to avoid appearing aggressive Robust and healthy With a calm temperament and familiar with humans Balance of spirit Training period Posi3ve educa3onal model Hospital wai)ng room Evalua3on: Who ? Impacts ? Internal staﬀ and pa3ents Quality of work life, stress level First month of work with Cancer pa3ents, non communica3ve pa3ents, > 75 years old, adolescent cancer pa3ents Stressed clinicians Consulta3ons and wai3ng room Before stressful examina3ons Health and safety charter validated Many posi3ve surprises Countless smiles A canine project full of humanity More than a colleague on 4 paws Snoopy is a super doctor New links between Hospital and Research Center Animals can provide solu.ons, they Encourage communica3on and interac3on Bring posi3ve distrac3on Reduce anxiety + many Snoopy volunteers 3 employees on 3 sites 3,700 missions Improve project management Mi3gate limi3ng factors Reﬂexion about a second dog? Possibility of replica3ng the project: other Curie sites, the Research Center 🐶, other establishments in France and beyond. PERSPECTIVES FOR THE FUTURE CONCLUSION To provide Snoopy 3me on request to pa3ents for whom the presence of a dog could be beneﬁcial: non-communica3ve or very anxious pa3ents, in oncogeriatrics, adolescent consulta3ons. virginie.bel@curie.fr - maxime.cheron@curie.fr	poster
A flare is visible in Transit 1 and may contaminate any planetary signal that would otherwise have been observable. Integrated AU Mic b, or not AU Mic b: the question of the young exoplanet's escaping atmosphere Do young Hot Neptunes exhibit atmospheric escape in Lyman-alpha spectra? There are a handful of detections of Hot Neptune transits with Lyman-alpha, as well as non-detections. Detections indicate the presence of escaping neutral hydrogen. We expect low density, close-in planets to be losing some or all of their atmospheres due to their irradiation. K2-25b is a young, close-in, Neptune-sized planet that did not indicate the presence of escaping neutral hydrogen (Rockcliffe, et al., 2021). Keighley Rockcliffe, Elisabeth Newton, Allison Youngblood, Peter Gao, Peter Plavchan, Eric Lopez HST/STIS Lyman-alpha transits of AU Mic b AU Mic b is another young, close-in planet that can provide more insight into atmospheric escape. Transit 1 of HST shows no significant transit of an escaping neutral hydrogen atmosphere, similar to K2-25b. keigh.rockcliffe@gmail.com kerockcliffe.com Transit 2 of HST complicates the picture, showing a potential planetary or stellar signature. The timescale of this steady increase in Lyman-alpha flux is too long to be attributed to the documented "breathing" effect. The increase is also offset in time from where an escaping neutral hydrogen tail is expected (after mid- transit). Scan for more info The timescale for AU Mic to photoionize any neutral hydrogen escaping AU Mic b is about 0.7 hours. K2- 25b has a similarly short timescale of about 2.5 hours. It may be that these planets have ionized hydrogen outflows that would not be observable at Lyman-alpha (Owen, et al., 2021). This work was done at Dartmouth College, which resides on unceded Abenaki land. ISM ISM	poster
ANÁLISE DO ESFORÇO MUSCULAR DURANTE A EXECUÇÃO DOS MOVIMENTOS DE FLEXÃO E EXTENSÃO DE PUNHO EM PACIENTES COM DOENÇA DE PARKINSON - UM ESTUDO PILOTO Samila Costa, Amanda Rabelo, Luiza Luiz, Luciane de Souza, Nayara Faustino, Marcus Vieira*** e Adriano Andrade* UFU, UFTM, **UFG 1. INTRODUÇÃO A ergonomia de qualquer solução ortótica é vital para a sua adoção efetiva na fisioterapia relacionada à DP. Nesse sentido, trabalhos realizados anteriormente no Núcleo de Inovação e Avaliação Tecnológica em Saúde (NIATS) destinaram-se ao estudo de variáveis ergonômicas que devem ser levadas em consideração para o uso de uma órtese ativa de punho, na prática clínica, a fim de prover dados necessários ao aprimoramento do dispositivo disponível. Um dos estudos realizados avaliou o esforço muscular dos flexores e extensores de punho, no plano sagital eixo latero lateral, com e sem o uso do dispositivo ortótico. Os resultados mostraram que o esforço muscular exigido do flexor de punho era menor durante o uso do dispositivo ortótico, concluindo que o peso da órtese combinado com a força gravitacional facilita o movimento de flexão. Diante do exposto, este estudo tem como objetivo avaliar a influência da mudança de plano e eixo no esforço muscular durante a execução dos movimentos de flexão e extensão de punho em pacientes com DP. Optou-se pela realização de um piloto para verificar o esforço muscular dos flexores e extensores de punho no plano transversal eixo longitudinal o qual sofre uma menor influência da força gravitacional. 3. RESULTADOS O Gráfico 1. mostra a análise, baseada na média da porcentagem de ativação muscular (% CVM) dos Sujeitos. Os dados utilizados para o cálculo da média foram obtidos durante os movimentos de flexão-extensão do punho, no plano sagital, eixo latero lateral, em seguida o mesmo protocolo foi realizado no plano transversal eixo longitudinal. Gráfico 1. Comparação entre o % MVC para os músculos flexores e extensores nas posições vertical e Horizontal. 2. MATERIAIS E MÉTODOS Participaram deste estudo dois indivíduos diagnosticados com a Doença de Parkinson, um homem e uma mulher, com respectivamente 62 e 56 anos, classificados pela escala Movement Disorders Society - Unified Parkinson's Disease Rating Scale (MDS-UPDRS), em grau moderado. O protocolo experimental foi explicado detalhadamente para cada voluntário. Para quantificar a atividade muscular máxima dos sujeitos, a Contração Voluntária Máxima (CVM) foi adquirida e analisada. Os dados da CVM foram utilizados como valores de referência para comparação dos dados resultantes da tarefa proposta. A Figura 1. mostra a posição do antebraço e punho durante a realização das tarefas. Os sinais de EMG foram coletados simultaneamente dos músculos flexores e extensores do punho. 4. DISCUSSÃO Este estudo concentrou-se em analisar e comparar esforço muscular durante a realização dos movimentos e flexão e extensão de punho, no plano sagital eixo latero lateral, com o mesmo protocolo realizado no plano transversal eixo longitudinal. No movimento de flexão esse aumento chega a aproximadamente 46,57% e ocorre, pois, quando realizado no plano sagital, o peso do punho e da mão, combinado com a força gravitacional, favorece o movimento exigindo um menor esforço muscular. Desta forma ao se repetir o mesmo movimento no plano transversal, onde a força gravitacional tem menor influência e não favorece o movimento, o %CVM do flexor aumenta. Para o movimento de extensão esse aumento não é tão expressivo, cerca de 11%. Estes resultados preliminares permitem concluir que estudos que avaliam esforço muscular utilizado o músculo flexor de punho, devem ter cuidado ao definir o protocolo, uma vez que o movimento realizado no plano sagital eixo latero-lateral, sofre com influência da força gravitacional, o que interfere de forma significativa no esforço muscular avaliado. O que não acontece de forma tão expressiva com os extensores. Figura 1. A e B, respectivamente, extensão e flexão	poster
Flanders Bio Imaging – towards efficient centralized research data management and analysis of bioimaging data Sebastian Munck1,2,9, Christopher Cawthorne1,3,9, Tatiana Woller1,2,4,9, Benjamin Pavie1,2,9,10, Alexander Botzki4,5,9, Frank Vernaillen6, Raf De Coster7,9, Paul Borgermans8,9, Ingrid Barcena Roig 8,9, , Mariana Montes8,9 To make modern data management and analysis that is committed to FAIR principles and improved reproducibility a reality, Flanders BioImaging in a team effort with the Flemish supercomputing center (Vlaams Supercomputer Centrum, VSC) and KU Leuven’s central IT infrastructure, is exploring new models for data management, metadata handling, and image analysis. Research data management (RDM) Versatile HPC for users with distinct needs Due to the diversity in microscopes, biological images are heterogenous, leading to a plethora of distinct analyses. Hence, image analysts require a flexible and powerful environment to carry out their work. In the OnDemand server at the VSC, users can select virtual desktops with dedicated software (Band, Neurodesk), cluster desktop or web-based interactive environments (Jupyter Lab, R Studio server)… Conclusion and prospects Thanks to this collaboration, we aim at: 1. FAIR RDM and analysis by design 2. Single point of access to enhance reproducible analysis 3. A platform for collaboration on bioimage analysis Affiliations 1.Flanders Bio Imaging 2.Bioimaging core, VIB 3.Molecular Small Animal Imaging Center, KU Leuven 4.Elixir Belgium 5. Technology training core, VIB 6. Spatial Catalyst, VIB 7. Center for Brain and Diseases Research, VIB 8. Flemish supercomputer center (VSC) 9. KU Leuven 10. UGent Globus Data deposition Automatic extraction metadata Automatic transfer from instruments Use of ontologies with schemas Policies, automation, data discovery Bio -Formats REMBI MITI MIAPE ISO Schema manager In general, RDM is often postponed until it becomes crucial. However, there is an increasing number of editors and funding agencies requiring open or findable accessible interoperable reusable (FAIR) data. While going through the data-lifecycle, we attempted to find a golden mean between FAIR data and the time invested by researchers to achieve FAIR data. Hence, we automatized each step, where possible, of the data lifecycle. With ManGO data is stored and annotated, with metadata to contextualize and make it findable. Data workflows are automated helping to reduce manual work and mistakes. All this via different user interfaces making ManGO accessible for everybody and from everywhere. Rstudio server Jupyter Lab Bioimage analysis desktop HPC Institutional repositories Neurodesk	poster
WOMEN INCLUSION IN HUMAN CAPACITY DEVELOPMENT; THE SUB-SAHARAN NUCLEAR INDUSTRY Keziah Garba, Ahmadu Bello University, Nigeria Research Question To what extent can human capacity development improve gender equality in the sub-Saharan nuclear industry? Background • Gender equality is pivotal to creating a thriving work environment. • However, women comprise barely 25% of the global nuclear workforce. • In sub-Saharan Africa, the challenges women face in the nuclear sector has affected their workforce participation and ability to access key decision- making positions. • Without initiatives in place to tackle these issues, they threaten the potential of the nuclear industry growth in sub- Saharan Africa Why Sub-Saharan Africa? • Sub-Saharan women experience the highest levels of inequality globally. The main challenges include: • Socio-cultural barriers • Lack of funding • Restricted educational opportunities • Lack of advocacy Methodology • Case studies based on successful initiatives implemented on similar challenges in STEM fields. • Analysis of the specific challenges. • Particular focus on the impact of capacity development. Conclusion • Given the history of economic and social injustices excluding sub-Saharan women from contributing to the nuclear field, human capacity development is essential to improving their competencies. • Governments and international nuclear organizations can play key roles in capacity development through: • Education • Mentorship • By empowering Sub-Saharan women in the nuclear industry, we can foster a more inclusive and gender-balanced sector, enhancing prowess within the field. Recommendations • International nuclear organizations and governments should implement capacity development initiatives tailored toward improving the gender pipeline in the sub- Saharan nuclear sector. • Scholarships for women studying nuclear and related fields at the university. • Encourage the participation of women in nuclear fields through advocacy and empowerment. • Provide capacity building opportunities such as trainings and workshops. Case studies • Regional Scholarship and Innovation Fund (est. 2015) 103343% of total Female PhD Scholars so far • Sciences et Technologies au féminin (Kenya, 2023) • Africa Centre for Excellence (est. 2014) Scan to Connect	poster
Innovative Research for a Sustainable Future www.epa.gov/research Logan J. Everett l everett.logan@epa.gov l 919-541-2495 Overview Screen Design & Analysis Scalable Quality Control Differential Gene Expression Analysis Summary & References High-Throughput Chemical Safety Screening Using Targeted RNA-seq Logan J. Everett, Joshua A. Harrill, Derik Haggard, Joseph Bundy, Beena Vallanat, Imran Shah, Richard Judson U.S. Environmental Protection Agency, Office of Research and Development, Center for Computational Toxicology & Exposure Research Triangle Park, North Carolina, U.S.A. • U.S. EPA has proposed a tiered testing strategy using New Approach Methodologies (NAMs) to identify hazards from chemical exposure and characterize their dose-response relationships. The first tier of testing will utilize NAMs that are high-throughput and provide broad biological coverage [1]. • Targeted RNA-seq of cultured human cells provides a platform for high-throughput transcriptomics (HTTr) screening that covers >20,000 genes and a wide array of biological responses and pathways [2]. • We successfully piloted the targeted RNA-seq approach for HTTr to predict biological pathway altering concentrations (BPACs) [3] and have now scaled this approach to screen over 1,200 chemicals in three distinct cell types. • We have developed rigorous quality control procedures to remove aberrant samples that are scalable to tens of thousands of sequencing libraries per study. • Differential expression models [4] reveal dose-responsive accumulation of transcriptional changes across cell types and chemicals tested, and signature-based analysis is used to derive potency and mechanism of action information for each chemical. Figure 1. Design and analysis of large-scale high-throughput transcriptomic screens. Left: Dose plates are prepared with ~40 test chemical samples at 8 concentrations (half log10 spacing, single replicates) and a standard set of reference chemicals for each cell type. Cells are grown on the test plate, then treated with chemical samples from the dose plate. Positions of each chemical treatment are randomized on every plate by an automated liquid handling system. Each test plate is generated in triplicate using the same test chemicals, but with separate cell culture batches. QC reference standards are manually added to each test plate before transcriptomic profiling. Right: Raw data from targeted RNA-seq samples is rapidly aligned to known probe sequences producing counts of uniquely aligned reads for each probe in each sample. Probe counts are used to derive QC metrics and are stored in a database layer. Subsequent analysis is performed independently for each chemical. Count data for all concentrations, replicates, and plate-matched vehicle controls are extracted. DESeq2 [4] is used to compute moderated fold-changes, which are then input to a novel method for modeling concentration-responsive activity for a catalog of known gene signatures. Figure 3. Quality control failure rates by sample and cell type. Individual HTTr profiles were excluded from further analysis due to errors in acoustic dispensing of chemicals (red), >50% cell death indicated by cell viability assay (green), or abnormal parameters from a battery of bioinformatic checks applied to sequencing data results (blue, see Figure 2). Greater than 98% of samples pass all QC filters, demonstrating the ability to reliably scale this workflow to studies encompassing thousands of chemicals and samples. Acoustic dispenser logs identify problems with chemical handling Apoptosis/cell viability assays identify cytotoxic concentrations (>50% cell death) Bioinformatic QC checks remove: • Low read depth samples • High rate of alignment failure • Samples with low gene coverage • Samples with irregular count distributions N = 2,509 41,952 36,208 35,559 The views expressed are those of the presenter and do not necessarily reflect the views or policies of the U.S. Environmental Protection Agency. 1. Th	poster
NASA’s GMAT: a software tool-kit for general space-mission design and space-craft trajectory analysis Nikolaj F. Eriksen1, Tobias C. Hinse1, Jose L. Alvarellos2 and Mads T. Frandsen1 1University of Southern Denmark, SDU-Galaxy, FKF, Denmark 2Private address, California, USA Annual Danish Astronomy Meeting (ADAM) 2024 – 22 - 23 May 2024 -- Comwell Hotel Roskilde, Denmark Abstract: We introduce and raise awareness of NASA’s GMAT (General Mission-design and Analysis Tool) software system tool for spacecraft trajectory optimization and mission design, navigation and orbit analysis. GMAT is developed by NASA Goddard Space Flight Center (GSFC) in collaboration with private industry, public developers and various national space agencies. The tool has applications in all orbital regimes (mission to libration points, LEOs, landing scenarios, gravity-assist fly-by’s). GMAT is fully tested and certified for operational use and was chosen as the primary operational tool for NASA’s ACE (Advanced Composition Explorer) mission for maneuver planning, orbit determination. Various spacecraft models (various thruster models, impulse burn, etc), numerical propagators (Prince-Dormand, Adams-Bashford) and force models (atmospheric drag, solar pressure, etc.) are implemented. GMAT was selected as the primary mission design tool for NASA’s TESS space telescope mission and was used for mission design for the James Webb Space Telescope. At SDU/SDU-Galaxy we have embarked on weekly workshop-like meetings to gradually gain experience with this tool aiming to apply gained knowledge to the Århus University-led “STEP-A” space telescope mission (2025/2026) and optimal geolocation-planning of ground stations (based on predicted TLE’s) for effective Earth-spacecraft communication and data telemetry. This tool can also be used for science communication, STEM outreach activities raising awareness of space science, spacecraft control and astrodynamics. High-level key architecture components of GMAT and their interaction to solve a satellite / space- craft mission design problem. GMAT is highly complex. Each set of components are grouped into functional packages that interact with each other in the process of message passing, information exchange and data flow. The Program Interface component is the top-level interface between user input and the GMAT engine. The interaction with GMAT can either be via a GUI or at scripting level. At engine level we have the core simulation engine controlling the model of the flight dynamics problem in GMAT. Model elements are used to simulate a particular spacecraft mission. For example a model component could be an atmosphere model for Earth or Mars. We have worked out a number of worked tutorials which will be described below for their functionality and purpose. Hohmann Transfer: Going from one circular orbit to another in the same orbital plane is a common maneuver in space missions. This is used in many situations: raising LEO satellites that has degraded because of atmospheric drag, moving a satellite from LEO to GEO or even going to Mars. The Hohmann transfer is a sequence of maneuvers that can do exactly that. The transfer consists of two maneuvers: going to an elliptic orbit with apoapsis in the altitude of the desired orbit then circularize the orbit at the right altitude. Mission to Mars & Mars B-plane: This tutorial focuses on designing a mission to Mars, demonstrating GMAT functions. It starts with an outgoing hyperbolic trajectory from Earth, then performs a Trajectory Correction Maneuver (TCM) to target Mars' B-Plane. Upon approaching Mars, the tutorial adjusts the maneuver to achieve Mars Orbit Insertion (MOI) and places the spacecraft in an elliptical orbit with a 90-degree inclination. Two targeting sequences are created: First Target Sequence: This uses maneuvers in Earth-based Velocity (V), Normal (N), and Bi-normal (B) directions, comprising four propagation sequences. The maneuvers target the BdotT and BdotR c	poster
 Baboons can compensate for foraging costs of low rank  BUT only in low competition environments Rank influences foraging performance? vs   Social bonds mediate rank- related foraging aggression? vs low contribution to social bonds = circles and solid lines, high contribution = squares and dotted lines   2 x environments LOW vs HIGH Foraging Competition Social effects on individual foraging behaviour and performance depend on local environmental conditions Harry H. Marshall1,2,5, Alecia J. Carter1,3,4, Alexandra Ashford1,2, J. Marcus Rowcliffe1 & Guy Cowlishaw1 1Institute of Zoology, Zoological Society of London, U.K. 2 Division of Ecology and Evolution, Imperial College London, U.K. 3The Fenner School of Environment and Society, The Australian National University, Australia 4Current address: Department of Zoology, University of Cambridge, U.K. 5Correspondence address: Centre for Ecology and Conservation, University of Exeter, U.K. h.marshall@exeter.ac.uk Funding: Natural Environment Research Council (NERC) CASE Studentship, Fenner School of Environment and Society Studentship, Leakey Foundation, Animal Behavior Society (USA), International Primatological Society, and The Explorers Club	poster
BAR PATTERN SPEEDS IN CALIFA GALAXIES ULTRAFAST BARS OR TOO LONG BARS? ABSTRACT More than 10% of barred galaxies with a direct measurement of the bar pattern speed host an ultrafast bar. These bars challenge our understanding of the orbital structure of barred galaxies. We analyse the ultrafast bars detected in CALIFA and revise previous analysis. We found that nearly all the sample galaxies are spirals with an inner ring or pseudo-ring and/or strong spiral arms, which falsed previous measurements of bar radius: ultrafast bars are no longer observed when the correct measurement of the bar radius is adopted. V. Cuomo1, Y.H. Lee2, C. Buttitta3, J. A. L. Aguerri4,5, E.M. Corsini3,6, L. Morelli1 1Universidad de Atacama (Chile), 2Korea Astronomy and Space Science Institute (Korea), 3Università di Padova (Italy), 4Istituto de Astrofìsica de Canarias (Spain), 5Universidad de La Laguna (Spain), 6INAF-Osservatorio di Padova (Italy) INTRODUCTION During the evolution of barred galaxies, the rotation of the bar rules the redistribution of mass and angular momentum in the disc. The bar is slowed through the exchange of angular momentum: studing the bar pattern speed Ωbar becomes desiderable (Athanassoula 2003, MNRAS, 341, 1179). The bar rotation rate R=Rcr/Rbar= (Vcirc/Ωbar)/Rbar parametrises Ωbar. This is the ratio between the bar corotation Rcr and bar Rbar radii and allows to distinguish fast (1 ≤ R ≤ 1.4) from slow bars (R > 1.4, Athanassoula 1992, MNRAS, 259, 328). If R < 1 the bars are termed ultrafast (Buta & Zhang 2009, ApJS, 182, 559) but they are unstable (Contopoulos, 1981, A&A, 102, 265). The Tremaine-Weinberg method (TW, Tremaine & Weinberg 1984, ApJ, 282, L5) allows to get Ωbar. It consists in directly measuring the mean velocity and position of a tracer satisying the continuity equation, along slits parallel to the disc major axis. More than 100 galaxies have been analysed with the TW method (Cuomo et al. 2020, A&A, 641, A111): 10% of them hosts ultrafast bars. It is unclear ∼ whether they are the consequence of an erroneous measure or a new class of bars. SAMPLE: ANALYSIS AND MORPHOLOGY We considered the 31 barred galaxies from CALIFA studied with the TW method (Aguerri et al. 2015, A&A, 576, A102; Cuomo et al. 2019A&A, 632, A51): 12 of them host an ultrafast bar. We revised their morphology: most of them hosts an inner ring or pseudo-ring and/or strong spiral arms. These structures make the application of the TW method more difficult. Nevertheless, its applicability to spiral galaxies was demonstrated by both theoretical (Zou et al. 2019, ApJ, 884, 23) and observational studies involving integral-field data (Garma-Oehmichen et al. 2020, MNRAS, 491, 3655). We verified that the TW method was correcty applied to our sample galaxies. Fig. 1 (a): i-band SDSS image of NGC5406. (b): Deprojected image of the galaxy. The red and blue crosses show the peaks from QT(RQb) and QT (Rmean) azimuthal profiles. (c): Ratio map QT(r, φ). The vertical lines indicate the location of RQb (blue) and Rmean (red). (d): Radial profile of <QT>. (e): Azimuthal profile of QT (RQb) and local maxima (asterisks). (f ): Same as (e) but for QT(Rmean). Fig. 2 Comparison between Rmean and RQb. (RE)MEASURING THE BAR RADIUS The values of Rbar used to get R, Rmean, is the mean result of various photometric methods (Guo et al. 2019, MNRAS, 482, 1733). To test the reliability of Rmean, we built the map tracing the transverse-to-radial force ratio QT(r, φ) of the galaxy, following Lee et al. (2020, ApJ, 899, 84). This requires the calculation of the gravitational potential of the galaxy. In turn, it provides an independent estimate of Rbar, RQb, and allows to test whether Rmean matches the bar region. The ratio map QT(r, φ) of a barred galaxy presents four thick slabs and the corresponding peaks mark the four corners of the bar. The location of a peak or a plateau in the radial profile <QT> provides RQb. At this radius, four peaks appear in the azimuthal profile Q	poster

Subsets and Splits

No community queries yet

The top public SQL queries from the community will appear here once available.