Epitope ID stringlengths 8 35 | Epitope stringclasses 5 values | Epitope.1 stringlengths 1 829 | Epitope.2 stringlengths 2 111 ⌀ | Epitope.3 stringclasses 47 values | Epitope.4 stringlengths 1 17 ⌀ | Epitope.5 stringlengths 1 15 ⌀ | Epitope.6 stringlengths 3 43 ⌀ | Epitope.7 stringlengths 2 3.89k ⌀ | Epitope.8 stringlengths 1 433 ⌀ | Epitope.9 stringlengths 19 51 ⌀ | Epitope.10 stringlengths 1 188 ⌀ | Epitope.11 stringlengths 19 43 ⌀ | Epitope.12 stringlengths 4 95 ⌀ | Epitope.13 stringlengths 19 48 ⌀ | Epitope.14 stringlengths 4 52 ⌀ | Epitope.15 stringlengths 11 48 ⌀ | Related Object stringclasses 7 values | Related Object.1 stringclasses 11 values | Related Object.2 stringlengths 2 1.53k ⌀ | Related Object.3 stringlengths 1 17 ⌀ | Related Object.4 stringlengths 1 15 ⌀ | Related Object.5 stringclasses 81 values | Related Object.6 stringlengths 1 1.59k ⌀ | Related Object.7 stringlengths 2 286 ⌀ | Related Object.8 stringlengths 19 51 ⌀ | Related Object.9 stringlengths 3 144 ⌀ | Related Object.10 stringlengths 19 41 ⌀ | Related Object.11 stringclasses 494 values | Related Object.12 stringclasses 390 values | Related Object.13 stringclasses 251 values | Related Object.14 stringclasses 251 values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
http://www.iedb.org/epitope/505 | Linear peptide | AAVVRFQEAANKQKQ | null | null | 53 | 67 | null | null | type VII secretion protein EsxB | http://www.ncbi.nlm.nih.gov/protein/WP_072513134.1 | ESAT-6-like protein EsxB | http://www.uniprot.org/uniprot/P9WNK5 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/506 | Linear peptide | AAVVRFQEAANKQKQEL | null | null | 53 | 69 | null | null | ESAT-6-like protein esxB | http://www.ncbi.nlm.nih.gov/protein/P0A566.2 | ESAT-6-like protein EsxB | http://www.uniprot.org/uniprot/P9WNK5 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/507 | Linear peptide | AAVYNFATCGI | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | KAVYNFATCGI | 33 | 43 | null | GPC, GP-C, Segment S | Pre-glycoprotein polyprotein GP complex | https://www.uniprot.org/uniprot/P09991.1 | Pre-glycoprotein polyprotein GP complex | http://www.uniprot.org/uniprot/P09991 | Mammarenavirus choriomeningitidis (Lymphocytic choriomeningitis mammarenavirus) | http://purl.obolibrary.org/obo/NCBITaxon_3052303 | Mammarenavirus choriomeningitidis | http://purl.obolibrary.org/obo/NCBITaxon_3052303 |
http://www.iedb.org/epitope/508 | Linear peptide | AAVYNFATM | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | KAVYNFATC | 33 | 41 | null | GPC, GP-C, Segment S | Pre-glycoprotein polyprotein GP complex | https://www.uniprot.org/uniprot/P09991.1 | Pre-glycoprotein polyprotein GP complex | http://www.uniprot.org/uniprot/P09991 | Mammarenavirus choriomeningitidis (Lymphocytic choriomeningitis mammarenavirus) | http://purl.obolibrary.org/obo/NCBITaxon_3052303 | Mammarenavirus choriomeningitidis | http://purl.obolibrary.org/obo/NCBITaxon_3052303 |
http://www.iedb.org/epitope/509 | Linear peptide | AAWGGSGSEAYQGVQQ | null | null | 41 | 56 | null | null | 6 kDa early secretory antigenic target | http://www.ncbi.nlm.nih.gov/protein/P0A565.2 | 6 kDa early secretory antigenic target | http://www.uniprot.org/uniprot/P9WNK7 | Mycobacterium tuberculosis variant bovis | http://purl.obolibrary.org/obo/NCBITaxon_1765 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/510 | Linear peptide | AAWGGSGSEAYQGVQQKW | null | null | 41 | 58 | null | null | 6 kDa early secretory antigenic target | http://www.ncbi.nlm.nih.gov/protein/P0A564.2 | 6 kDa early secretory antigenic target | http://www.uniprot.org/uniprot/P9WNK7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/511 | Linear peptide | AAWGGSGSEAYQGVQQKWDA | null | null | 41 | 60 | null | null | 6 kDa early secretory antigenic target | http://www.ncbi.nlm.nih.gov/protein/P0A564.2 | 6 kDa early secretory antigenic target | http://www.uniprot.org/uniprot/P9WNK7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/512 | Linear peptide | AAWNSGTSTLTITVNSKKTK | null | null | 214 | 233 | null | null | Outer surface protein A precursor | http://www.ncbi.nlm.nih.gov/protein/P14013.1 | Outer surface protein A | http://www.uniprot.org/uniprot/P0CL66 | Borreliella burgdorferi ZS7 | http://purl.obolibrary.org/obo/NCBITaxon_445985 | Borreliella burgdorferi | http://purl.obolibrary.org/obo/NCBITaxon_139 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/513 | Linear peptide | AAWVNMPSL | null | null | 341 | 349 | null | null | kelch-like protein | http://www.ncbi.nlm.nih.gov/protein/ABZ79951.1 | Immune evasion protein OPG047 | http://www.uniprot.org/uniprot/P24357 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/514 | Linear peptide | AAYAAAAAAKAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/515 | Linear peptide | AAYAAAAAL | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/516 | Linear peptide | AAYAAAKAAALAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/517 | Linear peptide | AAYAAMATLASAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/518 | Linear peptide | AAYAAQGYKVLVLNPSVAAT | null | null | 216 | 235 | null | null | NS3 protease/helicase' | http://www.ncbi.nlm.nih.gov/protein/NP_803144.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/519 | Linear peptide | AAYARAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/520 | Linear peptide | AAYARAAAL | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/521 | Linear peptide | AAYCLSTGCV | null | null | 1671 | 1680 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA45534.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate Taiwan) | http://purl.obolibrary.org/obo/NCBITaxon_31645 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/522 | Linear peptide | AAYCLSTGCVVIVGRVVLSG | null | null | 1671 | 1690 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26664.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/523 | Linear peptide | AAYDKGIKE | null | null | 497 | 505 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/524 | Linear peptide | AAYFVGYLK | null | null | 250 | 258 | null | null | Spike glycoprotein | https://www.uniprot.org/uniprot/P59594.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/525 | Linear peptide | AAYFVGYLKPTTFMLKY | null | null | 250 | 266 | null | null | Spike glycoprotein | https://www.uniprot.org/uniprot/P59594.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/526 | Linear peptide | AAYGFRNI | null | null | 351 | 358 | null | null | nuclear prelamin A recognition factor [Mus musculus] | http://www.ncbi.nlm.nih.gov/protein/163954939 | Nuclear prelamin A recognition factor | http://www.uniprot.org/uniprot/Q9CYQ7 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/527 | Linear peptide | AAYHPQQFI | null | null | 122 | 130 | null | null | hypothetical protein | http://www.ncbi.nlm.nih.gov/protein/WP_016721285.1 | Diacylglycerol acyltransferase/mycolyltransferase Ag85B | http://www.uniprot.org/uniprot/P9WQP1 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/528 | Linear peptide | AAYHPQQFIYAGSLS | null | null | 176 | 190 | null | null | Diacylglycerol acyltransferase/mycolyltransferase Ag85B | https://www.uniprot.org/uniprot/P9WQP1.1 | Diacylglycerol acyltransferase/mycolyltransferase Ag85B | http://www.uniprot.org/uniprot/P9WQP1 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/529 | Linear peptide | AAYHPQQFIYAGSLSALL | null | null | 176 | 193 | null | null | Antigen 85-B precursor (85B) (Extracellular alpha-antigen) (Antigen 85 complex B) (Ag85B) (Mycolyl transferase 85B) (Fibronectin-binding protein B) (30 kDa extracellular protein) | http://www.ncbi.nlm.nih.gov/protein/P31952 | Diacylglycerol acyltransferase/mycolyltransferase Ag85B | http://www.uniprot.org/uniprot/P9WQP1 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/530 | Linear peptide | AAYIKLETKGSDPDTSFLEG | null | null | 330 | 349 | null | null | TprK | http://www.ncbi.nlm.nih.gov/protein/ABK06458.1 | Tpr protein K (TprK) | http://www.uniprot.org/uniprot/O83867 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/531 | Linear peptide | AAYPLLGTGI + ACET(A1) | A1 | Acetylation|ACET | 881 | 890 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/532 | Linear peptide | AAYQNPASWKNNRIW | null | null | 125 | 139 | null | null | Polygalacturonase precursor | http://www.ncbi.nlm.nih.gov/protein/P43212.1 | Cry j 2 | http://www.uniprot.org/uniprot/P43212 | Cryptomeria japonica | http://purl.obolibrary.org/obo/NCBITaxon_3369 | Cryptomeria japonica | http://purl.obolibrary.org/obo/NCBITaxon_3369 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/533 | Linear peptide | AAYRETCSRL + ACET(A1) | A1 | Acetylation|ACET | 869 | 878 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/534 | Linear peptide | AAYRSKNTI | null | null | 83 | 91 | null | null | unknown | http://www.ncbi.nlm.nih.gov/protein/AAO89437.1 | Protein OPG163 | http://www.uniprot.org/uniprot/Q01232 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/535 | Linear peptide | AAYTLTPRPI + ACET(A1) | A1 | Acetylation|ACET | 841 | 850 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/536 | Linear peptide | AAYTQAMATTPSLPEIAA | null | null | 94 | 111 | null | null | PPE FAMILY PROTEIN | http://www.ncbi.nlm.nih.gov/protein/YP_178022.1 | PPE family immunomodulator PPE68 | http://www.uniprot.org/uniprot/P9WHW9 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/537 | Linear peptide | AAYVNDLLL | null | null | 55 | 63 | null | null | Uncharacterized 8.6 kDa protein | http://www.ncbi.nlm.nih.gov/protein/P68626.1 | Uncharacterized 8.6 kDa protein | http://www.uniprot.org/uniprot/P68627 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/538 | Linear peptide | AAYVNYKRL | null | null | 31 | 39 | null | null | Protein A21 | http://www.ncbi.nlm.nih.gov/protein/P68712.1 | Virion membrane protein OPG147 | http://www.uniprot.org/uniprot/P68712 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/539 | Linear peptide | AAYYFMKFR | null | null | 3037 | 3045 | null | null | Replicase polyprotein 1ab | http://www.ncbi.nlm.nih.gov/protein/P59641.2 | Replicase polyprotein 1ab | http://www.uniprot.org/uniprot/P0C6X7 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/540 | Linear peptide | AAYYFMKFRR | null | null | 3037 | 3046 | null | null | Replicase polyprotein 1ab | http://www.ncbi.nlm.nih.gov/protein/P59641.2 | Replicase polyprotein 1ab | http://www.uniprot.org/uniprot/P0C6X7 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/541 | Linear peptide | ACAAGNSSTKNLIYNL | null | null | 31 | 46 | null | null | major structural glycoprotein GP5 | https://ontology.iedb.org/ontology/ONTIE_0002078 | Minor structural glycoprotein | http://www.uniprot.org/uniprot/Q83019 | Lactate dehydrogenase-elevating virus | http://purl.obolibrary.org/obo/NCBITaxon_11048 | Gammaarterivirus lacdeh | http://purl.obolibrary.org/obo/NCBITaxon_2499678 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/542 | Linear peptide | ACAAGNSSTKNLIYNLTLCEL | null | null | 31 | 51 | null | null | major structural glycoprotein GP5 | https://ontology.iedb.org/ontology/ONTIE_0002078 | Minor structural glycoprotein | http://www.uniprot.org/uniprot/Q83019 | Lactate dehydrogenase-elevating virus | http://purl.obolibrary.org/obo/NCBITaxon_11048 | Gammaarterivirus lacdeh | http://purl.obolibrary.org/obo/NCBITaxon_2499678 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/543 | Linear peptide | ACAAGNSSTKNLIYNLTLCELNVTGFQQHF | null | null | 31 | 60 | null | null | major structural glycoprotein | http://www.ncbi.nlm.nih.gov/protein/AAA85668.1 | Major structural glycoprotein | http://www.uniprot.org/uniprot/Q83022 | Lactate dehydrogenase elevating virus Plagemann | http://purl.obolibrary.org/obo/NCBITaxon_300016 | Gammaarterivirus lacdeh | http://purl.obolibrary.org/obo/NCBITaxon_2499678 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/544 | Linear peptide | ACADGTRHTY | null | null | 66 | 75 | null | null | Protein 7a precursor | http://www.ncbi.nlm.nih.gov/protein/P59635.1 | ORF7a protein | http://www.uniprot.org/uniprot/P59635 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/545 | Linear peptide | ACADNLTTI | null | null | 20 | 28 | null | null | S-S bond formation pathway | http://www.ncbi.nlm.nih.gov/protein/AAO89400.1 | Protein OPG128 | http://www.uniprot.org/uniprot/P07608 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/546 | Linear peptide | ACAGCRVTPG + ACET(A1) | A1 | Acetylation|ACET | 957 | 966 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/547 | Linear peptide | ACAKAAAAV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/548 | Linear peptide | ACAPDRCPPTCIYV | null | null | 313 | 326 | null | null | Nucleoprotein | http://www.ncbi.nlm.nih.gov/protein/P27313.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P27313 | Puumala virus sotkamo/v-2969/81 | http://purl.obolibrary.org/obo/NCBITaxon_39002 | Orthohantavirus puumalaense | http://purl.obolibrary.org/obo/NCBITaxon_3052493 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/549 | Linear peptide | ACCNGIRNVN | null | null | 26 | 35 | null | null | Non-specific lipid-transfer protein 1 | http://www.ncbi.nlm.nih.gov/protein/P81402.1 | Non-specific lipid-transfer protein | http://www.uniprot.org/uniprot/Q5RZZ3 | Prunus persica | http://purl.obolibrary.org/obo/NCBITaxon_3760 | Prunus persica | http://purl.obolibrary.org/obo/NCBITaxon_3760 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/550 | Linear peptide | ACCRTHDMCPDVMSAGES | null | null | 62 | 79 | null | null | Phospholipase A2 precursor | http://www.ncbi.nlm.nih.gov/protein/P00630.3 | Api m 1 | http://www.uniprot.org/uniprot/P00630 | Apis mellifera | http://purl.obolibrary.org/obo/NCBITaxon_7460 | Apis mellifera | http://purl.obolibrary.org/obo/NCBITaxon_7460 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/551 | Linear peptide | ACDPHSGHFV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | in-frame neo-epitope | Fragment of a Natural Sequence Molecule | ARDPHSGHFV | 23 | 32 | null | Cell division protein kinase 4, PSK-J3, CDK4 | Cyclin-dependent kinase 4 | https://www.uniprot.org/uniprot/P11802.2 | Cyclin-dependent kinase 4 | http://www.uniprot.org/uniprot/P11802 | Homo sapiens (human) | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 |
http://www.iedb.org/epitope/552 | Linear peptide | ACEDDKLMIY | null | null | 74 | 83 | null | null | Protein L5 | http://www.ncbi.nlm.nih.gov/protein/P68623.1 | Entry-fusion complex protein OPG094 | http://www.uniprot.org/uniprot/P68623 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/553 | Linear peptide | ACEVEPAFGHSDAAC | null | null | 431 | 445 | null | null | E2 and E1 polyprotein | http://www.ncbi.nlm.nih.gov/protein/BAA28178.1 | Structural polyprotein | http://www.uniprot.org/uniprot/P07566 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/554 | Linear peptide | ACGASNSSTKNLIKNLTLCELNVTGFQQHF | null | null | null | null | null | null | major structural glycoprotein GP5 | https://ontology.iedb.org/ontology/ONTIE_0002078 | Minor structural glycoprotein | http://www.uniprot.org/uniprot/Q83019 | Lactate dehydrogenase-elevating virus | http://purl.obolibrary.org/obo/NCBITaxon_11048 | Gammaarterivirus lacdeh | http://purl.obolibrary.org/obo/NCBITaxon_2499678 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/555 | Linear peptide | ACGDIISGL | null | null | 992 | 1000 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/BAA25076.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 1b | http://purl.obolibrary.org/obo/NCBITaxon_31647 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/556 | Linear peptide | ACGKAGCQTYKWETL | null | null | 126 | 140 | null | null | secreted antigen 85-B fbpB | http://www.ncbi.nlm.nih.gov/protein/CAL71910.1 | Diacylglycerol acyltransferase/mycolyltransferase Ag85B | http://www.uniprot.org/uniprot/P9WQP1 | Mycobacterium tuberculosis variant bovis BCG | http://purl.obolibrary.org/obo/NCBITaxon_33892 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/557 | Linear peptide | ACGKNNERV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/558 | Linear peptide | ACGVYLDKLKSVG | null | null | 782 | 794 | null | null | glycoprotein precursor | http://www.ncbi.nlm.nih.gov/protein/AAO86638.1 | Envelopment polyprotein | http://www.uniprot.org/uniprot/O55346 | Andes virus CHI-7913 | https://ontology.iedb.org/ontology/ONTIE_0000461 | Orthohantavirus andesense | http://purl.obolibrary.org/obo/NCBITaxon_1980456 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/559 | Linear peptide | ACGYKDVDKPPF | null | null | 63 | 74 | null | null | pollen allergen Phl pI | http://www.ncbi.nlm.nih.gov/protein/CAA81613.1 | Phl p 1 | http://www.uniprot.org/uniprot/Q40967 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/560 | Linear peptide | ACHFVKCPLVKGQQYDIKYTW | null | null | 89 | 109 | null | null | Der f 2 allergen | http://www.ncbi.nlm.nih.gov/protein/ABL84752.1 | Der f 2 | http://www.uniprot.org/uniprot/Q00855 | Dermatophagoides farinae | http://purl.obolibrary.org/obo/NCBITaxon_6954 | Dermatophagoides farinae | http://purl.obolibrary.org/obo/NCBITaxon_6954 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/561 | Linear peptide | ACHLPLETFTRHRQPRGWEQ | null | null | 289 | 308 | null | null | exotoxin type A | http://www.ncbi.nlm.nih.gov/protein/AAB59097.1 | Exotoxin A | http://www.uniprot.org/uniprot/P11439 | Pseudomonas aeruginosa | http://purl.obolibrary.org/obo/NCBITaxon_287 | Pseudomonas aeruginosa | http://purl.obolibrary.org/obo/NCBITaxon_287 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/562 | Linear peptide | ACHNTSKPSNTDSVFSLTGK | null | null | 24 | 43 | null | null | hypothetical protein SPy0210 | http://www.ncbi.nlm.nih.gov/protein/AAK33302.1 | Transglutaminase-like domain-containing protein | http://www.uniprot.org/uniprot/Q9A1L2 | Streptococcus pyogenes M1 GAS | http://purl.obolibrary.org/obo/NCBITaxon_160490 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/563 | Linear peptide | ACHPLFDARCGGKS | null | null | null | null | null | null | null | null | null | null | null | null | null | null | mimotope | Accession Non-Sequence Molecule | polysaccharide | null | null | http://purl.obolibrary.org/obo/CHEBI_18154 | Glycan, Glycane, glycans, Glykan, Glykane, polisacarido, polisacaridos, Polysaccharide | null | null | null | null | Burkholderia pseudomallei | http://purl.obolibrary.org/obo/NCBITaxon_28450 | Burkholderia pseudomallei | http://purl.obolibrary.org/obo/NCBITaxon_28450 |
http://www.iedb.org/epitope/564 | Linear peptide | ACIKELHDVSKGAAN | null | null | 169 | 183 | null | null | 55 kDa immediate-early protein 1 | http://www.ncbi.nlm.nih.gov/protein/P03169.1 | Immediate early protein IE1 | http://www.uniprot.org/uniprot/P13202 | Human herpesvirus 5 strain Towne | http://purl.obolibrary.org/obo/NCBITaxon_10363 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/565 | Linear peptide | ACITLGAYLGHK | null | null | 228 | 239 | null | null | Apoptosis regulator Bcl-2 | https://www.uniprot.org/uniprot/P10415.2 | Apoptosis regulator Bcl-2 | http://www.uniprot.org/uniprot/P10415 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/566 | Linear peptide | ACKCIVRATKGISGIKNELVAEVPKKC | null | null | 80 | 106 | null | null | Probable non-specific lipid-transfer protein 2 precursor | http://www.ncbi.nlm.nih.gov/protein/P55958.1 | Par j 2 | http://www.uniprot.org/uniprot/P55958 | Parietaria judaica | http://purl.obolibrary.org/obo/NCBITaxon_33127 | Parietaria judaica | http://purl.obolibrary.org/obo/NCBITaxon_33127 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/567 | Linear peptide | ACKKPSAMLLVPGNK | null | null | 85 | 99 | null | null | Polygalacturonase precursor | http://www.ncbi.nlm.nih.gov/protein/P43212.1 | Cry j 2 | http://www.uniprot.org/uniprot/P43212 | Cryptomeria japonica | http://purl.obolibrary.org/obo/NCBITaxon_3369 | Cryptomeria japonica | http://purl.obolibrary.org/obo/NCBITaxon_3369 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/568 | Linear peptide | ACKPLLREDVTFQV | null | null | 2136 | 2149 | null | null | polyprotein precursor | http://www.ncbi.nlm.nih.gov/protein/BAA01583.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 1b | http://purl.obolibrary.org/obo/NCBITaxon_31647 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/569 | Linear peptide | ACKQNVSSLDEKNSVSVD | null | null | 16 | 33 | null | null | Outer surface protein A precursor | http://www.ncbi.nlm.nih.gov/protein/P14013.1 | Outer surface protein A | http://www.uniprot.org/uniprot/P0CL66 | Borreliella burgdorferi ZS7 | http://purl.obolibrary.org/obo/NCBITaxon_445985 | Borreliella burgdorferi | http://purl.obolibrary.org/obo/NCBITaxon_139 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/570 | Linear peptide | ACKRGPGSGFFSRLN | null | null | 154 | 168 | null | null | hemagglutinin | http://www.ncbi.nlm.nih.gov/protein/ABF83447.1 | Hemagglutinin | http://www.uniprot.org/uniprot/P03452 | Influenza A virus (A/X-31(H3N2)) | http://purl.obolibrary.org/obo/NCBITaxon_132504 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/571 | Linear peptide | ACKSTQDPMFTPKGCDN | null | null | 127 | 143 | null | null | pilin | http://www.ncbi.nlm.nih.gov/protein/BAD90120.1 | Type IV major pilin protein PilA | http://www.uniprot.org/uniprot/P04739 | Pseudomonas aeruginosa PAO | https://ontology.iedb.org/ontology/ONTIE_0000716 | Pseudomonas aeruginosa | http://purl.obolibrary.org/obo/NCBITaxon_287 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/572 | Linear peptide | ACKYGSLKPNCG | null | null | 39 | 50 | null | null | Venom allergen 5 precursor | http://www.ncbi.nlm.nih.gov/protein/Q05110.1 | Venom allergen 5 | http://www.uniprot.org/uniprot/A0A834K244 | Vespula vulgaris | http://purl.obolibrary.org/obo/NCBITaxon_7454 | Vespula vulgaris | http://purl.obolibrary.org/obo/NCBITaxon_7454 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/573 | Linear peptide | ACLENEELI | null | null | 25 | 33 | null | null | paraflagellar rod protein 3, putative | http://www.ncbi.nlm.nih.gov/protein/EAN87979.1 | Paraflagellar rod protein 3, putative | http://www.uniprot.org/uniprot/Q4D634 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/574 | Linear peptide | ACLFQPLMFINGSLTVRGVP | null | null | 265 | 284 | null | null | Alpha trans-inducing protein | http://www.ncbi.nlm.nih.gov/protein/P68336.1 | Tegument protein VP16 | http://www.uniprot.org/uniprot/P68336 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/575 | Linear peptide | ACLMFKHL | null | null | 274 | 281 | null | null | Ribonucleoside-diphosphate reductase subunit M2 | http://www.ncbi.nlm.nih.gov/protein/P11157.1 | Ribonucleoside-diphosphate reductase subunit M2 | http://www.uniprot.org/uniprot/P11157 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/576 | Linear peptide | ACLSLCQIGPERAPSR | null | null | 181 | 196 | null | null | Major surface glycoprotein G (Attachment glycoprotein G) | http://www.ncbi.nlm.nih.gov/protein/O10686.1 | Major surface glycoprotein G | http://www.uniprot.org/uniprot/P62648 | Bovine respiratory syncytial virus strain snook | http://purl.obolibrary.org/obo/NCBITaxon_82824 | Orthopneumovirus bovis | http://purl.obolibrary.org/obo/NCBITaxon_3050248 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/577 | Linear peptide | ACLSPQAYQQGVTVDSIGML | null | null | 226 | 245 | null | null | glycoprotein D | http://www.ncbi.nlm.nih.gov/protein/AAB59754.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69091 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/578 | Linear peptide | ACMDGFEVV | null | null | 260 | 268 | null | null | Adenosylhomocysteinase | http://www.ncbi.nlm.nih.gov/protein/Q9I685.1 | Adenosylhomocysteinase | http://www.uniprot.org/uniprot/Q9I685 | Pseudomonas aeruginosa | http://purl.obolibrary.org/obo/NCBITaxon_287 | Pseudomonas aeruginosa | http://purl.obolibrary.org/obo/NCBITaxon_287 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/579 | Linear peptide | ACMMTMYGGISLLSE | null | null | 293 | 307 | null | null | regulatory protein IE1 [Human betaherpesvirus 5] | http://www.ncbi.nlm.nih.gov/protein/AKI26103.1 | Immediate early protein IE1 | http://www.uniprot.org/uniprot/P13202 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/580 | Linear peptide | ACNENMETM | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | ASNENMETM | 366 | 374 | null | NP | Nucleoprotein | https://ontology.iedb.org/ontology/ONTIE_0002033 | Nucleoprotein | http://www.uniprot.org/uniprot/P03466 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 |
http://www.iedb.org/epitope/581 | Linear peptide | ACNKIKGKK | null | null | 332 | 340 | null | null | L protein | http://www.ncbi.nlm.nih.gov/protein/AAQ55254.1 | RNA-directed RNA polymerase L | http://www.uniprot.org/uniprot/Q6UY70 | Mammarenavirus guanaritoense | http://purl.obolibrary.org/obo/NCBITaxon_3052307 | Mammarenavirus guanaritoense | http://purl.obolibrary.org/obo/NCBITaxon_3052307 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/582 | Linear peptide | ACNTIGGYECGGGS | null | null | null | null | null | null | null | null | null | null | null | null | null | null | mimotope | Accession Non-Sequence Molecule | lipooligosaccharide | null | null | http://purl.obolibrary.org/obo/CHEBI_35371 | lipooligosaccharides, LOS | null | null | null | null | Neisseria meningitidis | http://purl.obolibrary.org/obo/NCBITaxon_487 | Neisseria meningitidis | http://purl.obolibrary.org/obo/NCBITaxon_487 |
http://www.iedb.org/epitope/583 | Linear peptide | ACNVSRLKINRKDYTGIYQV | null | null | 311 | 330 | null | null | Env | http://www.ncbi.nlm.nih.gov/protein/AAC03762.1 | Envelope glycoprotein | http://www.uniprot.org/uniprot/P32541 | Equine infectious anemia virus | http://purl.obolibrary.org/obo/NCBITaxon_11665 | Equine infectious anemia virus | http://purl.obolibrary.org/obo/NCBITaxon_11665 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/584 | Linear peptide | ACNWTRGERCDLEDRDRS | null | null | 643 | 660 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26664.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate 1) | http://purl.obolibrary.org/obo/NCBITaxon_11104 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/585 | Linear peptide | ACNWTRGERCNLDDRDRSEL | null | null | 644 | 663 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/BAA02670.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus genotype 2 | http://purl.obolibrary.org/obo/NCBITaxon_40271 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/586 | Linear peptide | ACPIRTQPRWNYYDS | null | null | 151 | 165 | null | null | glycoprotein D | http://www.ncbi.nlm.nih.gov/protein/ABM66847.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69091 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/587 | Linear peptide | ACQGVGGPGHKARVLA | null | null | 351 | 366 | null | null | Gag polyprotein | http://www.ncbi.nlm.nih.gov/protein/P03349.3 | Gag polyprotein | http://www.uniprot.org/uniprot/P04591 | HIV-1 M:B_ARV2/SF2 | http://purl.obolibrary.org/obo/NCBITaxon_11685 | Human immunodeficiency virus 1 | http://purl.obolibrary.org/obo/NCBITaxon_11676 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/588 | Linear peptide | ACQRQKKVTFDRLQV | null | null | 2465 | 2479 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/589 | Linear peptide | ACRAAK | null | null | 2721 | 2726 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26663.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 1b | http://purl.obolibrary.org/obo/NCBITaxon_31647 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/590 | Linear peptide | ACRCGRFQK | null | null | 460 | 468 | null | null | Glycoprotein | http://www.ncbi.nlm.nih.gov/protein/Q8AYW1.1 | Pre-glycoprotein polyprotein GP complex | http://www.uniprot.org/uniprot/Q8AYW1 | Mammarenavirus guanaritoense | http://purl.obolibrary.org/obo/NCBITaxon_3052307 | Mammarenavirus guanaritoense | http://purl.obolibrary.org/obo/NCBITaxon_3052307 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/591 | Linear peptide | ACREQQLPV | null | null | 21 | 29 | null | null | Phosphoribosylformylglycinamidine synthase | http://www.ncbi.nlm.nih.gov/protein/Q9KTN2.1 | Phosphoribosylformylglycinamidine synthase | http://www.uniprot.org/uniprot/Q9KTN2 | Vibrio cholerae | http://purl.obolibrary.org/obo/NCBITaxon_666 | Vibrio cholerae | http://purl.obolibrary.org/obo/NCBITaxon_666 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/592 | Linear peptide | ACRVKHDSMAEPKTVY | null | null | 99 | 114 | null | null | Beta-2-microglobulin precursor | http://www.ncbi.nlm.nih.gov/protein/P01887.1 | Beta-2-microglobulin | http://www.uniprot.org/uniprot/P01887 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/593 | Linear peptide | ACRVNHVTLSQPKIVK | null | null | 99 | 114 | null | null | Beta-2-microglobulin | https://www.uniprot.org/uniprot/P61769.1 | Beta-2-microglobulin | http://www.uniprot.org/uniprot/P61769 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/594 | Linear peptide | ACSANNSHHYI | null | null | 91 | 101 | null | null | Pre-glycoprotein polyprotein GP complex | https://www.uniprot.org/uniprot/P09991.1 | Pre-glycoprotein polyprotein GP complex | http://www.uniprot.org/uniprot/P09991 | Lymphocytic choriomeningitis virus (strain Armstrong) | http://purl.obolibrary.org/obo/NCBITaxon_11624 | Mammarenavirus choriomeningitidis | http://purl.obolibrary.org/obo/NCBITaxon_3052303 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/595 | Linear peptide | ACSFSSIP | null | null | 18 | 25 | null | null | lipoprotein, 15 kDa (tpp15) | http://www.ncbi.nlm.nih.gov/protein/NP_218610.1 | 15 kDa lipoprotein | http://www.uniprot.org/uniprot/P16055 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/596 | Linear peptide | ACSFSSIPNG | null | null | 18 | 27 | null | null | lipoprotein, 15 kDa (tpp15) | http://www.ncbi.nlm.nih.gov/protein/NP_218610.1 | 15 kDa lipoprotein | http://www.uniprot.org/uniprot/P16055 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/597 | Linear peptide | ACSGEPVVVHIT | null | null | 105 | 116 | null | null | Pollen allergen Phl p 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P43213.1 | Phl p 1 | http://www.uniprot.org/uniprot/Q40967 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/598 | Linear peptide | ACSHEGKSSFYRNLL | null | null | 151 | 165 | null | null | Hemagglutinin HA | http://www.ncbi.nlm.nih.gov/protein/Q8JUU5 | Hemagglutinin | http://www.uniprot.org/uniprot/P03452 | Influenza A virus (A/Puerto Rico/8/34/Mount Sinai(H1N1)) | http://purl.obolibrary.org/obo/NCBITaxon_183764 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/599 | Linear peptide | ACSLPEEAHTAIHS | null | null | 2684 | 2697 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26660.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 2a | http://purl.obolibrary.org/obo/NCBITaxon_31649 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/600 | Linear peptide | ACSLPQEARTAIHS | null | null | 4 | 17 | null | null | nonstructural protein 5 | http://www.ncbi.nlm.nih.gov/protein/AAA45665.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 2b | http://purl.obolibrary.org/obo/NCBITaxon_31650 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/601 | Linear peptide | ACTAGVMTRGRLKAE | null | null | 435 | 449 | null | null | 64 kDa lower matrix phosphoprotein | http://www.ncbi.nlm.nih.gov/protein/P18139.2 | 65 kDa phosphoprotein | http://www.uniprot.org/uniprot/P06725 | Human herpesvirus 5 strain Towne | http://purl.obolibrary.org/obo/NCBITaxon_10363 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/602 | Linear peptide | ACTFWAVNAYSSGGY | null | null | 396 | 410 | null | null | E2 and E1 polyprotein | http://www.ncbi.nlm.nih.gov/protein/BAA28178.1 | Structural polyprotein | http://www.uniprot.org/uniprot/P07566 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/603 | Linear peptide | ACTSGVMTRGRLKAE | null | null | 445 | 459 | null | null | 65 kDa lower matrix phosphoprotein | http://www.ncbi.nlm.nih.gov/protein/P06725.2 | 65 kDa phosphoprotein | http://www.uniprot.org/uniprot/P06725 | Human herpesvirus 5 strain AD169 | http://purl.obolibrary.org/obo/NCBITaxon_10360 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/604 | Linear peptide | ACTTANGG | null | null | 21 | 28 | null | null | trypomastigote small surface antigen | http://www.ncbi.nlm.nih.gov/protein/AAQ73321.1 | Mucin TcMUCII, putative | http://www.uniprot.org/uniprot/Q4D3H3 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.