Epitope ID stringlengths 8 35 | Epitope stringclasses 5 values | Epitope.1 stringlengths 1 829 | Epitope.2 stringlengths 2 111 ⌀ | Epitope.3 stringclasses 47 values | Epitope.4 stringlengths 1 17 ⌀ | Epitope.5 stringlengths 1 15 ⌀ | Epitope.6 stringlengths 3 43 ⌀ | Epitope.7 stringlengths 2 3.89k ⌀ | Epitope.8 stringlengths 1 433 ⌀ | Epitope.9 stringlengths 19 51 ⌀ | Epitope.10 stringlengths 1 188 ⌀ | Epitope.11 stringlengths 19 43 ⌀ | Epitope.12 stringlengths 4 95 ⌀ | Epitope.13 stringlengths 19 48 ⌀ | Epitope.14 stringlengths 4 52 ⌀ | Epitope.15 stringlengths 11 48 ⌀ | Related Object stringclasses 7 values | Related Object.1 stringclasses 11 values | Related Object.2 stringlengths 2 1.53k ⌀ | Related Object.3 stringlengths 1 17 ⌀ | Related Object.4 stringlengths 1 15 ⌀ | Related Object.5 stringclasses 81 values | Related Object.6 stringlengths 1 1.59k ⌀ | Related Object.7 stringlengths 2 286 ⌀ | Related Object.8 stringlengths 19 51 ⌀ | Related Object.9 stringlengths 3 144 ⌀ | Related Object.10 stringlengths 19 41 ⌀ | Related Object.11 stringclasses 494 values | Related Object.12 stringclasses 390 values | Related Object.13 stringclasses 251 values | Related Object.14 stringclasses 251 values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
http://www.iedb.org/epitope/705 | Linear peptide | ADLEVVTSTWVLVGGVLAAL | null | null | 1651 | 1670 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/706 | Linear peptide | ADLFNAQPGL | null | null | 429 | 438 | null | null | Nucleoprotein | http://www.ncbi.nlm.nih.gov/protein/P09992.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P09992 | Lymphocytic choriomeningitis virus (strain Armstrong) | http://purl.obolibrary.org/obo/NCBITaxon_11624 | Mammarenavirus choriomeningitidis | http://purl.obolibrary.org/obo/NCBITaxon_3052303 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/707 | Linear peptide | ADLGDFENSAAAAETGVGVIKSIA | null | null | 145 | 168 | null | null | pilus protein TcpA | http://www.ncbi.nlm.nih.gov/protein/AAL83643.1 | Toxin coregulated pilin | http://www.uniprot.org/uniprot/Q60153 | Vibrio cholerae | http://purl.obolibrary.org/obo/NCBITaxon_666 | Vibrio cholerae | http://purl.obolibrary.org/obo/NCBITaxon_666 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/708 | Linear peptide | ADLGDFETSVADAATGAGVIKSIA | null | null | 170 | 193 | null | null | Toxin coregulated pilin precursor | http://www.ncbi.nlm.nih.gov/protein/Q60153.1 | Toxin coregulated pilin | http://www.uniprot.org/uniprot/Q60153 | Vibrio cholerae O1 biovar El Tor | http://purl.obolibrary.org/obo/NCBITaxon_686 | Vibrio cholerae | http://purl.obolibrary.org/obo/NCBITaxon_666 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/709 | Linear peptide | ADLIAAQKLASKP | null | null | 66 | 78 | null | null | Nucleocapsid protein | http://www.ncbi.nlm.nih.gov/protein/Q89462 | Nucleoprotein | http://www.uniprot.org/uniprot/Q89462 | Sin Nombre virus NM H10 | https://ontology.iedb.org/ontology/ONTIE_0000452 | Orthohantavirus sinnombreense | http://purl.obolibrary.org/obo/NCBITaxon_3052499 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/710 | Linear peptide | ADLIAYLKQASAK | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | ADLIAYLKQATAK | 93 | 105 | null | CYC, CYCS | Cytochrome c | http://www.ncbi.nlm.nih.gov/protein/P00021.2 | Cytochrome c-like | http://www.uniprot.org/uniprot/A0A2I0MQ77 | Columba livia (carrier pigeon) | http://purl.obolibrary.org/obo/NCBITaxon_8932 | Columba livia | http://purl.obolibrary.org/obo/NCBITaxon_8932 |
http://www.iedb.org/epitope/711 | Linear peptide | ADLIAYLKQATAK | null | null | 93 | 105 | null | null | Cytochrome c | http://www.ncbi.nlm.nih.gov/protein/P00021.2 | Cytochrome c-like | http://www.uniprot.org/uniprot/A0A2I0MQ77 | Columba livia | http://purl.obolibrary.org/obo/NCBITaxon_8932 | Columba livia | http://purl.obolibrary.org/obo/NCBITaxon_8932 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/712 | Linear peptide | ADLIAYLKQATK | null | null | 97 | 108 | null | null | Cytochrome c | http://www.ncbi.nlm.nih.gov/protein/P00039.2 | Cytochrome c domain-containing protein | http://www.uniprot.org/uniprot/A0A921YQ32 | Manduca sexta | http://purl.obolibrary.org/obo/NCBITaxon_7130 | Manduca sexta | http://purl.obolibrary.org/obo/NCBITaxon_7130 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/713 | Linear peptide | ADLKHRVR | null | null | 153 | 160 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/714 | Linear peptide | ADLKSTQAAIDQING | null | null | 381 | 395 | null | null | hemagglutinin | http://www.ncbi.nlm.nih.gov/protein/ACU79926.1 | Hemagglutinin | http://www.uniprot.org/uniprot/P03452 | Influenza A virus (A/X-31(H3N2)) A/X-31 X HK | https://ontology.iedb.org/ontology/ONTIE_0001485 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/715 | Linear peptide | ADLMGYIPL | null | null | 131 | 139 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26664.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate 1) | http://purl.obolibrary.org/obo/NCBITaxon_11104 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/716 | Linear peptide | ADLMGYIPLV | null | null | 131 | 140 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/BAB18806.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/717 | Linear peptide | ADLMGYIPLVGAPLGGAARA | null | null | 131 | 150 | null | null | core protein | http://www.ncbi.nlm.nih.gov/protein/AAS15195.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate H) | http://purl.obolibrary.org/obo/NCBITaxon_11108 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/718 | Linear peptide | ADLMGYLPL | null | null | 131 | 139 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/CAB53095.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/719 | Linear peptide | ADLMGYPLV | null | null | null | null | null | null | Genome polyprotein | https://ontology.iedb.org/ontology/ONTIE_0002561 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/720 | Linear peptide | ADLPQP | null | null | 114 | 119 | null | null | Structural protein 1 | http://www.ncbi.nlm.nih.gov/protein/Q03499.1 | Protein ORF3 | http://www.uniprot.org/uniprot/Q81870 | Hepatitis E virus (strain Mexico) | http://purl.obolibrary.org/obo/NCBITaxon_31768 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/721 | Linear peptide | ADLRFASEF | null | null | 97 | 105 | null | null | Putative transport protein | http://www.ncbi.nlm.nih.gov/protein/Q8X7T0 | Putative electron transfer flavoprotein subunit YgcR | http://www.uniprot.org/uniprot/Q46908 | Escherichia coli O157:H7 | http://purl.obolibrary.org/obo/NCBITaxon_83334 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/722 | Linear peptide | ADLTNLKEL | null | null | 5 | 13 | null | null | Protein A20 | http://www.ncbi.nlm.nih.gov/protein/P68710.1 | DNA polymerase processivity factor component OPG148 | http://www.uniprot.org/uniprot/P68710 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/723 | Linear peptide | ADLVAAQKLATKP | null | null | 66 | 78 | null | null | nucleoprotein | http://www.ncbi.nlm.nih.gov/protein/AAO86636.1 | Nucleoprotein | http://www.uniprot.org/uniprot/Q8QRM9 | Andes virus CHI-7913 | https://ontology.iedb.org/ontology/ONTIE_0000461 | Orthohantavirus andesense | http://purl.obolibrary.org/obo/NCBITaxon_1980456 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/724 | Linear peptide | ADLVGFLLLK | null | null | 107 | 116 | null | null | Melanoma-associated antigen 1 | https://www.uniprot.org/uniprot/P43355.1 | Melanoma-associated antigen 1 | http://www.uniprot.org/uniprot/P43355 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/725 | Linear peptide | ADLVLWSPA | null | null | 432 | 440 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/726 | Linear peptide | ADLVPTATLLDTY | null | null | 278 | 290 | null | null | Mce-family protein Mce2A | https://www.uniprot.org/uniprot/Q79FY7.1 | Mce-family protein Mce2A | http://www.uniprot.org/uniprot/Q79FY7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/727 | Linear peptide | ADMIMHTPGC | null | null | 217 | 226 | null | null | structural protein | http://www.ncbi.nlm.nih.gov/protein/BAA00706.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus isolate HC-J4 | http://purl.obolibrary.org/obo/NCBITaxon_420174 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/728 | Linear peptide | ADMIMHTPGCVPCVR | null | null | 217 | 231 | null | null | structural region | http://www.ncbi.nlm.nih.gov/protein/AAA20154.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/729 | Linear peptide | ADMSIGVTV | null | null | 521 | 529 | null | null | RNA-directed RNA polymerase catalytic subunit | http://www.ncbi.nlm.nih.gov/protein/P21426.1 | RNA-directed RNA polymerase catalytic subunit | http://www.uniprot.org/uniprot/P03431 | Influenza A virus (A/Ann Arbor/6/1960(H2N2)) | http://purl.obolibrary.org/obo/NCBITaxon_384498 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/730 | Linear peptide | ADMSIGVTVI | null | null | 521 | 530 | null | null | RNA-directed RNA polymerase catalytic subunit | http://www.ncbi.nlm.nih.gov/protein/P21426.1 | RNA-directed RNA polymerase catalytic subunit | http://www.uniprot.org/uniprot/P03431 | Influenza A virus (A/Ann Arbor/6/1960(H2N2)) | http://purl.obolibrary.org/obo/NCBITaxon_384498 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/731 | Linear peptide | ADNDKNSY | null | null | 452 | 459 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/732 | Linear peptide | ADNEEGKK | null | null | 296 | 303 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/733 | Linear peptide | ADNENMETM | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | ASNENMETM | 366 | 374 | null | NP | Nucleoprotein | https://ontology.iedb.org/ontology/ONTIE_0002033 | Nucleoprotein | http://www.uniprot.org/uniprot/P03466 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 |
http://www.iedb.org/epitope/734 | Linear peptide | ADNESKKIA | null | null | 206 | 214 | null | null | Urease subunit alpha | http://www.ncbi.nlm.nih.gov/protein/P14916.2 | Urease subunit alpha | http://www.uniprot.org/uniprot/P14916 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/735 | Linear peptide | ADNLWVTVY | null | null | 30 | 38 | null | null | Envelope glycoprotein gp160 precursor | http://www.ncbi.nlm.nih.gov/protein/P04581.1 | Envelope glycoprotein gp160 | http://www.uniprot.org/uniprot/P04578 | Human immunodeficiency virus type 1 (ELI ISOLATE) | http://purl.obolibrary.org/obo/NCBITaxon_11689 | Human immunodeficiency virus 1 | http://purl.obolibrary.org/obo/NCBITaxon_11676 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/736 | Linear peptide | ADNNKLVLLMELPGFSSTDINVECGWGELI | null | null | 73 | 102 | null | null | small heat shock protein | http://www.ncbi.nlm.nih.gov/protein/AAK11624.1 | Small heat shock protein | http://www.uniprot.org/uniprot/A7ATV2 | Babesia bovis Mexico Mo7 | https://ontology.iedb.org/ontology/ONTIE_0000292 | Babesia bovis | http://purl.obolibrary.org/obo/NCBITaxon_5865 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/737 | Linear peptide | ADNQIYIAGHPAFVN | null | null | 136 | 150 | null | null | heterogeneous nuclear ribonucleoprotein L, isoform CRA_b, partial [Mus musculus] | http://www.ncbi.nlm.nih.gov/protein/148692162 | Heterogeneous nuclear ribonucleoprotein L | http://www.uniprot.org/uniprot/Q8R081 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/738 | Linear peptide | ADNVIVQNSMRIS | null | null | 577 | 589 | null | null | glycoprotein B precursor - human herpesvirus 1 (strain KOS) | http://www.ncbi.nlm.nih.gov/protein/VGBEK1 | Envelope glycoprotein B | http://www.uniprot.org/uniprot/P10211 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/739 | Linear peptide | ADPEYRKHLEVFHKILTNTD | null | null | 15 | 34 | null | null | glycophorin binding protein | http://www.ncbi.nlm.nih.gov/protein/AAF21764.1 | Glycophorin-binding protein 130 | http://www.uniprot.org/uniprot/Q8I6U8 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/740 | Linear peptide | ADPNAGRIPNSYVLPAGWVESDASHLDY | null | null | 130 | 157 | null | null | fibronectin attachment protein | http://www.ncbi.nlm.nih.gov/protein/AAB50543.1 | Alanine and proline-rich secreted protein Apa | http://www.uniprot.org/uniprot/I3NIE1 | Mycobacterium avium | http://purl.obolibrary.org/obo/NCBITaxon_1764 | Mycobacterium avium | http://purl.obolibrary.org/obo/NCBITaxon_1764 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/741 | Linear peptide | ADPNRFRGKD | null | null | 37 | 46 | null | null | glycoprotein D | http://www.ncbi.nlm.nih.gov/protein/ABM66847.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69091 | Human alphaherpesvirus 1 strain KOS | http://purl.obolibrary.org/obo/NCBITaxon_10306 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/742 | Linear peptide | ADPNRFRGKNLP | null | null | 37 | 48 | null | null | Glycoprotein D precursor | http://www.ncbi.nlm.nih.gov/protein/P03172.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69467 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/743 | Linear peptide | ADPNRFRGKNLPVLD | null | null | 37 | 51 | null | null | virion glycoprotein D | http://www.ncbi.nlm.nih.gov/protein/CAB06713.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69467 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/744 | Linear peptide | ADPPFS | null | null | 202 | 207 | null | null | Large delta antigen (p27) (HDAg-L) | http://www.ncbi.nlm.nih.gov/protein/P25989.1 | Large delta antigen | http://www.uniprot.org/uniprot/P29996 | Hepatitis delta virus | http://purl.obolibrary.org/obo/NCBITaxon_12475 | Hepatitis delta virus | http://purl.obolibrary.org/obo/NCBITaxon_12475 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/745 | Linear peptide | ADPQKQNSVSNDSVTINVYN | null | null | null | null | null | null | M protein | https://ontology.iedb.org/ontology/ONTIE_0002893 | M protein type 1 | http://www.uniprot.org/uniprot/Q99XV0 | Streptococcus pyogenes serotype M13 | https://ontology.iedb.org/ontology/ONTIE_0000688 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/746 | Linear peptide | ADPSIMAK | null | null | 45 | 52 | null | null | Globin CTT-III precursor | http://www.ncbi.nlm.nih.gov/protein/P02229.2 | Chi t 1 | http://www.uniprot.org/uniprot/P02229 | Chironomus thummi thummi | http://purl.obolibrary.org/obo/NCBITaxon_7155 | Chironomus thummi | http://purl.obolibrary.org/obo/NCBITaxon_7154 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/747 | Linear peptide | ADPSIMAKFTQFAGKDLESIK | null | null | 45 | 65 | null | null | Globin CTT-III precursor | http://www.ncbi.nlm.nih.gov/protein/P02229.2 | Chi t 1 | http://www.uniprot.org/uniprot/P02229 | Chironomus thummi thummi | http://purl.obolibrary.org/obo/NCBITaxon_7155 | Chironomus thummi | http://purl.obolibrary.org/obo/NCBITaxon_7154 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/748 | Linear peptide | ADPVKVTRSALQNAA | null | null | 491 | 505 | null | null | 60 kDa chaperonin 2 | http://www.ncbi.nlm.nih.gov/protein/P0A520.2 | Chaperonin GroEL 2 | http://www.uniprot.org/uniprot/P9WPE7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/749 | Linear peptide | ADPVKVTRSALQNAASIAGL | null | null | 491 | 510 | null | null | 60 KDA CHAPERONIN 2 GROEL2 (PROTEIN CPN60-2) (GROEL PROTEIN 2) (65 KDA ANTIGEN) (HEAT SHOCK PROTEIN 65) (CELL WALL PROTEIN A) (ANTIGEN A) | http://www.ncbi.nlm.nih.gov/protein/CAA17397.1 | Chaperonin GroEL 2 | http://www.uniprot.org/uniprot/P9WPE7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/750 | Linear peptide | ADPVPL | null | null | 423 | 428 | null | null | DNA polymerase processivity factor | https://www.uniprot.org/uniprot/P10226.1 | DNA polymerase processivity factor | http://www.uniprot.org/uniprot/P10226 | Human alphaherpesvirus 1 strain 17 | http://purl.obolibrary.org/obo/NCBITaxon_10299 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/751 | Linear peptide | ADPVTTEGDYVVKISEFYGR | null | null | null | null | null | null | Major allergen Alt a 1 | https://ontology.iedb.org/ontology/ONTIE_0002456 | null | null | Alternaria alternata | http://purl.obolibrary.org/obo/NCBITaxon_5599 | Alternaria alternata | http://purl.obolibrary.org/obo/NCBITaxon_5599 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/752 | Linear peptide | ADQAQYNQMH | null | null | 125 | 134 | null | null | Flagellar filament 41 kDa core protein | https://www.uniprot.org/uniprot/P11089.1 | Flagellar filament 41 kDa core protein | http://www.uniprot.org/uniprot/P11089 | Borreliella burgdorferi B31 | http://purl.obolibrary.org/obo/NCBITaxon_224326 | Borreliella burgdorferi | http://purl.obolibrary.org/obo/NCBITaxon_139 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/753 | Linear peptide | ADQIEAGAI | null | null | 208 | 216 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/754 | Linear peptide | ADQKSTQNAI | null | null | 379 | 388 | null | null | Hemagglutinin precursor | http://www.ncbi.nlm.nih.gov/protein/P03454.1 | Hemagglutinin | http://www.uniprot.org/uniprot/P03452 | Influenza A virus (A/Wilson-Smith/1933(H1N1)) | http://purl.obolibrary.org/obo/NCBITaxon_381518 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/755 | Linear peptide | ADQLPNVG | null | null | 167 | 174 | null | null | major outer membrane protein | http://www.ncbi.nlm.nih.gov/protein/1616229A | null | null | Chlamydia psittaci | http://purl.obolibrary.org/obo/NCBITaxon_83554 | Chlamydia psittaci | http://purl.obolibrary.org/obo/NCBITaxon_83554 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/756 | Linear peptide | ADQSLPPNF | null | null | 215 | 223 | null | null | Polymerase acidic protein | http://www.ncbi.nlm.nih.gov/protein/P21427.1 | Polymerase acidic protein | http://www.uniprot.org/uniprot/P03433 | Influenza A virus (A/Ann Arbor/6/1960(H2N2)) | http://purl.obolibrary.org/obo/NCBITaxon_384498 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/757 | Linear peptide | ADQTVEEHIGYLVKY | null | null | 46 | 60 | null | null | amoebapore-like protein | http://www.ncbi.nlm.nih.gov/protein/AAF88069.1 | FHAP protein | http://www.uniprot.org/uniprot/A0A4E0R033 | Fasciola hepatica | http://purl.obolibrary.org/obo/NCBITaxon_6192 | Fasciola hepatica | http://purl.obolibrary.org/obo/NCBITaxon_6192 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/758 | Linear peptide | ADRATFIVDPNNEIQ | null | null | 131 | 145 | null | null | AhpC | http://www.ncbi.nlm.nih.gov/protein/AAS03906.1 | AhpC | http://www.uniprot.org/uniprot/Q73ZL3 | Mycobacterium avium subsp. paratuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1770 | Mycobacterium avium | http://purl.obolibrary.org/obo/NCBITaxon_1764 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/759 | Linear peptide | ADREYCKYTVCTYPG | null | null | null | null | null | null | null | null | null | null | null | null | null | null | mimotope | Organism | Murine hepatitis virus strain A59 (Murine coronavirus mhv (STRAIN A59)) | null | null | null | null | null | null | null | null | Murine hepatitis virus strain A59 (Murine coronavirus mhv (STRAIN A59)) | null | null | null |
http://www.iedb.org/epitope/760 | Linear peptide | ADRGLLRDI | null | null | 263 | 271 | null | null | Nucleoprotein | http://www.ncbi.nlm.nih.gov/protein/P11102.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P04665 | Influenza B virus (B/Ann Arbor/1/1986) | http://purl.obolibrary.org/obo/NCBITaxon_11521 | Influenza B virus | http://purl.obolibrary.org/obo/NCBITaxon_11520 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/761 | Linear peptide | ADRGSIQIEI | null | null | 105 | 114 | null | null | Flagellar filament 41 kDa core protein | https://www.uniprot.org/uniprot/P11089.1 | Flagellar filament 41 kDa core protein | http://www.uniprot.org/uniprot/P11089 | Borreliella burgdorferi B31 | http://purl.obolibrary.org/obo/NCBITaxon_224326 | Borreliella burgdorferi | http://purl.obolibrary.org/obo/NCBITaxon_139 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/762 | Linear peptide | ADRPRAWRL | null | null | 74 | 82 | null | null | hypothetical protein BWRF1 | http://www.ncbi.nlm.nih.gov/protein/CAD53394.1 | BWRF1 | http://www.uniprot.org/uniprot/Q8AZK8 | human gammaherpesvirus 4 | http://purl.obolibrary.org/obo/NCBITaxon_10376 | human gammaherpesvirus 4 | http://purl.obolibrary.org/obo/NCBITaxon_10376 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/763 | Linear peptide | ADRQTACNCLKNLAG | null | null | 66 | 80 | null | null | Non-specific lipid-transfer protein precursor (LTP) (Allergen Mal d 3) | http://www.ncbi.nlm.nih.gov/protein/Q9M5X7.1 | Non-specific lipid-transfer protein | http://www.uniprot.org/uniprot/A0A498IFJ8 | Malus domestica | http://purl.obolibrary.org/obo/NCBITaxon_3750 | Malus domestica | http://purl.obolibrary.org/obo/NCBITaxon_3750 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/764 | Linear peptide | ADRTLVYLL | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/765 | Linear peptide | ADRTYCFDGF + ACET(A1) | A1 | Acetylation|ACET | 141 | 150 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/766 | Linear peptide | ADRYFTYEEPND | null | null | 127 | 138 | null | null | Nucleoprotein (Nucleocapsid protein) (Protein N) (NP) | http://www.ncbi.nlm.nih.gov/protein/Q03332.1 | Nucleoprotein | http://www.uniprot.org/uniprot/Q03332 | Rinderpest virus (strain RBOK) | http://purl.obolibrary.org/obo/NCBITaxon_36409 | Rinderpest morbillivirus | http://purl.obolibrary.org/obo/NCBITaxon_11241 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/767 | Linear peptide | ADSAGLDNKFYLTCD | null | null | 296 | 310 | null | null | attachment protein | http://www.ncbi.nlm.nih.gov/protein/AAW02827.1 | Attachment protein | http://www.uniprot.org/uniprot/Q5MKM3 | Pneumonia virus of mice J3666 | http://purl.obolibrary.org/obo/NCBITaxon_270473 | Orthopneumovirus muris | http://purl.obolibrary.org/obo/NCBITaxon_3050329 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/768 | Linear peptide | ADSAQDST | null | null | null | null | null | null | null | null | null | null | null | null | null | null | mimotope | Accession Sequence Molecule | large surface antigen | null | null | null | PreS1, PreS1 | null | null | Large envelope protein | http://www.uniprot.org/uniprot/Q76R62 | Hepatitis B virus (Human hepatitis B virus) | null | null | null |
http://www.iedb.org/epitope/769 | Linear peptide | ADSGYCYWVHILCYC | null | null | 46 | 60 | null | null | Ts IV alpha-toxin precursor | http://www.ncbi.nlm.nih.gov/protein/AAB30413.1 | Alpha-mammal toxin Ts3 | http://www.uniprot.org/uniprot/P01496 | Tityus serrulatus | http://purl.obolibrary.org/obo/NCBITaxon_6887 | Tityus serrulatus | http://purl.obolibrary.org/obo/NCBITaxon_6887 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/770 | Linear peptide | ADSKGCKITCFLTAA | null | null | 26 | 40 | null | null | Non-toxic protein TsNTxP precursor (NTxP) | http://www.ncbi.nlm.nih.gov/protein/O77463.1 | Toxin Ts4 | http://www.uniprot.org/uniprot/O77463 | Tityus serrulatus | http://purl.obolibrary.org/obo/NCBITaxon_6887 | Tityus serrulatus | http://purl.obolibrary.org/obo/NCBITaxon_6887 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/771 | Linear peptide | ADSLRSQANTLGQAISNGNDALGILQTADK | null | null | 51 | 80 | null | null | flagellin | http://www.ncbi.nlm.nih.gov/protein/NP_282485.1 | Flagellin A | http://www.uniprot.org/uniprot/P56963 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 | http://purl.obolibrary.org/obo/NCBITaxon_192222 | Campylobacter jejuni | http://purl.obolibrary.org/obo/NCBITaxon_197 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/772 | Linear peptide | ADSRIRPQT | null | null | 335 | 343 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/773 | Linear peptide | ADSSAH | null | null | 692 | 697 | null | null | shed-acute-phase-antigen | http://www.ncbi.nlm.nih.gov/protein/CAA40511.1 | Trans-sialidase, putative | http://www.uniprot.org/uniprot/Q4CZ79 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/774 | Linear peptide | ADSVGGKD | null | null | 117 | 124 | null | null | scrub typhus antigen 56 precursor | http://www.ncbi.nlm.nih.gov/protein/AAA26391.1 | 56 kDa type-specific antigen | http://www.uniprot.org/uniprot/Q02938 | Orientia tsutsugamushi Karp | https://ontology.iedb.org/ontology/ONTIE_0000662 | Orientia tsutsugamushi | http://purl.obolibrary.org/obo/NCBITaxon_784 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/775 | Linear peptide | ADTAACGDI | null | null | 994 | 1002 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/Q81495.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate HCV-K3a/650) | http://purl.obolibrary.org/obo/NCBITaxon_356416 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/776 | Linear peptide | ADTATDKVLAAERYY | null | null | 196 | 210 | null | null | Genome polyprotein | http://www.ncbi.nlm.nih.gov/protein/P08544.1 | Genome polyprotein | http://www.uniprot.org/uniprot/Q88595 | Theiler's encephalomyelitis virus (STRAIN BEAN 8386) | http://purl.obolibrary.org/obo/NCBITaxon_12125 | Cardiovirus B | http://purl.obolibrary.org/obo/NCBITaxon_1821750 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/777 | Linear peptide | ADTDGPPAQF | null | null | 171 | 180 | null | null | Chain 1, Bovine Enterovirus Vg-5-27 | http://www.ncbi.nlm.nih.gov/protein/1BEV_1 | Genome polyprotein | http://www.uniprot.org/uniprot/P12915 | Enterovirus E | http://purl.obolibrary.org/obo/NCBITaxon_12064 | Enterovirus E | http://purl.obolibrary.org/obo/NCBITaxon_12064 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/778 | Linear peptide | ADTIASGA | null | null | null | null | null | null | Merozoite surface protein 1 | https://ontology.iedb.org/ontology/ONTIE_0002573 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum FC27/Papua New Guinea | http://purl.obolibrary.org/obo/NCBITaxon_5837 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/779 | Linear peptide | ADTIASGS | null | null | 60 | 67 | null | null | Merozoite surface antigen 2 | http://www.ncbi.nlm.nih.gov/protein/P19599.1 | Merozoite surface protein 2 | http://www.uniprot.org/uniprot/P50498 | Plasmodium falciparum FC27/Papua New Guinea | http://purl.obolibrary.org/obo/NCBITaxon_5837 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/780 | Linear peptide | ADTIASGSQRSTNSASTSTTNNGESQTTTPTA | null | null | 23 | 54 | null | null | merozoite surface protein 2 | http://www.ncbi.nlm.nih.gov/protein/AAS48088.1 | Merozoite surface protein 2 | http://www.uniprot.org/uniprot/P50498 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/781 | Linear peptide | ADTIRI | null | null | 300 | 305 | null | null | Major outer membrane porin, serovar B precursor | http://www.ncbi.nlm.nih.gov/protein/P23421.1 | Major outer membrane porin, serovar D | http://www.uniprot.org/uniprot/Q46409 | Chlamydia trachomatis Serovar B | https://ontology.iedb.org/ontology/ONTIE_0000705 | Chlamydia trachomatis | http://purl.obolibrary.org/obo/NCBITaxon_813 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/782 | Linear peptide | ADTISSYFVGKMY | null | null | 108 | 120 | null | null | Phospholipase A2 precursor | http://www.ncbi.nlm.nih.gov/protein/P00630.3 | Api m 1 | http://www.uniprot.org/uniprot/P00630 | Apis mellifera | http://purl.obolibrary.org/obo/NCBITaxon_7460 | Apis mellifera | http://purl.obolibrary.org/obo/NCBITaxon_7460 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/783 | Linear peptide | ADTQGS | null | null | 197 | 202 | null | null | envelope glycoprotein | http://www.ncbi.nlm.nih.gov/protein/AAS49691.2 | Genome polyprotein | http://www.uniprot.org/uniprot/P17763 | Dengue virus 2 Jamaica/1409/1983 | http://purl.obolibrary.org/obo/NCBITaxon_11064 | Dengue virus | http://purl.obolibrary.org/obo/NCBITaxon_12637 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/784 | Linear peptide | ADTSRIGNCGPTIFLGVLED | null | null | 281 | 300 | null | null | Envelope glycoprotein precursor (Env polyprotein) | http://www.ncbi.nlm.nih.gov/protein/P22429.1 | Envelope glycoprotein | http://www.uniprot.org/uniprot/P32541 | Equine infectious anemia virus | http://purl.obolibrary.org/obo/NCBITaxon_11665 | Equine infectious anemia virus | http://purl.obolibrary.org/obo/NCBITaxon_11665 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/785 | Linear peptide | ADVEFCLSL | null | null | 316 | 324 | null | null | Tyrosinase precursor | http://www.ncbi.nlm.nih.gov/protein/Q8MIU0.2 | Tyrosinase | http://www.uniprot.org/uniprot/Q8MIU0 | Bos taurus | http://purl.obolibrary.org/obo/NCBITaxon_9913 | Bos taurus | http://purl.obolibrary.org/obo/NCBITaxon_9913 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/786 | Linear peptide | ADVFHLYLQY | null | null | 5247 | 5256 | null | null | Replicase polyprotein 1ab | http://www.ncbi.nlm.nih.gov/protein/P59641.2 | Replicase polyprotein 1ab | http://www.uniprot.org/uniprot/P0C6X7 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/787 | Linear peptide | ADVFNPRAGRIN | null | null | 368 | 379 | null | null | 13S globulin seed storage protein 3 precursor (Legumin-like protein 3) (Allergen Fag e 1) | http://www.ncbi.nlm.nih.gov/protein/Q9XFM4.1 | 13S globulin seed storage protein 3 | http://www.uniprot.org/uniprot/Q9XFM4 | Fagopyrum esculentum | http://purl.obolibrary.org/obo/NCBITaxon_3617 | Fagopyrum esculentum | http://purl.obolibrary.org/obo/NCBITaxon_3617 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/788 | Linear peptide | ADVGYGAYDLYDLGE | null | null | 81 | 95 | null | null | Alpha-amylase precursor (1,4-alpha-D-glucan glucanohydrolase) (BLA) | http://www.ncbi.nlm.nih.gov/protein/P06278.1 | Alpha amylase, Glycoside Hydrolase Family 13 | http://www.uniprot.org/uniprot/Q65MX0 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/789 | Linear peptide | ADVIPVRRRGDSRGS | null | null | 1137 | 1151 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/790 | Linear peptide | ADVKKDLISYGGGWK | null | null | 70 | 84 | null | null | Nonstructural protein NS3 | http://www.ncbi.nlm.nih.gov/protein/NP_739587.2 | Genome polyprotein | http://www.uniprot.org/uniprot/P17763 | Dengue virus 2 Thailand/16681/84 | http://purl.obolibrary.org/obo/NCBITaxon_31634 | Dengue virus | http://purl.obolibrary.org/obo/NCBITaxon_12637 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/791 | Linear peptide | ADVNISPVLIQNLREMYKEH | null | null | 131 | 150 | null | null | apical membrane antigen 1 | http://www.ncbi.nlm.nih.gov/protein/AAB36509.1 | Apical membrane antigen 1, putative | http://www.uniprot.org/uniprot/A0A1C6YDU1 | Plasmodium chabaudi adami DS | https://ontology.iedb.org/ontology/ONTIE_0000266 | Plasmodium chabaudi | http://purl.obolibrary.org/obo/NCBITaxon_5825 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/792 | Linear peptide | ADVRKNSS | null | null | 128 | 135 | null | null | 60 kDa chaperonin | http://www.ncbi.nlm.nih.gov/protein/P16625.1 | Chaperonin GroEL | http://www.uniprot.org/uniprot/A5CDL9 | Orientia tsutsugamushi | http://purl.obolibrary.org/obo/NCBITaxon_784 | Orientia tsutsugamushi | http://purl.obolibrary.org/obo/NCBITaxon_784 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/793 | Linear peptide | ADVTITVNGKVVAKPC | null | null | 24 | 39 | null | null | minor fimbrial subunit, precursor polypeptide | http://www.ncbi.nlm.nih.gov/protein/CAA12422.1 | Protein FimG | http://www.uniprot.org/uniprot/P08190 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/794 | Linear peptide | ADVVCGGV | null | null | 168 | 175 | null | null | Immunogenic protein MPB70 precursor | http://www.ncbi.nlm.nih.gov/protein/P0A669.1 | Immunogenic protein MPT70 | http://www.uniprot.org/uniprot/P9WNF5 | Mycobacterium tuberculosis variant bovis | http://purl.obolibrary.org/obo/NCBITaxon_1765 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/795 | Linear peptide | ADVVLIASIDHIT | null | null | 154 | 166 | null | null | Glutathione S-transferase class-mu 28 kDa isozyme | http://www.ncbi.nlm.nih.gov/protein/P26624.1 | glutathione transferase | http://www.uniprot.org/uniprot/Q26513 | Schistosoma japonicum | http://purl.obolibrary.org/obo/NCBITaxon_6182 | Schistosoma japonicum | http://purl.obolibrary.org/obo/NCBITaxon_6182 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/796 | Linear peptide | ADWADWLDYP | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/797 | Linear peptide | ADWDLQHPQPA | null | null | 212 | 222 | null | null | gag polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA47632.1 | Gag polyprotein | http://www.uniprot.org/uniprot/Q5QGH1 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/798 | Linear peptide | ADYEELREQLSSVSSFERFE | null | null | 113 | 132 | null | null | hemagglutinin | http://www.ncbi.nlm.nih.gov/protein/ABI96104.1 | Hemagglutinin | http://www.uniprot.org/uniprot/P03452 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/799 | Linear peptide | ADYFEYHQEGGPDGEPDVPP | null | null | 412 | 431 | null | null | Epstein-Barr nuclear antigen 1 | https://www.uniprot.org/uniprot/P03211.1 | Epstein-Barr nuclear antigen 1 | http://www.uniprot.org/uniprot/P03211 | Human herpesvirus 4 strain B95-8 | http://purl.obolibrary.org/obo/NCBITaxon_10377 | human gammaherpesvirus 4 | http://purl.obolibrary.org/obo/NCBITaxon_10376 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/800 | Linear peptide | ADYHRVMY | null | null | 73 | 80 | null | null | lipoprotein, 15 kDa (tpp15) | http://www.ncbi.nlm.nih.gov/protein/NP_218610.1 | 15 kDa lipoprotein | http://www.uniprot.org/uniprot/P16055 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/801 | Linear peptide | ADYHRVMYAS | null | null | 73 | 82 | null | null | lipoprotein, 15 kDa (tpp15) | http://www.ncbi.nlm.nih.gov/protein/NP_218610.1 | 15 kDa lipoprotein | http://www.uniprot.org/uniprot/P16055 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/802 | Linear peptide | ADYISSEATTPV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/803 | Linear peptide | ADYSVLYNST | null | null | 350 | 359 | null | null | spike glycoprotein | http://www.ncbi.nlm.nih.gov/protein/AAP41037.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/804 | Linear peptide | AEAAAAAAY | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.