Epitope ID stringlengths 8 35 | Epitope stringclasses 5 values | Epitope.1 stringlengths 1 829 | Epitope.2 stringlengths 2 111 ⌀ | Epitope.3 stringclasses 47 values | Epitope.4 stringlengths 1 17 ⌀ | Epitope.5 stringlengths 1 15 ⌀ | Epitope.6 stringlengths 3 43 ⌀ | Epitope.7 stringlengths 2 3.89k ⌀ | Epitope.8 stringlengths 1 433 ⌀ | Epitope.9 stringlengths 19 51 ⌀ | Epitope.10 stringlengths 1 188 ⌀ | Epitope.11 stringlengths 19 43 ⌀ | Epitope.12 stringlengths 4 95 ⌀ | Epitope.13 stringlengths 19 48 ⌀ | Epitope.14 stringlengths 4 52 ⌀ | Epitope.15 stringlengths 11 48 ⌀ | Related Object stringclasses 7 values | Related Object.1 stringclasses 11 values | Related Object.2 stringlengths 2 1.53k ⌀ | Related Object.3 stringlengths 1 17 ⌀ | Related Object.4 stringlengths 1 15 ⌀ | Related Object.5 stringclasses 81 values | Related Object.6 stringlengths 1 1.59k ⌀ | Related Object.7 stringlengths 2 286 ⌀ | Related Object.8 stringlengths 19 51 ⌀ | Related Object.9 stringlengths 3 144 ⌀ | Related Object.10 stringlengths 19 41 ⌀ | Related Object.11 stringclasses 494 values | Related Object.12 stringclasses 390 values | Related Object.13 stringclasses 251 values | Related Object.14 stringclasses 251 values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
http://www.iedb.org/epitope/605 | Linear peptide | ACVAGDSSTKNLIYTSTLCELNVTGFQQHF | null | null | 31 | 60 | null | null | primary envelope glycoprotein | http://www.ncbi.nlm.nih.gov/protein/AAC84053.1 | Major structural glycoprotein | http://www.uniprot.org/uniprot/Q83022 | Lactate dehydrogenase-elevating virus | http://purl.obolibrary.org/obo/NCBITaxon_11048 | Gammaarterivirus lacdeh | http://purl.obolibrary.org/obo/NCBITaxon_2499678 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/606 | Linear peptide | ACVHNQDII | null | null | 130 | 138 | null | null | M44 protein | http://www.ncbi.nlm.nih.gov/protein/CAJ84737.1 | null | null | Murid betaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10366 | Murid betaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10366 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/607 | Linear peptide | ACVVAEAVVKTLQPV | null | null | 873 | 887 | null | null | replicase 1AB [SARS coronavirus Tor2] | http://www.ncbi.nlm.nih.gov/protein/NP_828849.7 | Replicase polyprotein 1ab | http://www.uniprot.org/uniprot/P0C6X7 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/608 | Linear peptide | ACYCYGLPNWVKVWD | null | null | 41 | 55 | null | null | Chain A, Neurotoxin (Ts1) From Brazilian Scorpion Tityus Serrulatus | http://www.ncbi.nlm.nih.gov/protein/1B7D_A | Beta-mammal/insect toxin Ts1 | http://www.uniprot.org/uniprot/P15226 | Tityus serrulatus | http://purl.obolibrary.org/obo/NCBITaxon_6887 | Tityus serrulatus | http://purl.obolibrary.org/obo/NCBITaxon_6887 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/609 | Linear peptide | ACYISSEATTPV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/610 | Linear peptide | ACYLPFQLSCGGKS | null | null | null | null | null | null | null | null | null | null | null | null | null | null | mimotope | Accession Non-Sequence Molecule | polysaccharide | null | null | http://purl.obolibrary.org/obo/CHEBI_18154 | Glycan, Glycane, glycans, Glykan, Glykane, polisacarido, polisacaridos, Polysaccharide | null | null | null | null | Burkholderia pseudomallei | http://purl.obolibrary.org/obo/NCBITaxon_28450 | Burkholderia pseudomallei | http://purl.obolibrary.org/obo/NCBITaxon_28450 |
http://www.iedb.org/epitope/611 | Linear peptide | ADAANLLSG | null | null | 133 | 141 | null | null | ABC transporter ATP-binding protein | http://www.ncbi.nlm.nih.gov/protein/YP_040806.1 | ABC transporter, ATP-binding protein, putative | http://www.uniprot.org/uniprot/Q2FYP2 | Staphylococcus aureus subsp. aureus MRSA252 | http://purl.obolibrary.org/obo/NCBITaxon_282458 | Staphylococcus aureus | http://purl.obolibrary.org/obo/NCBITaxon_1280 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/612 | Linear peptide | ADAAPSPTPYLPRLS | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/613 | Linear peptide | ADAFILLNY | null | null | 508 | 516 | null | null | Ribonucleoside-diphosphate reductase large subunit | https://www.uniprot.org/uniprot/P12848.1 | Ribonucleoside-diphosphate reductase large subunit | http://www.uniprot.org/uniprot/P12848 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/614 | Linear peptide | ADAGFMKQY | null | null | 811 | 819 | null | null | Spike glycoprotein | https://www.uniprot.org/uniprot/P59594.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/615 | Linear peptide | ADAGFMKQYGECLGD | null | null | 811 | 825 | null | null | Spike glycoprotein | https://www.uniprot.org/uniprot/P59594.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS-CoV1 | null | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/616 | Linear peptide | ADAGYTPAAAAT | null | null | 26 | 37 | null | null | Pollen allergen Lol p VA | https://www.uniprot.org/uniprot/Q9XF24.1 | Lol p 5 | http://www.uniprot.org/uniprot/Q40237 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/617 | Linear peptide | ADAGYTPAAAATPATPAATP | null | null | 26 | 45 | null | null | Pollen allergen Lol p VA | https://www.uniprot.org/uniprot/Q9XF24.1 | Lol p 5 | http://www.uniprot.org/uniprot/Q40237 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/618 | Linear peptide | ADAGYTPAAPAAAGAGGKATTDEQKLLED | null | null | 1 | 29 | null | null | group V allergen | http://www.ncbi.nlm.nih.gov/protein/CAB10765.1 | Hol l 5 | http://www.uniprot.org/uniprot/O23972 | Holcus lanatus | http://purl.obolibrary.org/obo/NCBITaxon_29679 | Holcus lanatus | http://purl.obolibrary.org/obo/NCBITaxon_29679 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/619 | Linear peptide | ADAILHTPGC | null | null | 217 | 226 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P27958.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate H) | http://purl.obolibrary.org/obo/NCBITaxon_11108 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/620 | Linear peptide | ADAILHTPGCVPCVR | null | null | 217 | 231 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P27958.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/621 | Linear peptide | ADAKAAAAV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/622 | Linear peptide | ADAKCTEE | null | null | 1670 | 1677 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/623 | Linear peptide | ADALLEKG | null | null | 95 | 102 | null | null | lipoprotein, 15 kDa (tpp15) | http://www.ncbi.nlm.nih.gov/protein/NP_218610.1 | 15 kDa lipoprotein | http://www.uniprot.org/uniprot/P16055 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/624 | Linear peptide | ADALLEKGNP | null | null | 95 | 104 | null | null | lipoprotein, 15 kDa (tpp15) | http://www.ncbi.nlm.nih.gov/protein/NP_218610.1 | 15 kDa lipoprotein | http://www.uniprot.org/uniprot/P16055 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/625 | Linear peptide | ADALLTLGYRWFSAGGYFAS | null | null | 315 | 334 | null | null | tpr protein K | http://www.ncbi.nlm.nih.gov/protein/AAF45140.1 | Tpr protein K (TprK) | http://www.uniprot.org/uniprot/O83867 | Treponema pallidum subsp. pallidum str. Nichols | http://purl.obolibrary.org/obo/NCBITaxon_243276 | Treponema pallidum | http://purl.obolibrary.org/obo/NCBITaxon_160 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/626 | Linear peptide | ADAPEGKKNEKKNEKIERNN | null | null | 69 | 88 | null | null | circumsporozoite protein | http://www.ncbi.nlm.nih.gov/protein/AAA29541.1 | Circumsporozoite protein | http://www.uniprot.org/uniprot/P23093 | Plasmodium berghei | http://purl.obolibrary.org/obo/NCBITaxon_5821 | Plasmodium berghei | http://purl.obolibrary.org/obo/NCBITaxon_5821 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/627 | Linear peptide | ADAPEGKNEIRNN | null | null | null | null | null | null | Circumsporozoite protein | https://ontology.iedb.org/ontology/ONTIE_0002400 | null | null | Plasmodium berghei | http://purl.obolibrary.org/obo/NCBITaxon_5821 | Plasmodium berghei | http://purl.obolibrary.org/obo/NCBITaxon_5821 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/628 | Linear peptide | ADAPEGKNEKKNEKIERNN | null | null | null | null | null | null | Circumsporozoite protein | https://ontology.iedb.org/ontology/ONTIE_0002400 | null | null | Plasmodium berghei | http://purl.obolibrary.org/obo/NCBITaxon_5821 | Plasmodium berghei | http://purl.obolibrary.org/obo/NCBITaxon_5821 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/629 | Linear peptide | ADAPPGSPAPPPPEHRGGPE | null | null | 543 | 562 | null | null | envelope glycoprotein G | http://www.ncbi.nlm.nih.gov/protein/NP_044534.1 | Envelope glycoprotein G | http://www.uniprot.org/uniprot/P13290 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/630 | Linear peptide | ADARGLIQSS + NAc(A1) | A1 | N-acetylation | 1157 | 1166 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/631 | Linear peptide | ADASDSDA | null | null | 142 | 149 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/632 | Linear peptide | ADASLKMADPNRFRGKDLP | null | null | 30 | 48 | null | null | glycoprotein D | http://www.ncbi.nlm.nih.gov/protein/AAB59754.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69091 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | Human alphaherpesvirus 1 | http://purl.obolibrary.org/obo/NCBITaxon_10298 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/633 | Linear peptide | ADASTPESA | null | null | 25 | 33 | null | null | tat protein | http://www.ncbi.nlm.nih.gov/protein/AAW32419.1 | Protein Tat | http://www.uniprot.org/uniprot/Q5QFY3 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/634 | Linear peptide | ADASTPESANL | null | null | 25 | 35 | null | null | tat protein | http://www.ncbi.nlm.nih.gov/protein/AAW32419.1 | Protein Tat | http://www.uniprot.org/uniprot/Q5QFY3 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/635 | Linear peptide | ADATEDVTAVEVDPA | null | null | 138 | 152 | null | null | Alpha-amylase precursor (1,4-alpha-D-glucan glucanohydrolase) (BLA) | http://www.ncbi.nlm.nih.gov/protein/P06278.1 | Alpha amylase, Glycoside Hydrolase Family 13 | http://www.uniprot.org/uniprot/Q65MX0 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/636 | Linear peptide | ADAVIHASGKQMWQA | null | null | 145 | 159 | null | null | 65 kDa lower matrix phosphoprotein | http://www.ncbi.nlm.nih.gov/protein/P06725.2 | 65 kDa phosphoprotein | http://www.uniprot.org/uniprot/P06725 | Human herpesvirus 5 strain AD169 | http://purl.obolibrary.org/obo/NCBITaxon_10360 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/637 | Linear peptide | ADAVSRKKMD + ACET(A1) | A1 | Acetylation|ACET | 66 | 75 | null | null | Nucleoprotein | http://www.ncbi.nlm.nih.gov/protein/P27313.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P27313 | Puumala virus sotkamo/v-2969/81 | http://purl.obolibrary.org/obo/NCBITaxon_39002 | Orthohantavirus puumalaense | http://purl.obolibrary.org/obo/NCBITaxon_3052493 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/638 | Linear peptide | ADAVSRKKMD | null | null | 66 | 75 | null | null | N protein | http://www.ncbi.nlm.nih.gov/protein/CAB06337.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P27313 | Puumala virus Kazan | https://ontology.iedb.org/ontology/ONTIE_0000393 | Orthohantavirus puumalaense | http://purl.obolibrary.org/obo/NCBITaxon_3052493 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/639 | Linear peptide | ADAVSRKKMDTKPTDPT | null | null | 66 | 82 | null | null | N protein | http://www.ncbi.nlm.nih.gov/protein/CAB06337.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P27313 | Puumala virus Kazan | https://ontology.iedb.org/ontology/ONTIE_0000393 | Orthohantavirus puumalaense | http://purl.obolibrary.org/obo/NCBITaxon_3052493 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/640 | Linear peptide | ADCTLWFCPQTSN | null | null | null | null | null | null | null | null | null | null | null | null | null | null | mimotope | Accession Sequence Molecule | S protein | null | null | null | null | null | null | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS-CoV1 | null | null | null |
http://www.iedb.org/epitope/641 | Linear peptide | ADDDSFFKY | null | null | 13 | 21 | null | null | Protein J1 | http://www.ncbi.nlm.nih.gov/protein/P07616.1 | Virion assembly protein OPG100 | http://www.uniprot.org/uniprot/P07616 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/642 | Linear peptide | ADDFFQGTKAALAGGT | null | null | 86 | 101 | null | null | collapsin response mediator protein 1 | http://www.ncbi.nlm.nih.gov/protein/NP_031791.3 | Dihydropyrimidinase-related protein 1 | http://www.uniprot.org/uniprot/P97427 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/643 | Linear peptide | ADDHPGAVAARNDVLSGFS | null | null | 30 | 48 | null | null | M protein | http://www.ncbi.nlm.nih.gov/protein/AAQ64524.2 | M protein type 1 | http://www.uniprot.org/uniprot/Q99XV0 | Streptococcus pyogenes NS27 | https://ontology.iedb.org/ontology/ONTIE_0000685 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/644 | Linear peptide | ADDIVEKL | null | null | 53 | 60 | null | null | Octanoyltransferase | http://www.ncbi.nlm.nih.gov/protein/Q73GE2.1 | Octanoyltransferase | http://www.uniprot.org/uniprot/Q73GE2 | Wolbachia endosymbiont of Drosophila melanogaster | http://purl.obolibrary.org/obo/NCBITaxon_163164 | Wolbachia endosymbiont of Drosophila melanogaster | http://purl.obolibrary.org/obo/NCBITaxon_163164 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/645 | Linear peptide | ADDLTAAINKGILVT | null | null | 337 | 351 | null | null | envelope protein | http://www.ncbi.nlm.nih.gov/protein/NP_740305.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P03314 | Yellow fever virus 17D | http://purl.obolibrary.org/obo/NCBITaxon_11090 | Yellow fever virus | http://purl.obolibrary.org/obo/NCBITaxon_11089 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/646 | Linear peptide | ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA | null | null | 2 | 37 | null | null | Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Phl P 7 (Polcalcin) At 1.75 Angstroem | http://www.ncbi.nlm.nih.gov/protein/1K9U_A | Phl p 7 | http://www.uniprot.org/uniprot/O82040 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/647 | Linear peptide | ADDPLLR | null | null | 260 | 266 | null | null | E1 protein | http://www.ncbi.nlm.nih.gov/protein/BAA19893.1 | Structural polyprotein | http://www.uniprot.org/uniprot/P07566 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/648 | Linear peptide | ADDPLLRT | null | null | 260 | 267 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/CAJ88851.1 | Structural polyprotein | http://www.uniprot.org/uniprot/P07566 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | Rubella virus | http://purl.obolibrary.org/obo/NCBITaxon_11041 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/649 | Linear peptide | ADDSIVTGI | null | null | 137 | 145 | null | null | pol polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA47633.2 | Pol polyprotein (Fragment) | http://www.uniprot.org/uniprot/Q88016 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/650 | Linear peptide | ADDSIVTGIEL | null | null | 137 | 147 | null | null | pol polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA47633.2 | Pol polyprotein (Fragment) | http://www.uniprot.org/uniprot/Q88016 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/651 | Linear peptide | ADDTPYTLSFAPHRH | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/652 | Linear peptide | ADDVILHTPGCVPC | null | null | 216 | 229 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/Q81258.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus genotype 3 | http://purl.obolibrary.org/obo/NCBITaxon_356114 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/653 | Linear peptide | ADDVKLWRQRGMSTW | null | null | 81 | 95 | null | null | single strand-specific nuclease | http://www.ncbi.nlm.nih.gov/protein/AAD48894.2 | Single strand-specific nuclease | http://www.uniprot.org/uniprot/Q9NJY3 | Leishmania pifanoi | http://purl.obolibrary.org/obo/NCBITaxon_5682 | Leishmania pifanoi | http://purl.obolibrary.org/obo/NCBITaxon_5682 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/654 | Linear peptide | ADEELLKNIKNETGFQAQVVKD | null | null | 174 | 195 | null | null | Probable coat protein VP1 | http://www.ncbi.nlm.nih.gov/protein/P07299.1 | Minor capsid protein VP1 | http://www.uniprot.org/uniprot/Q9PZT0 | Human parvovirus B19 | http://purl.obolibrary.org/obo/NCBITaxon_10798 | Erythroparvovirus primate1 | http://purl.obolibrary.org/obo/NCBITaxon_3052189 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/655 | Linear peptide | ADEEQQQALSSQMGF | null | null | 86 | 100 | null | null | ESAT-6-like protein esxB | http://www.ncbi.nlm.nih.gov/protein/P0A566.2 | ESAT-6-like protein EsxB | http://www.uniprot.org/uniprot/P9WNK5 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/656 | Linear peptide | ADEIDKYIQGLD | null | null | 58 | 69 | null | null | Listeriolysin O | https://www.uniprot.org/uniprot/P13128.1 | Listeriolysin O | http://www.uniprot.org/uniprot/P13128 | Listeria monocytogenes EGD-e | http://purl.obolibrary.org/obo/NCBITaxon_169963 | Listeria monocytogenes | http://purl.obolibrary.org/obo/NCBITaxon_1639 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/657 | Linear peptide | ADEINNLKNKLE | null | null | 772 | 783 | null | null | Tetanus toxin | https://www.uniprot.org/uniprot/P04958.2 | Tetanus toxin | http://www.uniprot.org/uniprot/P04958 | Clostridium tetani | http://purl.obolibrary.org/obo/NCBITaxon_1513 | Clostridium tetani | http://purl.obolibrary.org/obo/NCBITaxon_1513 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/658 | Linear peptide | ADELEKIRL | null | null | 13 | 21 | null | null | gag polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA47632.1 | Gag polyprotein | http://www.uniprot.org/uniprot/Q5QGH1 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/659 | Linear peptide | ADELIKYL | null | null | 66 | 73 | null | null | RAP-2 | http://www.ncbi.nlm.nih.gov/protein/CAA41577.1 | Rhoptry-associated protein 2 | http://www.uniprot.org/uniprot/Q8I484 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/660 | Linear peptide | ADELLTWIKMLAAKNLPIYT | null | null | 291 | 310 | null | null | ORF4 | http://www.ncbi.nlm.nih.gov/protein/AAY57694.1 | mRNA export factor ICP27 homolog | http://www.uniprot.org/uniprot/P09269 | Human alphaherpesvirus 3 | http://purl.obolibrary.org/obo/NCBITaxon_10335 | Human alphaherpesvirus 3 | http://purl.obolibrary.org/obo/NCBITaxon_10335 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/661 | Linear peptide | ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF | null | null | 37 | 78 | null | null | Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Phl P 7 (Polcalcin) At 1.75 Angstroem | http://www.ncbi.nlm.nih.gov/protein/1K9U_A | Phl p 7 | http://www.uniprot.org/uniprot/O82040 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | Phleum pratense | http://purl.obolibrary.org/obo/NCBITaxon_15957 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/662 | Linear peptide | ADFIASM | null | null | 170 | 176 | null | null | middle t-antigen | http://www.ncbi.nlm.nih.gov/protein/NP_041265.1 | Middle T antigen | http://www.uniprot.org/uniprot/P03077 | Alphapolyomavirus muris | http://purl.obolibrary.org/obo/NCBITaxon_1891730 | Alphapolyomavirus muris | http://purl.obolibrary.org/obo/NCBITaxon_1891730 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/663 | Linear peptide | ADFKLFFRW | null | null | 237 | 245 | null | null | Hypothetical ATP binding protein | http://www.ncbi.nlm.nih.gov/protein/Q47527 | Ferric enterobactin transport ATP-binding protein FepC | http://www.uniprot.org/uniprot/P23878 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/664 | Linear peptide | ADFSNYGAVVDVYAPGKDIT | null | null | 324 | 343 | null | null | Tri r 2 allergen | http://www.ncbi.nlm.nih.gov/protein/AAD52013.1 | Subtilisin-like protease 6 | http://www.uniprot.org/uniprot/F2SLX7 | Trichophyton rubrum | http://purl.obolibrary.org/obo/NCBITaxon_5551 | Trichophyton rubrum | http://purl.obolibrary.org/obo/NCBITaxon_5551 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/665 | Linear peptide | ADGDALNKVLKAFQG | null | null | 155 | 169 | null | null | vlp25 gene homologue | http://www.ncbi.nlm.nih.gov/protein/BAC22682.1 | Variable large protein | http://www.uniprot.org/uniprot/W6TGH9 | Borrelia duttonii Ly | http://purl.obolibrary.org/obo/NCBITaxon_412419 | Borrelia duttonii | http://purl.obolibrary.org/obo/NCBITaxon_40834 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/666 | Linear peptide | ADGGCSGGA | null | null | 1307 | 1315 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/Q81258.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate NZL1) | http://purl.obolibrary.org/obo/NCBITaxon_356415 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/667 | Linear peptide | ADGGCSGGAYDIIIC | null | null | 1301 | 1315 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/668 | Linear peptide | ADGGCSGGAYDIIICDECHS | null | null | 1301 | 1320 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/669 | Linear peptide | ADGKKYYLAIAVNGARSRIEAM | null | null | 316 | 337 | null | null | chitinase family 18 protein | http://www.ncbi.nlm.nih.gov/protein/YP_169730.1 | Chitinase family 18 protein | http://www.uniprot.org/uniprot/Q5NGW2 | Francisella tularensis subsp. tularensis SCHU S4 | http://purl.obolibrary.org/obo/NCBITaxon_177416 | Francisella tularensis | http://purl.obolibrary.org/obo/NCBITaxon_263 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/670 | Linear peptide | ADGMVSKGWRLLAPI | null | null | 1015 | 1029 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/ACH61695.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/671 | Linear peptide | ADGNAL | null | null | 43 | 48 | null | null | CFA/I fimbrial subunit B precursor | http://www.ncbi.nlm.nih.gov/protein/P02971.3 | null | null | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/672 | Linear peptide | ADGNALPSAV | null | null | 43 | 52 | null | null | CFA/I fimbrial subunit B precursor | http://www.ncbi.nlm.nih.gov/protein/P02971.3 | null | null | Escherichia coli ETEC H10407 | http://purl.obolibrary.org/obo/NCBITaxon_316401 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/673 | Linear peptide | ADGNTLYSGHKDNLIR | null | null | 289 | 304 | null | null | Guanine nucleotide-binding protein subunit beta-like protein | http://www.ncbi.nlm.nih.gov/protein/Q25306.1 | Activated protein kinase c receptor | http://www.uniprot.org/uniprot/Q4Q7Y7 | Leishmania major | http://purl.obolibrary.org/obo/NCBITaxon_5664 | Leishmania major | http://purl.obolibrary.org/obo/NCBITaxon_5664 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/674 | Linear peptide | ADGTNATTI | null | null | 164 | 172 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/675 | Linear peptide | ADHPSYTAAKDEVLSHFSV | null | null | null | null | null | null | M protein | https://ontology.iedb.org/ontology/ONTIE_0002893 | M protein type 1 | http://www.uniprot.org/uniprot/Q99XV0 | Streptococcus pyogenes NS5 | https://ontology.iedb.org/ontology/ONTIE_0000686 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/676 | Linear peptide | ADIAAVAKY | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/677 | Linear peptide | ADIDKLIDYAASGD | null | null | 283 | 296 | null | null | Nucleoprotein | http://www.ncbi.nlm.nih.gov/protein/P27313.1 | Nucleoprotein | http://www.uniprot.org/uniprot/P27313 | Puumala virus sotkamo/v-2969/81 | http://purl.obolibrary.org/obo/NCBITaxon_39002 | Orthohantavirus puumalaense | http://purl.obolibrary.org/obo/NCBITaxon_3052493 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/678 | Linear peptide | ADIDNYNKF | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/679 | Linear peptide | ADIDYDHPDVAAEIK | null | null | 228 | 242 | null | null | Alpha-amylase precursor (1,4-alpha-D-glucan glucanohydrolase) (BLA) | http://www.ncbi.nlm.nih.gov/protein/P06278.1 | Alpha amylase, Glycoside Hydrolase Family 13 | http://www.uniprot.org/uniprot/Q65MX0 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/680 | Linear peptide | ADIENEEKI | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | QDIENEEKI | 346 | 354 | null | RNA-directed RNA polymerase subunit P3, PB2 | Polymerase basic protein 2 | https://ontology.iedb.org/ontology/ONTIE_0002032 | Polymerase basic protein 2 | http://www.uniprot.org/uniprot/P03428 | Influenza A virus (A/Puerto Rico/8/1934(H1N1)) (Influenza A virus (A/PR 8/34 (H1N1))) | http://purl.obolibrary.org/obo/NCBITaxon_211044 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 |
http://www.iedb.org/epitope/681 | Linear peptide | ADIGIKDGK | null | null | 84 | 92 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/682 | Linear peptide | ADIGSVQNQVTSTINNITVTQVNVKAAESQ | null | null | 501 | 530 | null | null | flagellin | http://www.ncbi.nlm.nih.gov/protein/NP_282485.1 | Flagellin A | http://www.uniprot.org/uniprot/P56963 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 | http://purl.obolibrary.org/obo/NCBITaxon_192222 | Campylobacter jejuni | http://purl.obolibrary.org/obo/NCBITaxon_197 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/683 | Linear peptide | ADIKDPIRLEPGGPD | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | CDIKDPIRLEPGGPD | 61 | 75 | null | null | Pollen allergen Amb a 3 | http://www.ncbi.nlm.nih.gov/protein/P00304.2 | Amb a 3 | http://www.uniprot.org/uniprot/P00304 | Ambrosia artemisiifolia var. elatior | http://purl.obolibrary.org/obo/NCBITaxon_4215 | Ambrosia artemisiifolia | http://purl.obolibrary.org/obo/NCBITaxon_4212 |
http://www.iedb.org/epitope/684 | Linear peptide | ADIKKLTE | null | null | 609 | 616 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/685 | Linear peptide | ADILLHSTY | null | null | 105 | 113 | null | null | vif protein | http://www.ncbi.nlm.nih.gov/protein/AAA47634.1 | Virion infectivity factor | http://www.uniprot.org/uniprot/Q89490 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/686 | Linear peptide | ADILLHSTYF | null | null | 105 | 114 | null | null | vif protein | http://www.ncbi.nlm.nih.gov/protein/AAA47634.1 | Virion infectivity factor | http://www.uniprot.org/uniprot/Q89490 | Simian immunodeficiency virus - mac - mac 239 | https://ontology.iedb.org/ontology/ONTIE_0000410 | Simian immunodeficiency virus | http://purl.obolibrary.org/obo/NCBITaxon_11723 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/687 | Linear peptide | ADINAVCPSELK | null | null | 146 | 157 | null | null | Pathogenesis-related protein precursor | http://www.ncbi.nlm.nih.gov/protein/P81295.1 | Jun a 3 | http://www.uniprot.org/uniprot/P81295 | Juniperus ashei | http://purl.obolibrary.org/obo/NCBITaxon_13101 | Juniperus ashei | http://purl.obolibrary.org/obo/NCBITaxon_13101 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/688 | Linear peptide | ADINNE | null | null | 77 | 82 | null | null | Alpha-amylase inhibitor 0.28 precursor (CIII) (WMAI-1) | http://www.ncbi.nlm.nih.gov/protein/P01083.3 | Tri a 15 | http://www.uniprot.org/uniprot/D2TGC3 | Triticum aestivum | http://purl.obolibrary.org/obo/NCBITaxon_4565 | Triticum aestivum | http://purl.obolibrary.org/obo/NCBITaxon_4565 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/689 | Linear peptide | ADIVKYEPTASM | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/690 | Linear peptide | ADKFKIFEAAFSESSKGLLA | null | null | 80 | 99 | null | null | Pollen allergen Lol p VA | https://www.uniprot.org/uniprot/Q9XF24.1 | Lol p 5 | http://www.uniprot.org/uniprot/Q40237 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/691 | Linear peptide | ADKNFTLM | null | null | null | null | null | null | Trans-sialidase | https://ontology.iedb.org/ontology/ONTIE_0002050 | null | null | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/692 | Linear peptide | ADKNKKEFG | null | null | 380 | 388 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/693 | Linear peptide | ADKPDEQLDYENDIEKKICK | null | null | null | null | null | null | Circumsporozoite | https://ontology.iedb.org/ontology/ONTIE_0002612 | Circumsporozoite protein | http://www.uniprot.org/uniprot/Q7K740 | Plasmodium falciparum isolate WELLCOME | http://purl.obolibrary.org/obo/NCBITaxon_5848 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/694 | Linear peptide | ADKPDESTL | null | null | 32 | 40 | null | null | kinetoplastid membrane protein-11 - Leishmania donovani | http://www.ncbi.nlm.nih.gov/protein/S53442 | Kinetoplastid membrane protein-11 | http://www.uniprot.org/uniprot/E9BS96 | Leishmania donovani | http://purl.obolibrary.org/obo/NCBITaxon_5661 | Leishmania donovani | http://purl.obolibrary.org/obo/NCBITaxon_5661 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/695 | Linear peptide | ADKRITEMI | null | null | 59 | 67 | null | null | Polymerase basic protein 2 | http://www.ncbi.nlm.nih.gov/protein/P21428.1 | Polymerase basic protein 2 | http://www.uniprot.org/uniprot/P03428 | Influenza A virus (A/Ann Arbor/6/1960(H2N2)) | http://purl.obolibrary.org/obo/NCBITaxon_384498 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/696 | Linear peptide | ADKSKVKLTISD | null | null | 81 | 92 | null | null | Outer surface protein A precursor | http://www.ncbi.nlm.nih.gov/protein/P14013.1 | Outer surface protein A | http://www.uniprot.org/uniprot/P0CL66 | Borreliella burgdorferi B31 | http://purl.obolibrary.org/obo/NCBITaxon_224326 | Borreliella burgdorferi | http://purl.obolibrary.org/obo/NCBITaxon_139 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/697 | Linear peptide | ADKSSILFLCDD | null | null | 106 | 117 | null | null | pH-regulated antigen PRA1 precursor | http://www.ncbi.nlm.nih.gov/protein/P87020.1 | pH-regulated antigen PRA1 | http://www.uniprot.org/uniprot/P87020 | Candida albicans | http://purl.obolibrary.org/obo/NCBITaxon_5476 | Candida albicans | http://purl.obolibrary.org/obo/NCBITaxon_5476 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/698 | Linear peptide | ADKVQAQGFKGANVK | null | null | 118 | 132 | null | null | Subtilisin Carlsberg precursor | http://www.ncbi.nlm.nih.gov/protein/P00780.1 | Apr | http://www.uniprot.org/uniprot/Q65LP7 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/699 | Linear peptide | ADKYDVQVA | null | null | 238 | 246 | null | null | urease beta subunit (urea amidohydrolase) (ureB) | http://www.ncbi.nlm.nih.gov/protein/NP_206872.1 | Urease subunit beta | http://www.uniprot.org/uniprot/P69996 | Helicobacter pylori 26695 | http://purl.obolibrary.org/obo/NCBITaxon_85962 | Helicobacter pylori | http://purl.obolibrary.org/obo/NCBITaxon_210 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/700 | Linear peptide | ADLAAVQKTNAANQAAYQK | null | null | 211 | 229 | null | null | Major cell-surface adhesin PAc precursor (Antigen I/II) | http://www.ncbi.nlm.nih.gov/protein/P11657.1 | Cell surface antigen I/II | http://www.uniprot.org/uniprot/P23504 | Streptococcus mutans MT 8148 | https://ontology.iedb.org/ontology/ONTIE_0000674 | Streptococcus mutans | http://purl.obolibrary.org/obo/NCBITaxon_1309 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/701 | Linear peptide | ADLAIEYEVMSRLKPGIIMCR | null | null | 89 | 109 | null | null | Bacterioferritin (BFR) (Major membrane protein II) (MMP-II) | http://www.ncbi.nlm.nih.gov/protein/P43315.1 | Bacterioferritin | http://www.uniprot.org/uniprot/P43315 | Mycobacterium leprae | http://purl.obolibrary.org/obo/NCBITaxon_1769 | Mycobacterium leprae | http://purl.obolibrary.org/obo/NCBITaxon_1769 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/702 | Linear peptide | ADLDFGKIK | null | null | 223 | 231 | null | null | ABC transporter ATP-binding protein | http://www.ncbi.nlm.nih.gov/protein/YP_040806.1 | ABC transporter, ATP-binding protein, putative | http://www.uniprot.org/uniprot/Q2FYP2 | Staphylococcus aureus subsp. aureus MRSA252 | http://purl.obolibrary.org/obo/NCBITaxon_282458 | Staphylococcus aureus | http://purl.obolibrary.org/obo/NCBITaxon_1280 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/703 | Linear peptide | ADLEKALEGAMC | null | null | null | null | null | null | M protein | https://ontology.iedb.org/ontology/ONTIE_0002893 | M protein type 1 | http://www.uniprot.org/uniprot/Q99XV0 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/704 | Linear peptide | ADLENEAKVL | null | null | 3072 | 3081 | null | null | Genome polyprotein | http://www.ncbi.nlm.nih.gov/protein/P06935.2 | Genome polyprotein | http://www.uniprot.org/uniprot/Q9Q6P4 | West Nile virus | http://purl.obolibrary.org/obo/NCBITaxon_11082 | West Nile virus | http://purl.obolibrary.org/obo/NCBITaxon_11082 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.