Unnamed: 0
int64
0
832k
id
float64
2.49B
32.1B
type
stringclasses
1 value
created_at
stringlengths
19
19
repo
stringlengths
7
112
repo_url
stringlengths
36
141
action
stringclasses
3 values
title
stringlengths
2
665
labels
stringlengths
4
554
body
stringlengths
3
235k
index
stringclasses
6 values
text_combine
stringlengths
96
235k
label
stringclasses
2 values
text
stringlengths
96
196k
binary_label
int64
0
1
19,056
13,187,261,798
IssuesEvent
2020-08-13 02:51:28
icecube-trac/tix3
https://api.github.com/repos/icecube-trac/tix3
opened
[documentation] 403 forbidden (Trac #1980)
Incomplete Migration Migrated from Trac infrastructure task
<details> <summary><em>Migrated from <a href="https://code.icecube.wisc.edu/ticket/1980">https://code.icecube.wisc.edu/ticket/1980</a>, reported by david.schultz and owned by nega</em></summary> <p> ```json { "status": "closed", "changetime": "2019-02-13T14:14:44", "description": "Whenever the nightly doc rebuild happens, we get 403 forbidden for quite a while (many minutes to hours). While the US users may not care as much, since it happens late at night, Europe/Asia is awake and working. So, let's make sure this doesn't happen.", "reporter": "david.schultz", "cc": "", "resolution": "fixed", "_ts": "1550067284370534", "component": "infrastructure", "summary": "[documentation] 403 forbidden", "priority": "normal", "keywords": "", "time": "2017-04-09T13:25:11", "milestone": "", "owner": "nega", "type": "task" } ``` </p> </details>
1.0
[documentation] 403 forbidden (Trac #1980) - <details> <summary><em>Migrated from <a href="https://code.icecube.wisc.edu/ticket/1980">https://code.icecube.wisc.edu/ticket/1980</a>, reported by david.schultz and owned by nega</em></summary> <p> ```json { "status": "closed", "changetime": "2019-02-13T14:14:44", "description": "Whenever the nightly doc rebuild happens, we get 403 forbidden for quite a while (many minutes to hours). While the US users may not care as much, since it happens late at night, Europe/Asia is awake and working. So, let's make sure this doesn't happen.", "reporter": "david.schultz", "cc": "", "resolution": "fixed", "_ts": "1550067284370534", "component": "infrastructure", "summary": "[documentation] 403 forbidden", "priority": "normal", "keywords": "", "time": "2017-04-09T13:25:11", "milestone": "", "owner": "nega", "type": "task" } ``` </p> </details>
infrastructure
forbidden trac migrated from json status closed changetime description whenever the nightly doc rebuild happens we get forbidden for quite a while many minutes to hours while the us users may not care as much since it happens late at night europe asia is awake and working so let s make sure this doesn t happen reporter david schultz cc resolution fixed ts component infrastructure summary forbidden priority normal keywords time milestone owner nega type task
1
587,348
17,613,522,652
IssuesEvent
2021-08-18 06:43:10
svthalia/concrexit
https://api.github.com/repos/svthalia/concrexit
opened
Remove automatic membership renewal feature
priority: low feature
### Is your feature request related to a problem? Please describe. Years ago, when the registrations app didn't exist yet and Thalia Pay really wasn't a thing, we had a checkbox for automatic membership renewal if people signed a mandate to automatically renew membership every year. We don't use it anymore. The mandates have all become invalid and with the registrations app and Thalia Pay people can arrange this themselves ### Describe the solution you'd like Remove the field from the profile, and change the email texts accordingly ### Motivation Clean up the codebase ### Describe alternatives you've considered ### Additional context
1.0
Remove automatic membership renewal feature - ### Is your feature request related to a problem? Please describe. Years ago, when the registrations app didn't exist yet and Thalia Pay really wasn't a thing, we had a checkbox for automatic membership renewal if people signed a mandate to automatically renew membership every year. We don't use it anymore. The mandates have all become invalid and with the registrations app and Thalia Pay people can arrange this themselves ### Describe the solution you'd like Remove the field from the profile, and change the email texts accordingly ### Motivation Clean up the codebase ### Describe alternatives you've considered ### Additional context
non_infrastructure
remove automatic membership renewal feature is your feature request related to a problem please describe years ago when the registrations app didn t exist yet and thalia pay really wasn t a thing we had a checkbox for automatic membership renewal if people signed a mandate to automatically renew membership every year we don t use it anymore the mandates have all become invalid and with the registrations app and thalia pay people can arrange this themselves describe the solution you d like remove the field from the profile and change the email texts accordingly motivation clean up the codebase describe alternatives you ve considered additional context
0
617,690
19,402,695,315
IssuesEvent
2021-12-19 13:22:03
bounswe/2021SpringGroup6
https://api.github.com/repos/bounswe/2021SpringGroup6
closed
Bug: Other Users Can Update Event
Type: Bug Platform: Back-end Priority: High Status: Waiting Review
When I was going through the update event code, I realized that non-organizer users can also edit the event since there is no check. This should be fixed. Related pull request #306
1.0
Bug: Other Users Can Update Event - When I was going through the update event code, I realized that non-organizer users can also edit the event since there is no check. This should be fixed. Related pull request #306
non_infrastructure
bug other users can update event when i was going through the update event code i realized that non organizer users can also edit the event since there is no check this should be fixed related pull request
0
31,427
25,748,146,002
IssuesEvent
2022-12-08 11:14:32
reapit/foundations
https://api.github.com/repos/reapit/foundations
opened
Spike: Use Vite for Foundations web app builds
feature front-end infrastructure
**Background context or User story:** _Vite is quite mature now, much better dev ex and much quicker than Webpack. It also now supports Linaria with a plugin. Experiment to see if we can replace webpack for FE builds and if so, roll out to web apps in Foundations_
1.0
Spike: Use Vite for Foundations web app builds - **Background context or User story:** _Vite is quite mature now, much better dev ex and much quicker than Webpack. It also now supports Linaria with a plugin. Experiment to see if we can replace webpack for FE builds and if so, roll out to web apps in Foundations_
infrastructure
spike use vite for foundations web app builds background context or user story vite is quite mature now much better dev ex and much quicker than webpack it also now supports linaria with a plugin experiment to see if we can replace webpack for fe builds and if so roll out to web apps in foundations
1
22,267
15,079,076,195
IssuesEvent
2021-02-05 09:39:14
raiden-network/light-client
https://api.github.com/repos/raiden-network/light-client
closed
Try GitHub code scanning
enhancement infrastructure 🚧
## Description GitHub integrated a new code scanning tool: https://github.blog/2020-09-30-code-scanning-is-now-available/ It is rules based and free to use, so we should give it a try, look at the results and decide if it's warnings are meaningful enough to use it. ## Acceptance criteria - ## Tasks - [ ] Enable code scanning on the repo - [ ] Go through the results and evaluate results - [ ] Decide whether to leave it enabled or not
1.0
Try GitHub code scanning - ## Description GitHub integrated a new code scanning tool: https://github.blog/2020-09-30-code-scanning-is-now-available/ It is rules based and free to use, so we should give it a try, look at the results and decide if it's warnings are meaningful enough to use it. ## Acceptance criteria - ## Tasks - [ ] Enable code scanning on the repo - [ ] Go through the results and evaluate results - [ ] Decide whether to leave it enabled or not
infrastructure
try github code scanning description github integrated a new code scanning tool it is rules based and free to use so we should give it a try look at the results and decide if it s warnings are meaningful enough to use it acceptance criteria tasks enable code scanning on the repo go through the results and evaluate results decide whether to leave it enabled or not
1
23,888
16,676,526,367
IssuesEvent
2021-06-07 16:53:08
dotnet/runtime
https://api.github.com/repos/dotnet/runtime
closed
Failed to build "CoreCLR component".
area-Infrastructure-coreclr customer assistance
During the compile "board.sh" facing the issue "Failed to build "CoreCLR component"". **./build.sh** ![Failed_core_CLI](https://user-images.githubusercontent.com/81962828/120468629-0c738800-c3bf-11eb-8968-060b4ac1d206.png)
1.0
Failed to build "CoreCLR component". - During the compile "board.sh" facing the issue "Failed to build "CoreCLR component"". **./build.sh** ![Failed_core_CLI](https://user-images.githubusercontent.com/81962828/120468629-0c738800-c3bf-11eb-8968-060b4ac1d206.png)
infrastructure
failed to build coreclr component during the compile board sh facing the issue failed to build coreclr component build sh
1
54,595
30,267,097,909
IssuesEvent
2023-07-07 12:44:01
keycloak/keycloak
https://api.github.com/repos/keycloak/keycloak
closed
Realm export performance heavily depends on the amount of users per file
kind/bug area/import-export team/store kind/performance
### Before reporting an issue - [X] I have searched existing issues - [X] I have reproduced the issue with the latest release ### Area import-export ### Describe the bug I frequently need to export a realm (including users) and need to import it into another Keycloak server. I have a realm with currently around 11500 users. Exporting the realm with users is extremely slow if --users=same_file is used. The export then exports just a few users per second and runs into a timeout after 5 minutes. After this time, only around 930 users have been exported, amounting to around 3 users per second. If --users=different_files is used, the export is fairly fast if a low number of users per file (via the --users-per-file parameter) is used and becomes slow if a larger amount of users per file is used. With 50 users per file (the default), the whole export takes around 80 seconds (over 140 users per second), with 1000 users per file, the export takes 280 seconds (around 40 users per second), with a higher number this runs into a timeout. The amount of users per file (which I assume is also the transaction size) heavily affects the performance during the export. The relationship between the number of users per file and the export time is not mentioned anywhere in the Keycloak documentation. ### Version 21.1.1 ### Expected behavior The number of users per file during a realm export should not impact the performance. Keycloak should internally always work with some fixed optimal transaction size, regardless of how many users it stores per file in the end. It should not matter whether I use 10 or 5000 users per file (except for some slight overhead for having more files). I expect the export time to grow linearly with the number of users. ### Actual behavior The realm export performance depends heavily on the amount of users per file. The worst case is --users=same_file, which is very slow. With --users=different_files, the performance gets better and better the lower the --users-per-file parameter is. ### How to Reproduce? Create a realm with a large number of users (e.g. 10,000). Measure the time for a realm export using --users=same_file and compare this to using --users=different_files with different values for --users-per-file (50, 500, 5000). ### Anything else? _No response_
True
Realm export performance heavily depends on the amount of users per file - ### Before reporting an issue - [X] I have searched existing issues - [X] I have reproduced the issue with the latest release ### Area import-export ### Describe the bug I frequently need to export a realm (including users) and need to import it into another Keycloak server. I have a realm with currently around 11500 users. Exporting the realm with users is extremely slow if --users=same_file is used. The export then exports just a few users per second and runs into a timeout after 5 minutes. After this time, only around 930 users have been exported, amounting to around 3 users per second. If --users=different_files is used, the export is fairly fast if a low number of users per file (via the --users-per-file parameter) is used and becomes slow if a larger amount of users per file is used. With 50 users per file (the default), the whole export takes around 80 seconds (over 140 users per second), with 1000 users per file, the export takes 280 seconds (around 40 users per second), with a higher number this runs into a timeout. The amount of users per file (which I assume is also the transaction size) heavily affects the performance during the export. The relationship between the number of users per file and the export time is not mentioned anywhere in the Keycloak documentation. ### Version 21.1.1 ### Expected behavior The number of users per file during a realm export should not impact the performance. Keycloak should internally always work with some fixed optimal transaction size, regardless of how many users it stores per file in the end. It should not matter whether I use 10 or 5000 users per file (except for some slight overhead for having more files). I expect the export time to grow linearly with the number of users. ### Actual behavior The realm export performance depends heavily on the amount of users per file. The worst case is --users=same_file, which is very slow. With --users=different_files, the performance gets better and better the lower the --users-per-file parameter is. ### How to Reproduce? Create a realm with a large number of users (e.g. 10,000). Measure the time for a realm export using --users=same_file and compare this to using --users=different_files with different values for --users-per-file (50, 500, 5000). ### Anything else? _No response_
non_infrastructure
realm export performance heavily depends on the amount of users per file before reporting an issue i have searched existing issues i have reproduced the issue with the latest release area import export describe the bug i frequently need to export a realm including users and need to import it into another keycloak server i have a realm with currently around users exporting the realm with users is extremely slow if users same file is used the export then exports just a few users per second and runs into a timeout after minutes after this time only around users have been exported amounting to around users per second if users different files is used the export is fairly fast if a low number of users per file via the users per file parameter is used and becomes slow if a larger amount of users per file is used with users per file the default the whole export takes around seconds over users per second with users per file the export takes seconds around users per second with a higher number this runs into a timeout the amount of users per file which i assume is also the transaction size heavily affects the performance during the export the relationship between the number of users per file and the export time is not mentioned anywhere in the keycloak documentation version expected behavior the number of users per file during a realm export should not impact the performance keycloak should internally always work with some fixed optimal transaction size regardless of how many users it stores per file in the end it should not matter whether i use or users per file except for some slight overhead for having more files i expect the export time to grow linearly with the number of users actual behavior the realm export performance depends heavily on the amount of users per file the worst case is users same file which is very slow with users different files the performance gets better and better the lower the users per file parameter is how to reproduce create a realm with a large number of users e g measure the time for a realm export using users same file and compare this to using users different files with different values for users per file anything else no response
0
19,057
13,187,261,882
IssuesEvent
2020-08-13 02:51:29
icecube-trac/tix3
https://api.github.com/repos/icecube-trac/tix3
opened
[buildbot] SUSE testing (Trac #1981)
Incomplete Migration Migrated from Trac infrastructure task
<details> <summary><em>Migrated from <a href="https://code.icecube.wisc.edu/ticket/1981">https://code.icecube.wisc.edu/ticket/1981</a>, reported by david.schultz and owned by nega</em></summary> <p> ```json { "status": "closed", "changetime": "2019-02-13T14:14:44", "description": "Gonzalo has the idea to run on Titan in the next year, meaning we should verify the code works on SUSE. Specific version is: SLES 11.2 (or OpenSUSE 11.3).", "reporter": "david.schultz", "cc": "olivas, gmerino", "resolution": "invalid", "_ts": "1550067284370534", "component": "infrastructure", "summary": "[buildbot] SUSE testing", "priority": "major", "keywords": "", "time": "2017-04-11T15:38:51", "milestone": "", "owner": "nega", "type": "task" } ``` </p> </details>
1.0
[buildbot] SUSE testing (Trac #1981) - <details> <summary><em>Migrated from <a href="https://code.icecube.wisc.edu/ticket/1981">https://code.icecube.wisc.edu/ticket/1981</a>, reported by david.schultz and owned by nega</em></summary> <p> ```json { "status": "closed", "changetime": "2019-02-13T14:14:44", "description": "Gonzalo has the idea to run on Titan in the next year, meaning we should verify the code works on SUSE. Specific version is: SLES 11.2 (or OpenSUSE 11.3).", "reporter": "david.schultz", "cc": "olivas, gmerino", "resolution": "invalid", "_ts": "1550067284370534", "component": "infrastructure", "summary": "[buildbot] SUSE testing", "priority": "major", "keywords": "", "time": "2017-04-11T15:38:51", "milestone": "", "owner": "nega", "type": "task" } ``` </p> </details>
infrastructure
suse testing trac migrated from json status closed changetime description gonzalo has the idea to run on titan in the next year meaning we should verify the code works on suse specific version is sles or opensuse reporter david schultz cc olivas gmerino resolution invalid ts component infrastructure summary suse testing priority major keywords time milestone owner nega type task
1
15,445
11,515,540,885
IssuesEvent
2020-02-14 01:32:28
dotnet/aspnetcore
https://api.github.com/repos/dotnet/aspnetcore
closed
Dependencies are out of date in master
area-infrastructure
Both the runtime and blazor dependencies are about 10 days out of date in master. This issue is being filed as a result of our agreed-upon SLA and escalation path of 7 days (max). ![image](https://user-images.githubusercontent.com/54385/74492840-0fbec980-4e85-11ea-8bec-15dba3ff271e.png) Runtime reports the oldest unconsumed commit as "(unknown)", but the build was produced late on February 3rd, so 10 days out of date should be the upper bound for that. @BrennanConroy What do you think about using the build date for reporting out-of-dateness when the oldest unconsumed commit cannot be found for whatever reason?
1.0
Dependencies are out of date in master - Both the runtime and blazor dependencies are about 10 days out of date in master. This issue is being filed as a result of our agreed-upon SLA and escalation path of 7 days (max). ![image](https://user-images.githubusercontent.com/54385/74492840-0fbec980-4e85-11ea-8bec-15dba3ff271e.png) Runtime reports the oldest unconsumed commit as "(unknown)", but the build was produced late on February 3rd, so 10 days out of date should be the upper bound for that. @BrennanConroy What do you think about using the build date for reporting out-of-dateness when the oldest unconsumed commit cannot be found for whatever reason?
infrastructure
dependencies are out of date in master both the runtime and blazor dependencies are about days out of date in master this issue is being filed as a result of our agreed upon sla and escalation path of days max runtime reports the oldest unconsumed commit as unknown but the build was produced late on february so days out of date should be the upper bound for that brennanconroy what do you think about using the build date for reporting out of dateness when the oldest unconsumed commit cannot be found for whatever reason
1
265,504
28,297,783,516
IssuesEvent
2023-04-10 01:03:57
nidhi7598/linux-3.0.35_CVE-2022-45934
https://api.github.com/repos/nidhi7598/linux-3.0.35_CVE-2022-45934
opened
CVE-2023-1652 (High) detected in linux-stable-rtv3.8.6
Mend: dependency security vulnerability
## CVE-2023-1652 - High Severity Vulnerability <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>linux-stable-rtv3.8.6</b></p></summary> <p> <p>Julia Cartwright's fork of linux-stable-rt.git</p> <p>Library home page: <a href=https://git.kernel.org/pub/scm/linux/kernel/git/julia/linux-stable-rt.git>https://git.kernel.org/pub/scm/linux/kernel/git/julia/linux-stable-rt.git</a></p> <p>Found in HEAD commit: <a href="https://github.com/nidhi7598/linux-3.0.35_CVE-2022-45934/commit/5e23b7f9d2dd0154edd54986754eecd5b5308571">5e23b7f9d2dd0154edd54986754eecd5b5308571</a></p> <p>Found in base branch: <b>master</b></p></p> </details> </p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Source Files (1)</summary> <p></p> <p> <img src='https://s3.amazonaws.com/wss-public/bitbucketImages/xRedImage.png' width=19 height=20> <b>/fs/nfsd/nfs4proc.c</b> </p> </details> <p></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> Vulnerability Details</summary> <p> A use-after-free flaw was found in nfsd4_ssc_setup_dul in fs/nfsd/nfs4proc.c in the NFS filesystem in the Linux Kernel. This issue could allow a local attacker to crash the system or it may lead to a kernel information leak problem. <p>Publish Date: 2023-03-29 <p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2023-1652>CVE-2023-1652</a></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>7.1</b>)</summary> <p> Base Score Metrics: - Exploitability Metrics: - Attack Vector: Local - Attack Complexity: Low - Privileges Required: Low - User Interaction: None - Scope: Unchanged - Impact Metrics: - Confidentiality Impact: High - Integrity Impact: None - Availability Impact: High </p> For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>. </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary> <p> <p>Type: Upgrade version</p> <p>Origin: <a href="https://www.linuxkernelcves.com/cves/CVE-2023-1652">https://www.linuxkernelcves.com/cves/CVE-2023-1652</a></p> <p>Release Date: 2023-03-29</p> <p>Fix Resolution: v5.15.91,v6.1.9</p> </p> </details> <p></p> *** Step up your Open Source Security Game with Mend [here](https://www.whitesourcesoftware.com/full_solution_bolt_github)
True
CVE-2023-1652 (High) detected in linux-stable-rtv3.8.6 - ## CVE-2023-1652 - High Severity Vulnerability <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>linux-stable-rtv3.8.6</b></p></summary> <p> <p>Julia Cartwright's fork of linux-stable-rt.git</p> <p>Library home page: <a href=https://git.kernel.org/pub/scm/linux/kernel/git/julia/linux-stable-rt.git>https://git.kernel.org/pub/scm/linux/kernel/git/julia/linux-stable-rt.git</a></p> <p>Found in HEAD commit: <a href="https://github.com/nidhi7598/linux-3.0.35_CVE-2022-45934/commit/5e23b7f9d2dd0154edd54986754eecd5b5308571">5e23b7f9d2dd0154edd54986754eecd5b5308571</a></p> <p>Found in base branch: <b>master</b></p></p> </details> </p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Source Files (1)</summary> <p></p> <p> <img src='https://s3.amazonaws.com/wss-public/bitbucketImages/xRedImage.png' width=19 height=20> <b>/fs/nfsd/nfs4proc.c</b> </p> </details> <p></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> Vulnerability Details</summary> <p> A use-after-free flaw was found in nfsd4_ssc_setup_dul in fs/nfsd/nfs4proc.c in the NFS filesystem in the Linux Kernel. This issue could allow a local attacker to crash the system or it may lead to a kernel information leak problem. <p>Publish Date: 2023-03-29 <p>URL: <a href=https://www.mend.io/vulnerability-database/CVE-2023-1652>CVE-2023-1652</a></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>7.1</b>)</summary> <p> Base Score Metrics: - Exploitability Metrics: - Attack Vector: Local - Attack Complexity: Low - Privileges Required: Low - User Interaction: None - Scope: Unchanged - Impact Metrics: - Confidentiality Impact: High - Integrity Impact: None - Availability Impact: High </p> For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>. </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary> <p> <p>Type: Upgrade version</p> <p>Origin: <a href="https://www.linuxkernelcves.com/cves/CVE-2023-1652">https://www.linuxkernelcves.com/cves/CVE-2023-1652</a></p> <p>Release Date: 2023-03-29</p> <p>Fix Resolution: v5.15.91,v6.1.9</p> </p> </details> <p></p> *** Step up your Open Source Security Game with Mend [here](https://www.whitesourcesoftware.com/full_solution_bolt_github)
non_infrastructure
cve high detected in linux stable cve high severity vulnerability vulnerable library linux stable julia cartwright s fork of linux stable rt git library home page a href found in head commit a href found in base branch master vulnerable source files fs nfsd c vulnerability details a use after free flaw was found in ssc setup dul in fs nfsd c in the nfs filesystem in the linux kernel this issue could allow a local attacker to crash the system or it may lead to a kernel information leak problem publish date url a href cvss score details base score metrics exploitability metrics attack vector local attack complexity low privileges required low user interaction none scope unchanged impact metrics confidentiality impact high integrity impact none availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution step up your open source security game with mend
0
19,355
13,222,585,441
IssuesEvent
2020-08-17 15:46:01
libero/reviewer
https://api.github.com/repos/libero/reviewer
closed
Ensure that we can do rolling updates/replicas
Infrastructure
If we want to have rolling updates/replicas of reviewer we need to ensure several things: - Multiple pods can use RDS/s3 simultaneously in a safe manner - File upload and progress state get handled by by same pod - Applications need to handle SIGTERM - Ensure you don’t end in bad state if SIGKILL or websocket connection gets terminated due to nginx config reload (see [this article](https://blog.colinbreck.com/kubernetes-liveness-and-readiness-probes-looking-for-more-feet)) You can manage where traffic goes with - [Readiness probe state](https://kubernetes.io/docs/tasks/configure-pod-container/configure-liveness-readiness-startup-probes/) (k8s ingress will send traffic) - [Cookie based session affinity](https://kubernetes.github.io/ingress-nginx/user-guide/nginx-configuration/configmap/#load-balance) (ingress annotation) - Chart can set [grace period](https://cloud.google.com/blog/products/gcp/kubernetes-best-practices-terminating-with-grace) for SIGTERM - Ingress [annotation how long to send existing connections](https://kubernetes.github.io/ingress-nginx/user-guide/nginx-configuration/configmap/#worker-shutdown-timeout) This ticket is result of discussion ticket #907 DoD: - ~~connections to submission are sticky~~ - ~~submission pods are kept alive to handle existing connections during rollout~~ - [x] per app replica and disruptionbudget - ~~ingress sends existing connections to old pod~~ - [x] grace-period can be set via values.yaml I have successfully uploaded large files while performing a rollout. I haven't looked deeper if all subsystems are behaving as expected. Tasks: - [x] replicas/disruptions budget in chart and deployments - [x] pod grace period - [x] ~~pre stop hook <<< **requires #1310**~~ submission handles SIGTERM gracefully, keeping uploads alive - [x] ingress grace period - [x] ingress stickyness - [x] ~~evaluate readyness and liveness probes~~ >>> #1306 - [x] test survival of connection during rollout - [x] investigate replicacount/canary interaction
1.0
Ensure that we can do rolling updates/replicas - If we want to have rolling updates/replicas of reviewer we need to ensure several things: - Multiple pods can use RDS/s3 simultaneously in a safe manner - File upload and progress state get handled by by same pod - Applications need to handle SIGTERM - Ensure you don’t end in bad state if SIGKILL or websocket connection gets terminated due to nginx config reload (see [this article](https://blog.colinbreck.com/kubernetes-liveness-and-readiness-probes-looking-for-more-feet)) You can manage where traffic goes with - [Readiness probe state](https://kubernetes.io/docs/tasks/configure-pod-container/configure-liveness-readiness-startup-probes/) (k8s ingress will send traffic) - [Cookie based session affinity](https://kubernetes.github.io/ingress-nginx/user-guide/nginx-configuration/configmap/#load-balance) (ingress annotation) - Chart can set [grace period](https://cloud.google.com/blog/products/gcp/kubernetes-best-practices-terminating-with-grace) for SIGTERM - Ingress [annotation how long to send existing connections](https://kubernetes.github.io/ingress-nginx/user-guide/nginx-configuration/configmap/#worker-shutdown-timeout) This ticket is result of discussion ticket #907 DoD: - ~~connections to submission are sticky~~ - ~~submission pods are kept alive to handle existing connections during rollout~~ - [x] per app replica and disruptionbudget - ~~ingress sends existing connections to old pod~~ - [x] grace-period can be set via values.yaml I have successfully uploaded large files while performing a rollout. I haven't looked deeper if all subsystems are behaving as expected. Tasks: - [x] replicas/disruptions budget in chart and deployments - [x] pod grace period - [x] ~~pre stop hook <<< **requires #1310**~~ submission handles SIGTERM gracefully, keeping uploads alive - [x] ingress grace period - [x] ingress stickyness - [x] ~~evaluate readyness and liveness probes~~ >>> #1306 - [x] test survival of connection during rollout - [x] investigate replicacount/canary interaction
infrastructure
ensure that we can do rolling updates replicas if we want to have rolling updates replicas of reviewer we need to ensure several things multiple pods can use rds simultaneously in a safe manner file upload and progress state get handled by by same pod applications need to handle sigterm ensure you don’t end in bad state if sigkill or websocket connection gets terminated due to nginx config reload see you can manage where traffic goes with ingress will send traffic ingress annotation chart can set for sigterm ingress this ticket is result of discussion ticket dod connections to submission are sticky submission pods are kept alive to handle existing connections during rollout per app replica and disruptionbudget ingress sends existing connections to old pod grace period can be set via values yaml i have successfully uploaded large files while performing a rollout i haven t looked deeper if all subsystems are behaving as expected tasks replicas disruptions budget in chart and deployments pod grace period pre stop hook requires submission handles sigterm gracefully keeping uploads alive ingress grace period ingress stickyness evaluate readyness and liveness probes test survival of connection during rollout investigate replicacount canary interaction
1
3,159
4,108,988,150
IssuesEvent
2016-06-06 17:58:20
JMRI/JMRI
https://api.github.com/repos/JMRI/JMRI
closed
Return of Travis Tests Crashing VM
infrastructure
(This is the return of the previous #369 issue) Travis is (again) crashing during ci-test, generally in the schema test section. Debugging is complicated by inability to see logs (suggestions welcome) but it appears that the process is being "kill"ed for violating some system limit. There's a bit of recent discussion in #753 and #768.
1.0
Return of Travis Tests Crashing VM - (This is the return of the previous #369 issue) Travis is (again) crashing during ci-test, generally in the schema test section. Debugging is complicated by inability to see logs (suggestions welcome) but it appears that the process is being "kill"ed for violating some system limit. There's a bit of recent discussion in #753 and #768.
infrastructure
return of travis tests crashing vm this is the return of the previous issue travis is again crashing during ci test generally in the schema test section debugging is complicated by inability to see logs suggestions welcome but it appears that the process is being kill ed for violating some system limit there s a bit of recent discussion in and
1
606,003
18,753,394,909
IssuesEvent
2021-11-05 07:17:53
MudBlazor/MudBlazor
https://api.github.com/repos/MudBlazor/MudBlazor
closed
API documentation page of the Popover component doesn't work on development server
bug docs fixed Priority: High bug-functional
### Bug type Docs (mudblazor.com) ### Component name Popover ### What happened? - Page isn't displayed. - "An error has occurred. This application may no longer respond until reloaded. Reload" is displayed at the bottom of the page instead ### Expected behavior No error ### Reproduction link https://dev.mudblazor.com/api/popover ### Reproduction steps Go to https://dev.mudblazor.com/api/popover ### Relevant log output ```shell System.ArgumentNullException: 'Value cannot be null. (Parameter 'fragment')' ``` ### Version (bug) from https://github.com/MudBlazor/MudBlazor/pull/2833 ### Version (working) before https://github.com/MudBlazor/MudBlazor/pull/2833 ### What browsers are you seeing the problem on? Chrome ### On what operating system are you experiencing the issue? Windows ### Pull Request - [ ] I would like to do a Pull Request ### Code of Conduct - [X] I agree to follow this project's Code of Conduct
1.0
API documentation page of the Popover component doesn't work on development server - ### Bug type Docs (mudblazor.com) ### Component name Popover ### What happened? - Page isn't displayed. - "An error has occurred. This application may no longer respond until reloaded. Reload" is displayed at the bottom of the page instead ### Expected behavior No error ### Reproduction link https://dev.mudblazor.com/api/popover ### Reproduction steps Go to https://dev.mudblazor.com/api/popover ### Relevant log output ```shell System.ArgumentNullException: 'Value cannot be null. (Parameter 'fragment')' ``` ### Version (bug) from https://github.com/MudBlazor/MudBlazor/pull/2833 ### Version (working) before https://github.com/MudBlazor/MudBlazor/pull/2833 ### What browsers are you seeing the problem on? Chrome ### On what operating system are you experiencing the issue? Windows ### Pull Request - [ ] I would like to do a Pull Request ### Code of Conduct - [X] I agree to follow this project's Code of Conduct
non_infrastructure
api documentation page of the popover component doesn t work on development server bug type docs mudblazor com component name popover what happened page isn t displayed an error has occurred this application may no longer respond until reloaded reload is displayed at the bottom of the page instead expected behavior no error reproduction link reproduction steps go to relevant log output shell system argumentnullexception value cannot be null parameter fragment version bug from version working before what browsers are you seeing the problem on chrome on what operating system are you experiencing the issue windows pull request i would like to do a pull request code of conduct i agree to follow this project s code of conduct
0
18,643
13,058,664,054
IssuesEvent
2020-07-30 09:22:35
Flank/flank
https://api.github.com/repos/Flank/flank
closed
Move source code of test artifacts to one repo.
Infrastructure
**Author the user story for this feature** As a developer, I want to have source code for all test artifacts on one repository so I can easily manage test artifacts projects. **Is your feature request related to a problem? Please describe.** https://github.com/Flank/flank/issues/849 **Describe the solution you'd like** Move EarlGreyExample to the flank repository. **Describe alternatives you've considered** Move EarlGreyExample and test_app to a dedicated repository and link it to the flank repo as a submodule. **Additionally** Clean test_app from unused soruce code
1.0
Move source code of test artifacts to one repo. - **Author the user story for this feature** As a developer, I want to have source code for all test artifacts on one repository so I can easily manage test artifacts projects. **Is your feature request related to a problem? Please describe.** https://github.com/Flank/flank/issues/849 **Describe the solution you'd like** Move EarlGreyExample to the flank repository. **Describe alternatives you've considered** Move EarlGreyExample and test_app to a dedicated repository and link it to the flank repo as a submodule. **Additionally** Clean test_app from unused soruce code
infrastructure
move source code of test artifacts to one repo author the user story for this feature as a developer i want to have source code for all test artifacts on one repository so i can easily manage test artifacts projects is your feature request related to a problem please describe describe the solution you d like move earlgreyexample to the flank repository describe alternatives you ve considered move earlgreyexample and test app to a dedicated repository and link it to the flank repo as a submodule additionally clean test app from unused soruce code
1
111,818
4,488,641,828
IssuesEvent
2016-08-30 08:08:59
nilsschmidt1337/ldparteditor
https://api.github.com/repos/nilsschmidt1337/ldparteditor
closed
The error "Invalid use of 'BFC INVERTNEXT' / Flat subfile" gets duplicated.
bug high-priority
``` 0 0 Name: new.dat 0 Author: Nils Schmidt [BlackBrick89] 0 !LDRAW_ORG Unofficial_Part 0 !LICENSE Redistributable under CCAL version 2.0 : see CAreadme.txt 0 BFC CERTIFY CCW 0 BFC INVERTNEXT 1 16 0 0 0 1 0 0 0 1 0 0 0 1 4-4disc.dat ``` If I modify the line `1 16 0 0 0 1 0 0 0 1 0 0 0 1 4-4disc.dat` the error "Invalid use of 'BFC INVERTNEXT' / Flat subfile" gets duplicated.
1.0
The error "Invalid use of 'BFC INVERTNEXT' / Flat subfile" gets duplicated. - ``` 0 0 Name: new.dat 0 Author: Nils Schmidt [BlackBrick89] 0 !LDRAW_ORG Unofficial_Part 0 !LICENSE Redistributable under CCAL version 2.0 : see CAreadme.txt 0 BFC CERTIFY CCW 0 BFC INVERTNEXT 1 16 0 0 0 1 0 0 0 1 0 0 0 1 4-4disc.dat ``` If I modify the line `1 16 0 0 0 1 0 0 0 1 0 0 0 1 4-4disc.dat` the error "Invalid use of 'BFC INVERTNEXT' / Flat subfile" gets duplicated.
non_infrastructure
the error invalid use of bfc invertnext flat subfile gets duplicated name new dat author nils schmidt ldraw org unofficial part license redistributable under ccal version see careadme txt bfc certify ccw bfc invertnext dat if i modify the line dat the error invalid use of bfc invertnext flat subfile gets duplicated
0
33,890
27,974,317,005
IssuesEvent
2023-03-25 11:49:13
signalco-io/signalco
https://api.github.com/repos/signalco-io/signalco
opened
[Infrastructure] Manage CloudFlare emails using Pulumi
enhancement area:infrastructure
Transfer existing email configurations from manual CloudFlare configuration to Pulumi CloudFlare configuration.
1.0
[Infrastructure] Manage CloudFlare emails using Pulumi - Transfer existing email configurations from manual CloudFlare configuration to Pulumi CloudFlare configuration.
infrastructure
manage cloudflare emails using pulumi transfer existing email configurations from manual cloudflare configuration to pulumi cloudflare configuration
1
42,048
2,869,095,073
IssuesEvent
2015-06-05 23:17:42
dart-lang/test
https://api.github.com/repos/dart-lang/test
closed
Unit Testing documentation has errors
bug Fixed Priority-High
_Originally opened as dart-lang/sdk#5487_ *This issue was originally filed by naddi...&#064;gmail.com* _____ **What steps will reproduce the problem?** 1. Go to http://www.dartlang.org/articles/dart-unit-tests/ Where is talks about expecting errors there is the following example code test('Exception type', &nbsp;&nbsp;&nbsp;&nbsp;expect(()=&gt; throw 'X', &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;throwsA(new isInstanceOf&lt;String&gt;())); Firstly, there's a missing parenthesis, secondly, if run, I get the following error: Error: line 51 pos 19: unexpected token 'throw' &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;expect(()=&gt; throw 'X', If I try to correct it, I then get &quot;expression does no yield a value&quot;.
1.0
Unit Testing documentation has errors - _Originally opened as dart-lang/sdk#5487_ *This issue was originally filed by naddi...&#064;gmail.com* _____ **What steps will reproduce the problem?** 1. Go to http://www.dartlang.org/articles/dart-unit-tests/ Where is talks about expecting errors there is the following example code test('Exception type', &nbsp;&nbsp;&nbsp;&nbsp;expect(()=&gt; throw 'X', &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;throwsA(new isInstanceOf&lt;String&gt;())); Firstly, there's a missing parenthesis, secondly, if run, I get the following error: Error: line 51 pos 19: unexpected token 'throw' &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;expect(()=&gt; throw 'X', If I try to correct it, I then get &quot;expression does no yield a value&quot;.
non_infrastructure
unit testing documentation has errors originally opened as dart lang sdk this issue was originally filed by naddi gmail com what steps will reproduce the problem go to where is talks about expecting errors there is the following example code test exception type nbsp nbsp nbsp nbsp expect gt throw x nbsp nbsp nbsp nbsp nbsp nbsp nbsp nbsp throwsa new isinstanceof lt string gt firstly there s a missing parenthesis secondly if run i get the following error error line pos unexpected token throw nbsp nbsp nbsp nbsp nbsp nbsp expect gt throw x if i try to correct it i then get quot expression does no yield a value quot
0
34,852
30,511,852,429
IssuesEvent
2023-07-18 21:35:15
dotnet/runtime
https://api.github.com/repos/dotnet/runtime
opened
Enable AddressSanitizer on ARM64
arch-arm64 area-Infrastructure
Although Clang says it technically does not support AddressSanitizer on ARM64, it looks like Mac has support for it on ARM64. We should look at adding test legs for it to ensure that we don't have memory safety issues on our ARM64-specific code paths.
1.0
Enable AddressSanitizer on ARM64 - Although Clang says it technically does not support AddressSanitizer on ARM64, it looks like Mac has support for it on ARM64. We should look at adding test legs for it to ensure that we don't have memory safety issues on our ARM64-specific code paths.
infrastructure
enable addresssanitizer on although clang says it technically does not support addresssanitizer on it looks like mac has support for it on we should look at adding test legs for it to ensure that we don t have memory safety issues on our specific code paths
1
34,375
29,579,658,769
IssuesEvent
2023-06-07 04:03:38
APSIMInitiative/ApsimX
https://api.github.com/repos/APSIMInitiative/ApsimX
closed
SetEmergenceDate and SetGerminationDate should be in Phenology class
interface/infrastructure refactor
These are currently in Plant.cs /// <summary> /// Force emergence on the date called if emergence has not occured already /// </summary> public void SetEmergenceDate(string emergencedate) { foreach (EmergingPhase ep in Apsim.ChildrenRecursively(this, typeof(EmergingPhase))) { ep.EmergenceDate=emergencedate; } SetGerminationDate(SowingDate.ToString("d-MMM")); } /// <summary> /// Force germination on the date called if germination has not occured already /// </summary> public void SetGerminationDate(string germinationdate) { { foreach (GerminatingPhase gp in Apsim.ChildrenRecursively(this, typeof(GerminatingPhase))) { gp.GerminationDate = germinationdate; } } }
1.0
SetEmergenceDate and SetGerminationDate should be in Phenology class - These are currently in Plant.cs /// <summary> /// Force emergence on the date called if emergence has not occured already /// </summary> public void SetEmergenceDate(string emergencedate) { foreach (EmergingPhase ep in Apsim.ChildrenRecursively(this, typeof(EmergingPhase))) { ep.EmergenceDate=emergencedate; } SetGerminationDate(SowingDate.ToString("d-MMM")); } /// <summary> /// Force germination on the date called if germination has not occured already /// </summary> public void SetGerminationDate(string germinationdate) { { foreach (GerminatingPhase gp in Apsim.ChildrenRecursively(this, typeof(GerminatingPhase))) { gp.GerminationDate = germinationdate; } } }
infrastructure
setemergencedate and setgerminationdate should be in phenology class these are currently in plant cs force emergence on the date called if emergence has not occured already public void setemergencedate string emergencedate foreach emergingphase ep in apsim childrenrecursively this typeof emergingphase ep emergencedate emergencedate setgerminationdate sowingdate tostring d mmm force germination on the date called if germination has not occured already public void setgerminationdate string germinationdate foreach germinatingphase gp in apsim childrenrecursively this typeof germinatingphase gp germinationdate germinationdate
1
3,340
4,236,376,102
IssuesEvent
2016-07-05 18:12:31
freeorion/freeorion
https://api.github.com/repos/freeorion/freeorion
opened
Gamestate Updates with Diffs
enhancement feature idea infrastructure
Currently the server sends to full galaxy (and everything else) gamestate to all the players at least twice per turn. It would be potentially faster to just send what has changed between turns or to the next update. This would require implementing some sort of diff mechanism between gamestates, or tracking changes since the last update was sent.
1.0
Gamestate Updates with Diffs - Currently the server sends to full galaxy (and everything else) gamestate to all the players at least twice per turn. It would be potentially faster to just send what has changed between turns or to the next update. This would require implementing some sort of diff mechanism between gamestates, or tracking changes since the last update was sent.
infrastructure
gamestate updates with diffs currently the server sends to full galaxy and everything else gamestate to all the players at least twice per turn it would be potentially faster to just send what has changed between turns or to the next update this would require implementing some sort of diff mechanism between gamestates or tracking changes since the last update was sent
1
24,114
16,857,706,050
IssuesEvent
2021-06-21 08:59:10
mozilla/experimenter
https://api.github.com/repos/mozilla/experimenter
opened
Enable pytest-html HTML report for integration-tests
Enhancement Infrastructure Tests
We should enable the HTML report and capture it on CI to help debug failures. ┆Issue is synchronized with this [Jira Task](https://mozilla-hub.atlassian.net/browse/EXP-1409)
1.0
Enable pytest-html HTML report for integration-tests - We should enable the HTML report and capture it on CI to help debug failures. ┆Issue is synchronized with this [Jira Task](https://mozilla-hub.atlassian.net/browse/EXP-1409)
infrastructure
enable pytest html html report for integration tests we should enable the html report and capture it on ci to help debug failures ┆issue is synchronized with this
1
4,235
4,913,325,637
IssuesEvent
2016-11-23 12:08:58
kbenoit/quanteda
https://api.github.com/repos/kbenoit/quanteda
closed
Ready data object objects for new API
infrastructure
Involves: - [ ] renaming the data objects - [ ] deprecating old functions, through aliasing and other references - [ ] adding tests - [ ] updating documentation
1.0
Ready data object objects for new API - Involves: - [ ] renaming the data objects - [ ] deprecating old functions, through aliasing and other references - [ ] adding tests - [ ] updating documentation
infrastructure
ready data object objects for new api involves renaming the data objects deprecating old functions through aliasing and other references adding tests updating documentation
1
18,001
12,719,036,180
IssuesEvent
2020-06-24 08:36:44
dotnet/runtime
https://api.github.com/repos/dotnet/runtime
closed
Lengthy RuntimeIdentifierGraph update roundtrip with SDK
area-Infrastructure-coreclr untriaged
A change to `src/libraries/pkg/Microsoft.NETCore.Platforms/runtime.json` requires a full update cycle, which includes: 1. a PR updating `runtime.json` merged in runtime repo 2. SDK repo picks up runtime change 3. runtime picks up the updated SDK This blocks building CLR tests on a new platform, until all of the above has happened (or we patch SDK after the restore). For example, my current workaround is: ```sh # workaround: overwrite file containing updated RIDs from libraries /runtime $ cp src/libraries/pkg/Microsoft.NETCore.Platforms/runtime.json \ .dotnet/sdk/5.0.100-preview.6.20310.4/RuntimeIdentifierGraph.json # then cross-compile CLR tests without getting restore errors /runtime $ ROOTFS_DIR=$(pwd)/.tools/rootfs/x64 ./src/coreclr/build-test.sh \ -x64 -cross -os illumos -gcc ``` In the age of live-live builds, is it possible to ensure `LiveRuntimeIdentifierGraphPath` from `eng/liveBuilds.targets` is properly picked up during the SDK resolution for test build? Currently it seem to have no effect (despite being imported in `src/coreclr/tests/src/Common/test_dependencies/test_dependencies.csproj`) and SDK ends up using `.dotnet/sdk/<version>/RuntimeIdentifierGraph.json`, instead of the `runtime.json` file pointed by `LiveRuntimeIdentifierGraphPath`. cc @jashook, @jkotas
1.0
Lengthy RuntimeIdentifierGraph update roundtrip with SDK - A change to `src/libraries/pkg/Microsoft.NETCore.Platforms/runtime.json` requires a full update cycle, which includes: 1. a PR updating `runtime.json` merged in runtime repo 2. SDK repo picks up runtime change 3. runtime picks up the updated SDK This blocks building CLR tests on a new platform, until all of the above has happened (or we patch SDK after the restore). For example, my current workaround is: ```sh # workaround: overwrite file containing updated RIDs from libraries /runtime $ cp src/libraries/pkg/Microsoft.NETCore.Platforms/runtime.json \ .dotnet/sdk/5.0.100-preview.6.20310.4/RuntimeIdentifierGraph.json # then cross-compile CLR tests without getting restore errors /runtime $ ROOTFS_DIR=$(pwd)/.tools/rootfs/x64 ./src/coreclr/build-test.sh \ -x64 -cross -os illumos -gcc ``` In the age of live-live builds, is it possible to ensure `LiveRuntimeIdentifierGraphPath` from `eng/liveBuilds.targets` is properly picked up during the SDK resolution for test build? Currently it seem to have no effect (despite being imported in `src/coreclr/tests/src/Common/test_dependencies/test_dependencies.csproj`) and SDK ends up using `.dotnet/sdk/<version>/RuntimeIdentifierGraph.json`, instead of the `runtime.json` file pointed by `LiveRuntimeIdentifierGraphPath`. cc @jashook, @jkotas
infrastructure
lengthy runtimeidentifiergraph update roundtrip with sdk a change to src libraries pkg microsoft netcore platforms runtime json requires a full update cycle which includes a pr updating runtime json merged in runtime repo sdk repo picks up runtime change runtime picks up the updated sdk this blocks building clr tests on a new platform until all of the above has happened or we patch sdk after the restore for example my current workaround is sh workaround overwrite file containing updated rids from libraries runtime cp src libraries pkg microsoft netcore platforms runtime json dotnet sdk preview runtimeidentifiergraph json then cross compile clr tests without getting restore errors runtime rootfs dir pwd tools rootfs src coreclr build test sh cross os illumos gcc in the age of live live builds is it possible to ensure liveruntimeidentifiergraphpath from eng livebuilds targets is properly picked up during the sdk resolution for test build currently it seem to have no effect despite being imported in src coreclr tests src common test dependencies test dependencies csproj and sdk ends up using dotnet sdk runtimeidentifiergraph json instead of the runtime json file pointed by liveruntimeidentifiergraphpath cc jashook jkotas
1
26,255
19,829,636,571
IssuesEvent
2022-01-20 10:35:44
lampepfl/dotty
https://api.github.com/repos/lampepfl/dotty
opened
No errors shown on forwards/backwards compat test failure
area:infrastructure
## Compiler version When compiling with test with a file containing the `c3.0.0` name, the errors are not reported. ## Minimized example `pos/test/mytest/A_1_c3.0.0.scala` ```Scala def f: Int = match ``` `pos/test/mytest/B_2.scala` ```scala def test() = f ``` ## Output ``` sbt> testCompilation tests/pos/mytest ... [info] Test dotty.tools.dotc.CompilationTests.pos started -- [E006] Not Found Error: tests/pos/mytest/B_2.scala:1:13 ---------------------------------------- 1 |def test() = f | ^ | Not found: f Compilation failed for: 'tests/pos/mytest' [=======================================] completed (1/1, 1 failed, 5s) ... ``` ## Expectation The errors of `A_1_c3.0.0.scala` should be reported to be able to fix them easily. Note that it might be an error that only occurred in that version.
1.0
No errors shown on forwards/backwards compat test failure - ## Compiler version When compiling with test with a file containing the `c3.0.0` name, the errors are not reported. ## Minimized example `pos/test/mytest/A_1_c3.0.0.scala` ```Scala def f: Int = match ``` `pos/test/mytest/B_2.scala` ```scala def test() = f ``` ## Output ``` sbt> testCompilation tests/pos/mytest ... [info] Test dotty.tools.dotc.CompilationTests.pos started -- [E006] Not Found Error: tests/pos/mytest/B_2.scala:1:13 ---------------------------------------- 1 |def test() = f | ^ | Not found: f Compilation failed for: 'tests/pos/mytest' [=======================================] completed (1/1, 1 failed, 5s) ... ``` ## Expectation The errors of `A_1_c3.0.0.scala` should be reported to be able to fix them easily. Note that it might be an error that only occurred in that version.
infrastructure
no errors shown on forwards backwards compat test failure compiler version when compiling with test with a file containing the name the errors are not reported minimized example pos test mytest a scala scala def f int match pos test mytest b scala scala def test f output sbt testcompilation tests pos mytest test dotty tools dotc compilationtests pos started not found error tests pos mytest b scala def test f not found f compilation failed for tests pos mytest completed failed expectation the errors of a scala should be reported to be able to fix them easily note that it might be an error that only occurred in that version
1
4,357
10,965,734,316
IssuesEvent
2019-11-28 04:13:34
fga-eps-mds/2019.2-Over26
https://api.github.com/repos/fga-eps-mds/2019.2-Over26
closed
Atualizar diagramas do Documento de Arquitetura
Architecture Documentation EPS
## Descrição da Mudança * <!--- Forneça um resumo geral da _issue_ --> É necessário adequar os diagramas presentes no Documento de Arquitetura à atual estrutura do projeto. ## Checklist * <!-- Essa checklist propõe a criação de uma boa issue --> <!-- Se a issue é sobre uma história de usuário, seu nome deve ser "USXX - Nome da história--> <!-- Se a issue é sobre um bug, seu nome deve ser "BF - Nome curto do bug"--> <!-- Se a issue é sobre outra tarefa o nome deve ser uma simples descrição da tarefa--> - [x] Esta issue tem um nome significativo. - [x] O nome da issue está no padrão. - [x] Esta issue tem uma descrição de fácil entendimento. - [x] Esta issue tem uma boa definição de critérios de aceitação. - [x] Esta issue tem labels associadas. - [ ] Esta issue está associada à uma milestone. - [ ] Esta issue tem uma pontuação estimada. ## Tarefas * <!-- Adicione aqui as tarefas necessárias para concluir a issue --> - [x] Atualizar diagrama de classes - [x] Atualizar diagrama lógico - [x] Atualizar diagrama de pacotes ## Critérios de Aceitação * <!-- Liste aqui o conjunto de aspectos mecessários para considerar a atividade como completa--> <!-- Os itens serão adicionados pelo Product Owner --> - [x] Diagramas atualizados.
1.0
Atualizar diagramas do Documento de Arquitetura - ## Descrição da Mudança * <!--- Forneça um resumo geral da _issue_ --> É necessário adequar os diagramas presentes no Documento de Arquitetura à atual estrutura do projeto. ## Checklist * <!-- Essa checklist propõe a criação de uma boa issue --> <!-- Se a issue é sobre uma história de usuário, seu nome deve ser "USXX - Nome da história--> <!-- Se a issue é sobre um bug, seu nome deve ser "BF - Nome curto do bug"--> <!-- Se a issue é sobre outra tarefa o nome deve ser uma simples descrição da tarefa--> - [x] Esta issue tem um nome significativo. - [x] O nome da issue está no padrão. - [x] Esta issue tem uma descrição de fácil entendimento. - [x] Esta issue tem uma boa definição de critérios de aceitação. - [x] Esta issue tem labels associadas. - [ ] Esta issue está associada à uma milestone. - [ ] Esta issue tem uma pontuação estimada. ## Tarefas * <!-- Adicione aqui as tarefas necessárias para concluir a issue --> - [x] Atualizar diagrama de classes - [x] Atualizar diagrama lógico - [x] Atualizar diagrama de pacotes ## Critérios de Aceitação * <!-- Liste aqui o conjunto de aspectos mecessários para considerar a atividade como completa--> <!-- Os itens serão adicionados pelo Product Owner --> - [x] Diagramas atualizados.
non_infrastructure
atualizar diagramas do documento de arquitetura descrição da mudança é necessário adequar os diagramas presentes no documento de arquitetura à atual estrutura do projeto checklist esta issue tem um nome significativo o nome da issue está no padrão esta issue tem uma descrição de fácil entendimento esta issue tem uma boa definição de critérios de aceitação esta issue tem labels associadas esta issue está associada à uma milestone esta issue tem uma pontuação estimada tarefas atualizar diagrama de classes atualizar diagrama lógico atualizar diagrama de pacotes critérios de aceitação diagramas atualizados
0
63,020
26,229,618,789
IssuesEvent
2023-01-04 22:21:03
microsoft/vscode-cpptools
https://api.github.com/repos/microsoft/vscode-cpptools
closed
Intellisense glitches rapidly between C and C++ for header
bug Language Service regression verified
### Environment OS: Windows 10.0.19042 Build 19042 VSCode: 1.70.0 C/C++ Extension v1.11.4 I tried disabling all other extensions, problem still occurs. Often but not always, any .h header file will make the language mode rapidly switch back and forth between C and C++, causing extreme lag and flickering of syntax highlighting. This happens despite any overridden language mode setting for the file. When no glitching occurs, overriding the language mode to C will switch to C++ instantly. (see animated screenshot) ![Recording 2022-08-05 at 12 46 02](https://user-images.githubusercontent.com/55514761/183063960-ef7c4056-ae8b-49ae-8e25-d1aadfa6f199.gif) ### Bug Summary and Steps to Reproduce Bug Summary: Header files cause intellisense to rapidly switch between C/C++ language mode. Steps to reproduce: 1. Open .h header file 2. It probably starts glitching OR 1. Have .h header file open 2. Something triggers the start of glitching globally ### Expected behavior Should stay at the language I or it chose. ### Code sample and Logs ```shell - use any header `c_cpp_propeties.json` { "configurations": [ { "name": "OpenWatcom DOS", "includePath": [ "${workspaceFolder}/src/**", "C:/WATCOM/h/**" ], "defines": [ "_DEBUG", "UNICODE", "_UNICODE", "far=/**/", "__far=/**/", "near=/**/", "__near=/**/", "huge=/**/", "__huge=/**/", "interrupt=/**/", "__interrupt=/**/", "__WATCOMC__" ], "compilerPath": "C:/Program Files (x86)/Microsoft Visual Studio/2019/Community/VC/Tools/MSVC/14.29.30037/bin/Hostx64/x64/cl.exe", "cStandard": "c89", "cppStandard": "c++17", "intelliSenseMode": "windows-msvc-x86" } ], "version": 4 } - Log Diagnostics output not relevant Language server logs: loggingLevel: Debug loggingLevel has changed to: Debug File exclude: **/.vscode File exclude: **/.vs File exclude: **/.git File exclude: **/.svn File exclude: **/.hg File exclude: **/CVS File exclude: **/.DS_Store File exclude: **/Thumbs.db Search exclude: **/node_modules Search exclude: **/bower_components Search exclude: **/*.code-search Discovering files... Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/ATLMFC/INCLUDE Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/INCLUDE Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/CPPWINRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/SHARED/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UCRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UM/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/WINRT/ Processing folder (recursive): C:/WATCOM/H/ Processing folder (recursive): C:/DOS/KLAMWATC/ Discovering files: 5995 file(s) processed 158 file(s) removed from database Done discovering files. Populating include completion cache. Parsing remaining files... Parsing: 0 files(s) processed Done parsing remaining files. Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Aborting tag parse of C:\DOS\KLAMWATC\SRC\G_ASSETS.H and dependencies Discovering files... Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/ATLMFC/INCLUDE Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/INCLUDE Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/CPPWINRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/SHARED/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UCRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UM/ Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/WINRT/ Processing folder (recursive): C:/WATCOM/H/ Processing folder (recursive): C:/DOS/KLAMWATC/ Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Discovering files: 6153 file(s) processed 0 file(s) removed from database Done discovering files. Populating include completion cache. Parsing remaining files... Parsing: 0 files(s) processed Done parsing remaining files. Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C <infinite loop...> ``` ### Screenshots ![Recording 2022-08-05 at 12 46 02](https://user-images.githubusercontent.com/55514761/183062094-ea2b2e25-1f26-43cc-aad6-606aab3a5437.gif) ### Additional context _No response_
1.0
Intellisense glitches rapidly between C and C++ for header - ### Environment OS: Windows 10.0.19042 Build 19042 VSCode: 1.70.0 C/C++ Extension v1.11.4 I tried disabling all other extensions, problem still occurs. Often but not always, any .h header file will make the language mode rapidly switch back and forth between C and C++, causing extreme lag and flickering of syntax highlighting. This happens despite any overridden language mode setting for the file. When no glitching occurs, overriding the language mode to C will switch to C++ instantly. (see animated screenshot) ![Recording 2022-08-05 at 12 46 02](https://user-images.githubusercontent.com/55514761/183063960-ef7c4056-ae8b-49ae-8e25-d1aadfa6f199.gif) ### Bug Summary and Steps to Reproduce Bug Summary: Header files cause intellisense to rapidly switch between C/C++ language mode. Steps to reproduce: 1. Open .h header file 2. It probably starts glitching OR 1. Have .h header file open 2. Something triggers the start of glitching globally ### Expected behavior Should stay at the language I or it chose. ### Code sample and Logs ```shell - use any header `c_cpp_propeties.json` { "configurations": [ { "name": "OpenWatcom DOS", "includePath": [ "${workspaceFolder}/src/**", "C:/WATCOM/h/**" ], "defines": [ "_DEBUG", "UNICODE", "_UNICODE", "far=/**/", "__far=/**/", "near=/**/", "__near=/**/", "huge=/**/", "__huge=/**/", "interrupt=/**/", "__interrupt=/**/", "__WATCOMC__" ], "compilerPath": "C:/Program Files (x86)/Microsoft Visual Studio/2019/Community/VC/Tools/MSVC/14.29.30037/bin/Hostx64/x64/cl.exe", "cStandard": "c89", "cppStandard": "c++17", "intelliSenseMode": "windows-msvc-x86" } ], "version": 4 } - Log Diagnostics output not relevant Language server logs: loggingLevel: Debug loggingLevel has changed to: Debug File exclude: **/.vscode File exclude: **/.vs File exclude: **/.git File exclude: **/.svn File exclude: **/.hg File exclude: **/CVS File exclude: **/.DS_Store File exclude: **/Thumbs.db Search exclude: **/node_modules Search exclude: **/bower_components Search exclude: **/*.code-search Discovering files... Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/ATLMFC/INCLUDE Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/INCLUDE Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/CPPWINRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/SHARED/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UCRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UM/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/WINRT/ Processing folder (recursive): C:/WATCOM/H/ Processing folder (recursive): C:/DOS/KLAMWATC/ Discovering files: 5995 file(s) processed 158 file(s) removed from database Done discovering files. Populating include completion cache. Parsing remaining files... Parsing: 0 files(s) processed Done parsing remaining files. Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Aborting tag parse of C:\DOS\KLAMWATC\SRC\G_ASSETS.H and dependencies Discovering files... Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/ATLMFC/INCLUDE Processing folder (non-recursive): C:/PROGRAM FILES (X86)/MICROSOFT VISUAL STUDIO/2019/COMMUNITY/VC/TOOLS/MSVC/14.29.30133/INCLUDE Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/CPPWINRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/SHARED/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UCRT/ Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/UM/ Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Processing folder (recursive): C:/PROGRAM FILES (X86)/WINDOWS KITS/10/INCLUDE/10.0.19041.0/WINRT/ Processing folder (recursive): C:/WATCOM/H/ Processing folder (recursive): C:/DOS/KLAMWATC/ Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Discovering files: 6153 file(s) processed 0 file(s) removed from database Done discovering files. Populating include completion cache. Parsing remaining files... Parsing: 0 files(s) processed Done parsing remaining files. Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C Checking for syntax errors: C:\DOS\KLAMWATC\SRC\G_ASSETS.H Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_MAP.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\G_ASSETS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\W_MARS.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\E_PLAYER.C Queueing IntelliSense update for files in translation unit of: C:\DOS\KLAMWATC\SRC\MAIN.C <infinite loop...> ``` ### Screenshots ![Recording 2022-08-05 at 12 46 02](https://user-images.githubusercontent.com/55514761/183062094-ea2b2e25-1f26-43cc-aad6-606aab3a5437.gif) ### Additional context _No response_
non_infrastructure
intellisense glitches rapidly between c and c for header environment os windows build vscode c c extension i tried disabling all other extensions problem still occurs often but not always any h header file will make the language mode rapidly switch back and forth between c and c causing extreme lag and flickering of syntax highlighting this happens despite any overridden language mode setting for the file when no glitching occurs overriding the language mode to c will switch to c instantly see animated screenshot bug summary and steps to reproduce bug summary header files cause intellisense to rapidly switch between c c language mode steps to reproduce open h header file it probably starts glitching or have h header file open something triggers the start of glitching globally expected behavior should stay at the language i or it chose code sample and logs shell use any header c cpp propeties json configurations name openwatcom dos includepath workspacefolder src c watcom h defines debug unicode unicode far far near near huge huge interrupt interrupt watcomc compilerpath c program files microsoft visual studio community vc tools msvc bin cl exe cstandard cppstandard c intellisensemode windows msvc version log diagnostics output not relevant language server logs logginglevel debug logginglevel has changed to debug file exclude vscode file exclude vs file exclude git file exclude svn file exclude hg file exclude cvs file exclude ds store file exclude thumbs db search exclude node modules search exclude bower components search exclude code search discovering files processing folder non recursive c program files microsoft visual studio community vc tools msvc atlmfc include processing folder non recursive c program files microsoft visual studio community vc tools msvc include processing folder recursive c program files windows kits include cppwinrt processing folder recursive c program files windows kits include shared processing folder recursive c program files windows kits include ucrt processing folder recursive c program files windows kits include um processing folder recursive c program files windows kits include winrt processing folder recursive c watcom h processing folder recursive c dos klamwatc discovering files file s processed file s removed from database done discovering files populating include completion cache parsing remaining files parsing files s processed done parsing remaining files checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c aborting tag parse of c dos klamwatc src g assets h and dependencies discovering files processing folder non recursive c program files microsoft visual studio community vc tools msvc atlmfc include processing folder non recursive c program files microsoft visual studio community vc tools msvc include processing folder recursive c program files windows kits include cppwinrt processing folder recursive c program files windows kits include shared processing folder recursive c program files windows kits include ucrt processing folder recursive c program files windows kits include um checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c processing folder recursive c program files windows kits include winrt processing folder recursive c watcom h processing folder recursive c dos klamwatc checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c discovering files file s processed file s removed from database done discovering files populating include completion cache parsing remaining files parsing files s processed done parsing remaining files checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c checking for syntax errors c dos klamwatc src g assets h queueing intellisense update for files in translation unit of c dos klamwatc src e map c queueing intellisense update for files in translation unit of c dos klamwatc src g assets c queueing intellisense update for files in translation unit of c dos klamwatc src w mars c queueing intellisense update for files in translation unit of c dos klamwatc src e player c queueing intellisense update for files in translation unit of c dos klamwatc src main c screenshots additional context no response
0
52,188
13,211,404,221
IssuesEvent
2020-08-15 22:54:17
icecube-trac/tix4
https://api.github.com/repos/icecube-trac/tix4
opened
[simprod-scripts] polyplopia without gpus (Trac #1814)
Incomplete Migration Migrated from Trac combo simulation defect
<details> <summary><em>Migrated from <a href="https://code.icecube.wisc.edu/projects/icecube/ticket/1814">https://code.icecube.wisc.edu/projects/icecube/ticket/1814</a>, reported by david.schultzand owned by juancarlos</em></summary> <p> ```json { "status": "closed", "changetime": "2019-02-13T14:13:35", "_ts": "1550067215093672", "description": "Currently, the PolyplopiaPhotons segment can only be used with gpus. This makes testing difficult, and should be flexible anyway.\n\nhttp://code.icecube.wisc.edu/projects/icecube/browser/IceCube/projects/simprod-scripts/trunk/python/segments/Polyplopia.py#L184\n\n", "reporter": "david.schultz", "cc": "", "resolution": "fixed", "time": "2016-08-08T19:50:06", "component": "combo simulation", "summary": "[simprod-scripts] polyplopia without gpus", "priority": "critical", "keywords": "", "milestone": "", "owner": "juancarlos", "type": "defect" } ``` </p> </details>
1.0
[simprod-scripts] polyplopia without gpus (Trac #1814) - <details> <summary><em>Migrated from <a href="https://code.icecube.wisc.edu/projects/icecube/ticket/1814">https://code.icecube.wisc.edu/projects/icecube/ticket/1814</a>, reported by david.schultzand owned by juancarlos</em></summary> <p> ```json { "status": "closed", "changetime": "2019-02-13T14:13:35", "_ts": "1550067215093672", "description": "Currently, the PolyplopiaPhotons segment can only be used with gpus. This makes testing difficult, and should be flexible anyway.\n\nhttp://code.icecube.wisc.edu/projects/icecube/browser/IceCube/projects/simprod-scripts/trunk/python/segments/Polyplopia.py#L184\n\n", "reporter": "david.schultz", "cc": "", "resolution": "fixed", "time": "2016-08-08T19:50:06", "component": "combo simulation", "summary": "[simprod-scripts] polyplopia without gpus", "priority": "critical", "keywords": "", "milestone": "", "owner": "juancarlos", "type": "defect" } ``` </p> </details>
non_infrastructure
polyplopia without gpus trac migrated from json status closed changetime ts description currently the polyplopiaphotons segment can only be used with gpus this makes testing difficult and should be flexible anyway n n reporter david schultz cc resolution fixed time component combo simulation summary polyplopia without gpus priority critical keywords milestone owner juancarlos type defect
0
23,950
16,717,965,853
IssuesEvent
2021-06-10 01:14:04
dotnet/runtime
https://api.github.com/repos/dotnet/runtime
closed
Build failed: Validate-DotNet/main #runtime-90819-.NET6
area-Infrastructure untriaged
Build [#runtime-90819-.NET6](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_build/results?buildId=1146754) failed ## :x: : internal / Validate-DotNet failed ### Summary **Finished** - Thu, 20 May 2021 03:58:51 GMT **Duration** - 293 minutes **Requested for** - DotNet Bot **Reason** - manual ### Details #### Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/151) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.PGO.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 5 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.ios-arm64.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Symbols missing for 4 packages - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - PowerShell exited with code '1'. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/289) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/226) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/244) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/297) - Git fetch failed with exit code 128, back off 9.496 seconds before retry. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - ValidateSymbols: Entry found in generated contract does not match ValidateSymbols. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - Steps were not validated for contract. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - Contract was not validated. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - PowerShell exited with code '1'. #### Required Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/161) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/252) - Number of checksums and assets don't match. Checksums: 182. Assets: 794. Assets with no corresponding checksum are: assets/symbols/System.Security.Cryptography.Xml.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Permissions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Principal.Windows.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg Runtime/6.0.0-preview.6.21269.5/runtime-productVersion.txt assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Configuration.ConfigurationManager.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Collections.Immutable.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.CodeDom.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.Win32.SystemEvents Microsoft.NETCore.App.Runtime.Mono.tvos-arm64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64 Microsoft.NETCore.App.Runtime.Mono.osx-arm64 Microsoft.NETCore.App.Runtime.Mono.osx-x64 Microsoft.NETCore.App.Runtime.osx-x64 Microsoft.NETCore.App.Runtime.Mono.win-x64 runtime.linux-musl-arm.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Runtime.win-arm64 runtime.native.System.IO.Ports Microsoft.NETCore.App.Runtime.Mono.linux-arm runtime.osx-arm64.Microsoft.NETCore.DotNetHost runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.TestHost Microsoft.Extensions.Logging Microsoft.Extensions.Logging.Abstractions Microsoft.Extensions.Logging.Console Microsoft.Extensions.Logging.Debug Microsoft.Extensions.Logging.Configuration Microsoft.Extensions.Logging.EventLog Microsoft.Extensions.Logging.EventSource Microsoft.Extensions.Logging.TraceSource Microsoft.Extensions.Options Microsoft.Extensions.Options.ConfigurationExtensions Microsoft.Extensions.Options.DataAnnotations Microsoft.Extensions.Primitives Microsoft.ILVerification Microsoft.IO.Redist Microsoft.NETCore.App.Crossgen2.linux-musl-arm64 Microsoft.Extensions.Hosting.WindowsServices Microsoft.Extensions.Hosting.Abstractions dotnet-ilverify Microsoft.Bcl.AsyncInterfaces Microsoft.Extensions.Configuration.Json Microsoft.Extensions.Configuration.UserSecrets Microsoft.Extensions.Configuration.Xml Microsoft.Extensions.DependencyInjection Microsoft.Extensions.DependencyInjection.Abstractions Microsoft.Extensions.FileProviders.Abstractions Microsoft.Extensions.DependencyInjection.Specification.Tests Microsoft.Extensions.DependencyModel Microsoft.Extensions.FileSystemGlobbing Microsoft.Extensions.Hosting assets/symbols/runtime.linux-arm.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.linux-arm64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86 Microsoft.NETCore.App.Runtime.linux-musl-arm64 Microsoft.NETCore.App.Runtime.linux-musl-x64 Microsoft.NETCore.App.Runtime.Mono.android-arm64 Microsoft.NETCore.App.Runtime.Mono.android-x64 Microsoft.NETCore.App.Runtime.linux-musl-arm Microsoft.NETCore.App.Crossgen2.linux-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64 Microsoft.NETCore.App.Crossgen2.win-x64 Microsoft.NETCore.App.Crossgen2.win-arm64 Microsoft.NETCore.App.Host.win-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64 assets/symbols/Microsoft.NETCore.App.Host.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.Android.Sample.Mono.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.iOS.Sample.Mono.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.MonoAOTCompiler.Task.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.RuntimeConfigParser.Task.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.wasm.Sample.Mono.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.WebAssembly.Sdk.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Sdk.IL.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Win32.SystemEvents.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Windows.Compatibility.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.XmlSerializer.Generator.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.Extensions.FileProviders.Composite Microsoft.Extensions.FileProviders.Physical Microsoft.NETCore.App.Crossgen2.osx-arm64 Microsoft.Extensions.Configuration.Ini Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64 Microsoft.NETCore.App.Runtime.linux-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.linux-x64 Microsoft.NETCore.App.Runtime.Mono.android-arm Microsoft.NETCore.App.Runtime.Mono.android-x86 Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86 runtime.win-x86.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Host.win-arm64 assets/symbols/Microsoft.NETCore.App.PGO.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Windows.Extensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Formats.Asn1.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Formats.Cbor.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Packaging.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Pipes.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Pipelines.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Data.OleDb.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Net.Http.WinHttpHandler.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Memory.Data.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Net.Http.Json.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Numerics.Tensors.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Reflection.Context.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Reflection.Metadata.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Reflection.MetadataLoadContext.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Resources.Extensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Runtime.Caching.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Runtime.CompilerServices.Unsafe.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Cryptography.Pkcs.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Cryptography.ProtectedData.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Management.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg Runtime/6.0.0-preview.6.21269.5/productVersion.txt runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver Microsoft.Win32.Registry Microsoft.NETCore.TestHost Microsoft.NETCore.Platforms Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64 Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64 Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64 Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64 Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.osx-arm64 Microsoft.NETCore.App.Runtime.win-x64 Microsoft.NETCore.DotNetAppHost runtime.linux-musl-x64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.DotNetAppHost runtime.osx-arm64.Microsoft.NETCore.ILAsm runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm runtime.linux-x64.Microsoft.NETCore.DotNetHost runtime.linux-x64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-x64.Microsoft.NETCore.ILDAsm runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver runtime.linux-x64.Microsoft.NETCore.TestHost runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-x64.runtime.native.System.IO.Ports Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64 Microsoft.NETCore.App.Runtime.Mono.linux-arm64 Microsoft.NETCore.App.Host.linux-arm64 Microsoft.NETCore.App.Host.linux-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm Microsoft.NETCore.App.Host.linux-musl-arm64 Microsoft.NETCore.App.Host.linux-musl-arm Microsoft.NETCore.App.Host.linux-x64 Microsoft.NETCore.App.Host.osx-arm64 Microsoft.NETCore.App.Host.win-arm Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm Microsoft.NETCore.App.Host.win-x86 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64 Microsoft.NETCore.App.Ref Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Ref.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg runtime.win-x86.Microsoft.NETCore.DotNetHost assets/symbols/Microsoft.NETCore.App.Runtime.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.BrowserDebugHost.Transport.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.DirectoryServices.Protocols.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Diagnostics.EventLog.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Diagnostics.DiagnosticSource.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Diagnostics.PerformanceCounter.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.DirectoryServices.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.DirectoryServices.AccountManagement.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Drawing.Common.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.FileSystem.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ComponentModel.Composition.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ComponentModel.Composition.Registration.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.Convention.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.AttributedModel.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.Runtime.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.Hosting.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvos-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg System.Memory.Data assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg System.Net.Http.WinHttpHandler System.Net.Http.Json assets/symbols/Microsoft.NET.HostModel.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Net.HostModel.PGO.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.ILVerification.6.0.0-preview.6.21269.5.symbols.nupkg System.Numerics.Tensors System.Reflection.Metadata System.Reflection.MetadataLoadContext System.Reflection.Context System.Resources.Extensions System.Runtime.Caching System.Security.Cryptography.Pkcs System.Runtime.CompilerServices.Unsafe System.Security.AccessControl System.Security.Cryptography.ProtectedData System.Security.Cryptography.Xml System.Security.Principal.Windows System.Security.Permissions System.ServiceModel.Syndication System.ServiceProcess.ServiceController System.Speech System.Text.Encoding.CodePages System.Text.Encodings.Web System.Data.Odbc System.Composition.TypedParts System.DirectoryServices System.Diagnostics.PerformanceCounter System.Formats.Asn1 System.DirectoryServices.Protocols System.Formats.Cbor System.IO.Packaging assets/symbols/Microsoft.Extensions.DependencyInjection.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Json.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Http.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Configuration.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Primitives.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.DataAnnotations.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Ini.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ServiceProcess.ServiceController.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Text.Encoding.CodePages.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Speech.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Text.Json.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Text.Encodings.Web.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Threading.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Threading.Tasks.Dataflow.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Threading.Channels.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ServiceModel.Syndication.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost runtime.linux-arm64.Microsoft.NETCore.DotNetHost runtime.linux-arm64.runtime.native.System.IO.Ports runtime.osx-x64.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.TestHost runtime.osx-x64.Microsoft.NETCore.DotNetHost runtime.osx-x64.Microsoft.NETCore.ILAsm runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver runtime.osx-x64.Microsoft.NETCore.ILDAsm runtime.win-arm.Microsoft.NETCore.DotNetAppHost runtime.osx-x64.Microsoft.NETCore.TestHost runtime.win-arm.Microsoft.NETCore.DotNetHost runtime.osx-x64.runtime.native.System.IO.Ports runtime.win-arm64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy runtime.win-arm.Microsoft.NETCore.DotNetHostResolver runtime.win-arm.Microsoft.NETCore.ILAsm runtime.win-arm.Microsoft.NETCore.ILDAsm runtime.osx-arm64.Microsoft.NETCore.TestHost runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver runtime.win-arm64.Microsoft.NETCore.DotNetHost runtime.win-x64.Microsoft.NETCore.DotNetAppHost runtime.win-x64.Microsoft.NETCore.DotNetHost runtime.win-arm64.Microsoft.NETCore.ILAsm runtime.win-arm64.Microsoft.NETCore.ILDAsm Microsoft.NETCore.App.Runtime.Mono.linux-x64 runtime.win-arm64.Microsoft.NETCore.TestHost runtime.win-x64.Microsoft.NETCore.DotNetHostResolver runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy runtime.win-x64.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Crossgen2.linux-arm Microsoft.NET.Runtime.WebAssembly.Sdk Microsoft.NET.Sdk.IL Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100 Microsoft.Diagnostics.Tracing.EventSource.Redist Microsoft.Extensions.Caching.Abstractions Microsoft.Extensions.Caching.Memory Microsoft.NETCore.App.Crossgen2.linux-musl-x64 Microsoft.Extensions.Configuration.Binder Microsoft.Extensions.Configuration.Abstractions Microsoft.Extensions.Configuration Microsoft.Extensions.Hosting.Systemd Microsoft.Extensions.Configuration.CommandLine Microsoft.Extensions.Configuration.EnvironmentVariables Microsoft.Extensions.Configuration.FileExtensions runtime.win-x64.Microsoft.NETCore.TestHost runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg System.Text.Json System.Threading.AccessControl System.Threading.Channels System.Threading.Tasks.Dataflow System.Windows.Extensions System.IO.Pipes.AccessControl System.IO.Ports System.Management System.IO.Pipelines runtime.win-x86.Microsoft.NETCore.ILDAsm runtime.win-x86.Microsoft.NETCore.DotNetHostResolver runtime.win-x86.Microsoft.NETCore.ILAsm runtime.win-x86.Microsoft.NETCore.TestHost System.Collections.Immutable System.CodeDom System.ComponentModel.Composition System.ComponentModel.Composition.Registration System.Composition System.Composition.Convention System.Composition.AttributedModel System.Composition.Hosting System.Composition.Runtime assets/symbols/Microsoft.IO.Redist.6.0.0-preview.6.21269.5.symbols.nupkg System.Diagnostics.DiagnosticSource System.Data.OleDb System.Diagnostics.EventLog System.DirectoryServices.AccountManagement System.Drawing.Common System.IO.FileSystem.AccessControl System.Configuration.ConfigurationManager assets/symbols/Microsoft.Extensions.Hosting.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.HostFactoryResolver.Sources.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Systemd.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Console.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventSource.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventLog.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.TraceSource.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.ConfigurationExtensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.WindowsServices.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.UserSecrets.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.EnvironmentVariables.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.FileExtensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Diagnostics.Tracing.EventSource.Redist.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Data.Odbc.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.TypedParts.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg runtime.linux-arm.Microsoft.NETCore.DotNetAppHost Microsoft.Win32.Registry.AccessControl assets/symbols/runtime.linux-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.Windows.Compatibility Microsoft.XmlSerializer.Generator runtime.linux-arm.Microsoft.NETCore.TestHost runtime.linux-arm.Microsoft.NETCore.DotNetHost runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver runtime.linux-arm.Microsoft.NETCore.ILDAsm runtime.linux-arm.Microsoft.NETCore.ILAsm runtime.linux-arm.runtime.native.System.IO.Ports runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-arm64.Microsoft.NETCore.ILAsm runtime.linux-arm64.Microsoft.NETCore.ILDAsm runtime.linux-arm64.Microsoft.NETCore.TestHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy Microsoft.NETCore.App.Runtime.win-arm Microsoft.NETCore.App.Runtime.win-x86 Microsoft.NETCore.DotNetHost Microsoft.NETCore.DotNetHostPolicy Microsoft.NETCore.ILAsm Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.App.Runtime.Mono.win-x86 runtime.win-x64.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.TestHost runtime.osx-arm64.Microsoft.NETCore.ILDAsm runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm64.Microsoft.NETCore.TestHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.App.Composite Microsoft.Extensions.Http Microsoft.NET.Runtime.Android.Sample.Mono Microsoft.NET.Runtime.iOS.Sample.Mono Microsoft.NET.Runtime.wasm.Sample.Mono Microsoft.NET.Runtime.MonoAOTCompiler.Task Microsoft.NET.Runtime.RuntimeConfigParser.Task Microsoft.NETCore.App.Crossgen2.linux-arm64 Microsoft.NETCore.App.Crossgen2.linux-musl-arm Microsoft.NETCore.App.Runtime.Mono.ios-arm Microsoft.NETCore.App.Runtime.Mono.browser-wasm Microsoft.NETCore.App.Runtime.Mono.ios-arm64 Microsoft.NETCore.App.Crossgen2.osx-x64 Microsoft.NETCore.App.Crossgen2.win-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm Microsoft.NETCore.App.Host.linux-musl-x64 Microsoft.NETCore.App.Crossgen2.win-x86 Microsoft.NETCore.App.Host.osx-x64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64 assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Composite.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Private.CoreFx.OOB.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Xml.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.Specification.Tests.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyModel.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Composite.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Physical.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileSystemGlobbing.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Debug.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.CommandLine.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.AspNetCore.Internal.Transport.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Binder.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/dotnet-pgo.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Memory.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Bcl.AsyncInterfaces.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/dotnet-ilverify.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/ILCompiler.Reflection.ReadyToRun.Experimental.6.0.0-preview.6.21269.5.symbols.nupkg - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/255) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/184) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/211) - Git fetch failed with exit code 128, back off 9.222 seconds before retry. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/259) - .packages\microsoft.dotnet.arcade.sdk\6.0.0-beta.21260.1\tools\SdkTasks\SigningValidation.proj(44,5): error MSB4181: (NETCORE_ENGINEERING_TELEMETRY=Build) The "SignCheckTask" task returned false but did not log an error. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - ValidateSigning-runtime: Entry found in generated contract does not match ValidateSigning-*. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - Steps were not validated for contract. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - Contract was not validated. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - PowerShell exited with code '1'. #### Signing Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/68) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/131) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Source Code Validation - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/54) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/74) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/105) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/120) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Prep Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/36) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. ### Changes - [dc6fef91](https://dev.azure.com/dnceng/internal/_git/dotnet-release/commit/dc6fef91431602f67899d946d02c0eb6292a8446) - Michelle McDaniel - Merged PR 15096: Use dotnetstage storage account for 5.x+ repo propagation
1.0
Build failed: Validate-DotNet/main #runtime-90819-.NET6 - Build [#runtime-90819-.NET6](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_build/results?buildId=1146754) failed ## :x: : internal / Validate-DotNet failed ### Summary **Finished** - Thu, 20 May 2021 03:58:51 GMT **Duration** - 293 minutes **Requested for** - DotNet Bot **Reason** - manual ### Details #### Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/151) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.PGO.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 5 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.ios-arm64.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64.6.0.0-preview.6.21269.5.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Symbols missing for 4 packages - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/280) - PowerShell exited with code '1'. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/289) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/226) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/244) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/297) - Git fetch failed with exit code 128, back off 9.496 seconds before retry. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - ValidateSymbols: Entry found in generated contract does not match ValidateSymbols. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - Steps were not validated for contract. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - Contract was not validated. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/303) - PowerShell exited with code '1'. #### Required Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/161) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/252) - Number of checksums and assets don't match. Checksums: 182. Assets: 794. Assets with no corresponding checksum are: assets/symbols/System.Security.Cryptography.Xml.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Permissions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Principal.Windows.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg Runtime/6.0.0-preview.6.21269.5/runtime-productVersion.txt assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Configuration.ConfigurationManager.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Collections.Immutable.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.CodeDom.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.Win32.SystemEvents Microsoft.NETCore.App.Runtime.Mono.tvos-arm64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64 Microsoft.NETCore.App.Runtime.Mono.osx-arm64 Microsoft.NETCore.App.Runtime.Mono.osx-x64 Microsoft.NETCore.App.Runtime.osx-x64 Microsoft.NETCore.App.Runtime.Mono.win-x64 runtime.linux-musl-arm.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Runtime.win-arm64 runtime.native.System.IO.Ports Microsoft.NETCore.App.Runtime.Mono.linux-arm runtime.osx-arm64.Microsoft.NETCore.DotNetHost runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.TestHost Microsoft.Extensions.Logging Microsoft.Extensions.Logging.Abstractions Microsoft.Extensions.Logging.Console Microsoft.Extensions.Logging.Debug Microsoft.Extensions.Logging.Configuration Microsoft.Extensions.Logging.EventLog Microsoft.Extensions.Logging.EventSource Microsoft.Extensions.Logging.TraceSource Microsoft.Extensions.Options Microsoft.Extensions.Options.ConfigurationExtensions Microsoft.Extensions.Options.DataAnnotations Microsoft.Extensions.Primitives Microsoft.ILVerification Microsoft.IO.Redist Microsoft.NETCore.App.Crossgen2.linux-musl-arm64 Microsoft.Extensions.Hosting.WindowsServices Microsoft.Extensions.Hosting.Abstractions dotnet-ilverify Microsoft.Bcl.AsyncInterfaces Microsoft.Extensions.Configuration.Json Microsoft.Extensions.Configuration.UserSecrets Microsoft.Extensions.Configuration.Xml Microsoft.Extensions.DependencyInjection Microsoft.Extensions.DependencyInjection.Abstractions Microsoft.Extensions.FileProviders.Abstractions Microsoft.Extensions.DependencyInjection.Specification.Tests Microsoft.Extensions.DependencyModel Microsoft.Extensions.FileSystemGlobbing Microsoft.Extensions.Hosting assets/symbols/runtime.linux-arm.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.linux-arm64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86 Microsoft.NETCore.App.Runtime.linux-musl-arm64 Microsoft.NETCore.App.Runtime.linux-musl-x64 Microsoft.NETCore.App.Runtime.Mono.android-arm64 Microsoft.NETCore.App.Runtime.Mono.android-x64 Microsoft.NETCore.App.Runtime.linux-musl-arm Microsoft.NETCore.App.Crossgen2.linux-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64 Microsoft.NETCore.App.Crossgen2.win-x64 Microsoft.NETCore.App.Crossgen2.win-arm64 Microsoft.NETCore.App.Host.win-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64 assets/symbols/Microsoft.NETCore.App.Host.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.Android.Sample.Mono.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.iOS.Sample.Mono.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.MonoAOTCompiler.Task.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.RuntimeConfigParser.Task.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.wasm.Sample.Mono.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.WebAssembly.Sdk.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Sdk.IL.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Win32.SystemEvents.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Windows.Compatibility.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.XmlSerializer.Generator.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.Extensions.FileProviders.Composite Microsoft.Extensions.FileProviders.Physical Microsoft.NETCore.App.Crossgen2.osx-arm64 Microsoft.Extensions.Configuration.Ini Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64 Microsoft.NETCore.App.Runtime.linux-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.linux-x64 Microsoft.NETCore.App.Runtime.Mono.android-arm Microsoft.NETCore.App.Runtime.Mono.android-x86 Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86 runtime.win-x86.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Host.win-arm64 assets/symbols/Microsoft.NETCore.App.PGO.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Windows.Extensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Formats.Asn1.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Formats.Cbor.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Packaging.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Pipes.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Pipelines.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Data.OleDb.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Net.Http.WinHttpHandler.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Memory.Data.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Net.Http.Json.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Numerics.Tensors.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Reflection.Context.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Reflection.Metadata.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Reflection.MetadataLoadContext.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Resources.Extensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Runtime.Caching.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Runtime.CompilerServices.Unsafe.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Cryptography.Pkcs.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Security.Cryptography.ProtectedData.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Management.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg Runtime/6.0.0-preview.6.21269.5/productVersion.txt runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver Microsoft.Win32.Registry Microsoft.NETCore.TestHost Microsoft.NETCore.Platforms Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64 Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64 Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64 Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64 Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.osx-arm64 Microsoft.NETCore.App.Runtime.win-x64 Microsoft.NETCore.DotNetAppHost runtime.linux-musl-x64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.DotNetAppHost runtime.osx-arm64.Microsoft.NETCore.ILAsm runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm runtime.linux-x64.Microsoft.NETCore.DotNetHost runtime.linux-x64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-x64.Microsoft.NETCore.ILDAsm runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver runtime.linux-x64.Microsoft.NETCore.TestHost runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-x64.runtime.native.System.IO.Ports Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64 Microsoft.NETCore.App.Runtime.Mono.linux-arm64 Microsoft.NETCore.App.Host.linux-arm64 Microsoft.NETCore.App.Host.linux-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm Microsoft.NETCore.App.Host.linux-musl-arm64 Microsoft.NETCore.App.Host.linux-musl-arm Microsoft.NETCore.App.Host.linux-x64 Microsoft.NETCore.App.Host.osx-arm64 Microsoft.NETCore.App.Host.win-arm Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm Microsoft.NETCore.App.Host.win-x86 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64 Microsoft.NETCore.App.Ref Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Ref.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg runtime.win-x86.Microsoft.NETCore.DotNetHost assets/symbols/Microsoft.NETCore.App.Runtime.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.BrowserDebugHost.Transport.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.DirectoryServices.Protocols.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Diagnostics.EventLog.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Diagnostics.DiagnosticSource.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Diagnostics.PerformanceCounter.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.DirectoryServices.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.DirectoryServices.AccountManagement.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Drawing.Common.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.IO.FileSystem.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ComponentModel.Composition.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ComponentModel.Composition.Registration.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.Convention.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.AttributedModel.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.Runtime.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.Hosting.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvos-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg System.Memory.Data assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm64.6.0.0-preview.6.21269.5.symbols.nupkg System.Net.Http.WinHttpHandler System.Net.Http.Json assets/symbols/Microsoft.NET.HostModel.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Net.HostModel.PGO.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.ILVerification.6.0.0-preview.6.21269.5.symbols.nupkg System.Numerics.Tensors System.Reflection.Metadata System.Reflection.MetadataLoadContext System.Reflection.Context System.Resources.Extensions System.Runtime.Caching System.Security.Cryptography.Pkcs System.Runtime.CompilerServices.Unsafe System.Security.AccessControl System.Security.Cryptography.ProtectedData System.Security.Cryptography.Xml System.Security.Principal.Windows System.Security.Permissions System.ServiceModel.Syndication System.ServiceProcess.ServiceController System.Speech System.Text.Encoding.CodePages System.Text.Encodings.Web System.Data.Odbc System.Composition.TypedParts System.DirectoryServices System.Diagnostics.PerformanceCounter System.Formats.Asn1 System.DirectoryServices.Protocols System.Formats.Cbor System.IO.Packaging assets/symbols/Microsoft.Extensions.DependencyInjection.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Json.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Http.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Configuration.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Primitives.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.DataAnnotations.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Ini.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ServiceProcess.ServiceController.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Text.Encoding.CodePages.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Speech.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Text.Json.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Text.Encodings.Web.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Threading.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Threading.Tasks.Dataflow.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Threading.Channels.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.ServiceModel.Syndication.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.native.System.IO.Ports.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost runtime.linux-arm64.Microsoft.NETCore.DotNetHost runtime.linux-arm64.runtime.native.System.IO.Ports runtime.osx-x64.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.TestHost runtime.osx-x64.Microsoft.NETCore.DotNetHost runtime.osx-x64.Microsoft.NETCore.ILAsm runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver runtime.osx-x64.Microsoft.NETCore.ILDAsm runtime.win-arm.Microsoft.NETCore.DotNetAppHost runtime.osx-x64.Microsoft.NETCore.TestHost runtime.win-arm.Microsoft.NETCore.DotNetHost runtime.osx-x64.runtime.native.System.IO.Ports runtime.win-arm64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy runtime.win-arm.Microsoft.NETCore.DotNetHostResolver runtime.win-arm.Microsoft.NETCore.ILAsm runtime.win-arm.Microsoft.NETCore.ILDAsm runtime.osx-arm64.Microsoft.NETCore.TestHost runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver runtime.win-arm64.Microsoft.NETCore.DotNetHost runtime.win-x64.Microsoft.NETCore.DotNetAppHost runtime.win-x64.Microsoft.NETCore.DotNetHost runtime.win-arm64.Microsoft.NETCore.ILAsm runtime.win-arm64.Microsoft.NETCore.ILDAsm Microsoft.NETCore.App.Runtime.Mono.linux-x64 runtime.win-arm64.Microsoft.NETCore.TestHost runtime.win-x64.Microsoft.NETCore.DotNetHostResolver runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy runtime.win-x64.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Crossgen2.linux-arm Microsoft.NET.Runtime.WebAssembly.Sdk Microsoft.NET.Sdk.IL Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100 Microsoft.Diagnostics.Tracing.EventSource.Redist Microsoft.Extensions.Caching.Abstractions Microsoft.Extensions.Caching.Memory Microsoft.NETCore.App.Crossgen2.linux-musl-x64 Microsoft.Extensions.Configuration.Binder Microsoft.Extensions.Configuration.Abstractions Microsoft.Extensions.Configuration Microsoft.Extensions.Hosting.Systemd Microsoft.Extensions.Configuration.CommandLine Microsoft.Extensions.Configuration.EnvironmentVariables Microsoft.Extensions.Configuration.FileExtensions runtime.win-x64.Microsoft.NETCore.TestHost runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-x64.6.0.0-preview.6.21269.5.symbols.nupkg System.Text.Json System.Threading.AccessControl System.Threading.Channels System.Threading.Tasks.Dataflow System.Windows.Extensions System.IO.Pipes.AccessControl System.IO.Ports System.Management System.IO.Pipelines runtime.win-x86.Microsoft.NETCore.ILDAsm runtime.win-x86.Microsoft.NETCore.DotNetHostResolver runtime.win-x86.Microsoft.NETCore.ILAsm runtime.win-x86.Microsoft.NETCore.TestHost System.Collections.Immutable System.CodeDom System.ComponentModel.Composition System.ComponentModel.Composition.Registration System.Composition System.Composition.Convention System.Composition.AttributedModel System.Composition.Hosting System.Composition.Runtime assets/symbols/Microsoft.IO.Redist.6.0.0-preview.6.21269.5.symbols.nupkg System.Diagnostics.DiagnosticSource System.Data.OleDb System.Diagnostics.EventLog System.DirectoryServices.AccountManagement System.Drawing.Common System.IO.FileSystem.AccessControl System.Configuration.ConfigurationManager assets/symbols/Microsoft.Extensions.Hosting.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.HostFactoryResolver.Sources.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Systemd.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Console.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventSource.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventLog.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.TraceSource.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.ConfigurationExtensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.WindowsServices.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.UserSecrets.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.EnvironmentVariables.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.FileExtensions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Diagnostics.Tracing.EventSource.Redist.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Data.Odbc.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/System.Composition.TypedParts.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21269.5.symbols.nupkg runtime.linux-arm.Microsoft.NETCore.DotNetAppHost Microsoft.Win32.Registry.AccessControl assets/symbols/runtime.linux-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21269.5.symbols.nupkg Microsoft.Windows.Compatibility Microsoft.XmlSerializer.Generator runtime.linux-arm.Microsoft.NETCore.TestHost runtime.linux-arm.Microsoft.NETCore.DotNetHost runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver runtime.linux-arm.Microsoft.NETCore.ILDAsm runtime.linux-arm.Microsoft.NETCore.ILAsm runtime.linux-arm.runtime.native.System.IO.Ports runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-arm64.Microsoft.NETCore.ILAsm runtime.linux-arm64.Microsoft.NETCore.ILDAsm runtime.linux-arm64.Microsoft.NETCore.TestHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy Microsoft.NETCore.App.Runtime.win-arm Microsoft.NETCore.App.Runtime.win-x86 Microsoft.NETCore.DotNetHost Microsoft.NETCore.DotNetHostPolicy Microsoft.NETCore.ILAsm Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.App.Runtime.Mono.win-x86 runtime.win-x64.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.TestHost runtime.osx-arm64.Microsoft.NETCore.ILDAsm runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm64.Microsoft.NETCore.TestHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.App.Composite Microsoft.Extensions.Http Microsoft.NET.Runtime.Android.Sample.Mono Microsoft.NET.Runtime.iOS.Sample.Mono Microsoft.NET.Runtime.wasm.Sample.Mono Microsoft.NET.Runtime.MonoAOTCompiler.Task Microsoft.NET.Runtime.RuntimeConfigParser.Task Microsoft.NETCore.App.Crossgen2.linux-arm64 Microsoft.NETCore.App.Crossgen2.linux-musl-arm Microsoft.NETCore.App.Runtime.Mono.ios-arm Microsoft.NETCore.App.Runtime.Mono.browser-wasm Microsoft.NETCore.App.Runtime.Mono.ios-arm64 Microsoft.NETCore.App.Crossgen2.osx-x64 Microsoft.NETCore.App.Crossgen2.win-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm Microsoft.NETCore.App.Host.linux-musl-x64 Microsoft.NETCore.App.Crossgen2.win-x86 Microsoft.NETCore.App.Host.osx-x64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64 assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Composite.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-arm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.ILAsm.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Private.CoreFx.OOB.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.AccessControl.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x86.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Xml.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.Specification.Tests.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyModel.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Composite.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Physical.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.FileSystemGlobbing.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Debug.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.CommandLine.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.AspNetCore.Internal.Transport.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Binder.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/dotnet-pgo.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Memory.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Abstractions.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/Microsoft.Bcl.AsyncInterfaces.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/dotnet-ilverify.6.0.0-preview.6.21269.5.symbols.nupkg assets/symbols/ILCompiler.Reflection.ReadyToRun.Experimental.6.0.0-preview.6.21269.5.symbols.nupkg - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/255) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/184) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/211) - Git fetch failed with exit code 128, back off 9.222 seconds before retry. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/259) - .packages\microsoft.dotnet.arcade.sdk\6.0.0-beta.21260.1\tools\SdkTasks\SigningValidation.proj(44,5): error MSB4181: (NETCORE_ENGINEERING_TELEMETRY=Build) The "SignCheckTask" task returned false but did not log an error. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - ValidateSigning-runtime: Entry found in generated contract does not match ValidateSigning-*. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - Steps were not validated for contract. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - Contract was not validated. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/276) - PowerShell exited with code '1'. #### Signing Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/68) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/131) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Source Code Validation - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/54) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/74) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/105) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/120) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Prep Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1146754/logs/36) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. ### Changes - [dc6fef91](https://dev.azure.com/dnceng/internal/_git/dotnet-release/commit/dc6fef91431602f67899d946d02c0eb6292a8446) - Michelle McDaniel - Merged PR 15096: Use dotnetstage storage account for 5.x+ repo propagation
infrastructure
build failed validate dotnet main runtime build failed x internal validate dotnet failed summary finished thu may gmt duration minutes requested for dotnet bot reason manual details validation ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app pgo preview symbols nupkg x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app runtime mono ios arm preview symbols nupkg x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app runtime mono ios preview symbols nupkg x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app runtime mono maccatalyst preview symbols nupkg x netcore engineering telemetry checksymbols symbols missing for packages x powershell exited with code warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning git fetch failed with exit code back off seconds before retry x validatesymbols entry found in generated contract does not match validatesymbols x steps were not validated for contract x contract was not validated x powershell exited with code required validation ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning number of checksums and assets don t match checksums assets assets with no corresponding checksum are assets symbols system security cryptography xml preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux musl microsoft netcore testhost preview symbols nupkg assets symbols runtime linux musl arm microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore testhost preview symbols nupkg assets symbols runtime win arm microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethost preview symbols nupkg assets symbols system security permissions preview symbols nupkg assets symbols system security principal windows preview symbols nupkg assets symbols runtime osx microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux microsoft netcore testhost preview symbols nupkg assets symbols runtime linux runtime native system io ports preview symbols nupkg runtime preview runtime productversion txt assets symbols runtime linux microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime win microsoft netcore ildasm preview symbols nupkg assets symbols runtime win microsoft netcore testhost preview symbols nupkg assets symbols runtime win microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime win microsoft netcore ilasm preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win microsoft netcore ildasm preview symbols nupkg assets symbols runtime win microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win microsoft netcore testhost preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostresolver preview symbols nupkg assets symbols system configuration configurationmanager preview symbols nupkg assets symbols runtime win microsoft netcore ilasm preview symbols nupkg assets symbols runtime win microsoft netcore ildasm preview symbols nupkg assets symbols runtime win microsoft netcore testhost preview symbols nupkg assets symbols system collections immutable preview symbols nupkg assets symbols system codedom preview symbols nupkg microsoft systemevents microsoft netcore app runtime mono tvos microsoft netcore app runtime mono tvossimulator microsoft netcore app runtime mono osx microsoft netcore app runtime mono osx microsoft netcore app runtime osx microsoft netcore app runtime mono win runtime linux musl arm microsoft netcore ilasm microsoft netcore app runtime win runtime native system io ports microsoft netcore app runtime mono linux arm runtime osx microsoft netcore dotnethost runtime osx microsoft netcore dotnethostpolicy runtime linux musl microsoft netcore testhost microsoft extensions logging microsoft extensions logging abstractions microsoft extensions logging console microsoft extensions logging debug microsoft extensions logging configuration microsoft extensions logging eventlog microsoft extensions logging eventsource microsoft extensions logging tracesource microsoft extensions options microsoft extensions options configurationextensions microsoft extensions options dataannotations microsoft extensions primitives microsoft ilverification microsoft io redist microsoft netcore app linux musl microsoft extensions hosting windowsservices microsoft extensions hosting abstractions dotnet ilverify microsoft bcl asyncinterfaces microsoft extensions configuration json microsoft extensions configuration usersecrets microsoft extensions configuration xml microsoft extensions dependencyinjection microsoft extensions dependencyinjection abstractions microsoft extensions fileproviders abstractions microsoft extensions dependencyinjection specification tests microsoft extensions dependencymodel microsoft extensions filesystemglobbing microsoft extensions hosting assets symbols runtime linux arm runtime native system io ports preview symbols nupkg microsoft netcore app runtime aot osx cross iossimulator microsoft netcore app runtime aot win cross android arm microsoft netcore app runtime aot win cross android microsoft netcore app runtime linux microsoft netcore app runtime aot win cross android microsoft netcore app runtime linux musl microsoft netcore app runtime linux musl microsoft netcore app runtime mono android microsoft netcore app runtime mono android microsoft netcore app runtime linux musl arm microsoft netcore app linux microsoft netcore app runtime aot osx cross ios microsoft netcore app win microsoft netcore app win microsoft netcore app host win microsoft netcore app runtime aot osx cross android microsoft netcore app runtime aot linux cross browser wasm microsoft netcore app runtime aot osx cross android assets symbols microsoft netcore app host win preview symbols nupkg assets symbols microsoft netcore app runtime aot linux cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot linux cross browser wasm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross ios arm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross browser wasm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross tvos preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android preview symbols nupkg assets symbols microsoft netcore app host win preview symbols nupkg assets symbols microsoft netcore app host win arm preview symbols nupkg assets symbols microsoft netcore app host osx preview symbols nupkg assets symbols microsoft net runtime android sample mono preview symbols nupkg assets symbols microsoft net runtime ios sample mono preview symbols nupkg assets symbols microsoft net runtime monoaotcompiler task preview symbols nupkg assets symbols microsoft net runtime runtimeconfigparser task preview symbols nupkg assets symbols microsoft net runtime wasm sample mono preview symbols nupkg assets symbols microsoft net runtime webassembly sdk preview symbols nupkg assets symbols microsoft net sdk il preview symbols nupkg assets symbols microsoft net workload mono toolchain manifest preview symbols nupkg assets symbols microsoft netcore ildasm preview symbols nupkg assets symbols microsoft netcore testhost preview symbols nupkg assets symbols microsoft systemevents preview symbols nupkg assets symbols microsoft windows compatibility preview symbols nupkg assets symbols microsoft xmlserializer generator preview symbols nupkg assets symbols runtime linux arm microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux arm microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux arm microsoft netcore ildasm preview symbols nupkg assets symbols microsoft netcore app runtime mono win preview symbols nupkg assets symbols microsoft netcore app runtime mono win preview symbols nupkg assets symbols microsoft netcore app runtime linux preview symbols nupkg assets symbols microsoft netcore app runtime mono android preview symbols nupkg assets symbols microsoft netcore app runtime mono ios arm preview symbols nupkg assets symbols microsoft netcore app runtime mono browser wasm preview symbols nupkg microsoft extensions fileproviders composite microsoft extensions fileproviders physical microsoft netcore app osx microsoft extensions configuration ini microsoft netcore app runtime aot osx cross iossimulator microsoft netcore app runtime aot osx cross maccatalyst microsoft netcore app runtime aot osx cross tvos microsoft netcore app runtime aot osx cross tvossimulator microsoft netcore app runtime aot osx cross maccatalyst microsoft netcore app runtime aot osx cross tvossimulator microsoft netcore app runtime aot win cross android microsoft netcore app runtime linux arm microsoft netcore app runtime aot osx cross iossimulator microsoft netcore app runtime aot win cross browser wasm microsoft netcore app runtime linux microsoft netcore app runtime mono android arm microsoft netcore app runtime mono android microsoft netcore app runtime mono iossimulator microsoft netcore app runtime mono iossimulator microsoft netcore app runtime mono iossimulator microsoft netcore app runtime aot osx cross android runtime win microsoft netcore dotnetapphost microsoft netcore app host win assets symbols microsoft netcore app pgo preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android arm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross iossimulator preview symbols nupkg assets symbols microsoft netcore app linux arm preview symbols nupkg assets symbols microsoft netcore app osx preview symbols nupkg assets symbols microsoft netcore app linux preview symbols nupkg assets symbols microsoft netcore app host osx preview symbols nupkg assets symbols microsoft netcore app runtime win preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnetapphost preview symbols nupkg assets symbols microsoft netcore app runtime mono tvossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm aot linux preview symbols nupkg assets symbols system windows extensions preview symbols nupkg assets symbols system formats preview symbols nupkg assets symbols system formats cbor preview symbols nupkg assets symbols system io packaging preview symbols nupkg assets symbols system io pipes accesscontrol preview symbols nupkg assets symbols system io pipelines preview symbols nupkg assets symbols system data oledb preview symbols nupkg assets symbols system net http winhttphandler preview symbols nupkg assets symbols system io ports preview symbols nupkg assets symbols system memory data preview symbols nupkg assets symbols system net http json preview symbols nupkg assets symbols system numerics tensors preview symbols nupkg assets symbols system reflection context preview symbols nupkg assets symbols system reflection metadata preview symbols nupkg assets symbols system reflection metadataloadcontext preview symbols nupkg assets symbols system resources extensions preview symbols nupkg assets symbols system runtime caching preview symbols nupkg assets symbols system runtime compilerservices unsafe preview symbols nupkg assets symbols system security accesscontrol preview symbols nupkg assets symbols system security cryptography pkcs preview symbols nupkg assets symbols system security cryptography protecteddata preview symbols nupkg assets symbols system management preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win microsoft netcore ilasm preview symbols nupkg runtime preview productversion txt runtime linux musl arm microsoft netcore dotnetapphost microsoft netcore app runtime mono llvm aot osx runtime linux musl arm microsoft netcore dotnethostresolver microsoft registry microsoft netcore testhost microsoft netcore platforms microsoft netcore app runtime mono llvm linux microsoft netcore app runtime mono llvm linux microsoft netcore app runtime mono llvm osx microsoft netcore app runtime mono maccatalyst microsoft netcore app runtime mono maccatalyst microsoft netcore app runtime mono tvossimulator microsoft netcore app runtime osx microsoft netcore app runtime win microsoft netcore dotnetapphost runtime linux musl microsoft netcore ilasm runtime linux microsoft netcore dotnetapphost runtime osx microsoft netcore ilasm runtime linux musl microsoft netcore ildasm runtime linux microsoft netcore dotnethost runtime linux microsoft netcore ilasm runtime linux microsoft netcore dotnethostpolicy runtime linux microsoft netcore ildasm runtime linux microsoft netcore dotnethostresolver runtime linux microsoft netcore testhost runtime osx microsoft netcore dotnetapphost runtime linux runtime native system io ports microsoft netcore app runtime mono linux musl microsoft netcore app runtime mono linux microsoft netcore app host linux microsoft netcore app host linux arm microsoft netcore app runtime aot osx cross ios arm microsoft netcore app host linux musl microsoft netcore app host linux musl arm microsoft netcore app host linux microsoft netcore app host osx microsoft netcore app host win arm microsoft netcore app runtime aot linux cross android arm microsoft netcore app host win microsoft netcore app runtime aot linux cross android microsoft netcore app ref microsoft netcore app runtime aot linux cross android microsoft netcore app runtime aot osx cross android arm assets symbols microsoft netcore app runtime aot linux cross android preview symbols nupkg assets symbols microsoft netcore app ref preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android arm preview symbols nupkg assets symbols microsoft netcore app linux musl preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross browser wasm preview symbols nupkg assets symbols microsoft netcore app win preview symbols nupkg assets symbols microsoft netcore app win preview symbols nupkg assets symbols microsoft netcore app host linux arm preview symbols nupkg assets symbols microsoft netcore app host linux preview symbols nupkg assets symbols microsoft netcore app host linux musl arm preview symbols nupkg assets symbols microsoft netcore app host linux musl preview symbols nupkg assets symbols microsoft netcore app host linux musl preview symbols nupkg assets symbols microsoft netcore app host linux preview symbols nupkg runtime win microsoft netcore dotnethost assets symbols microsoft netcore app runtime osx preview symbols nupkg assets symbols microsoft netcore app runtime win preview symbols nupkg assets symbols microsoft netcore browserdebughost transport preview symbols nupkg assets symbols microsoft netcore app runtime linux musl preview symbols nupkg assets symbols microsoft netcore app runtime mono linux arm preview symbols nupkg assets symbols microsoft netcore app runtime mono linux preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime osx microsoft netcore ilasm preview symbols nupkg assets symbols runtime osx microsoft netcore ildasm preview symbols nupkg assets symbols runtime osx microsoft netcore testhost preview symbols nupkg assets symbols runtime osx runtime native system io ports preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win arm microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore ildasm preview symbols nupkg assets symbols runtime win arm microsoft netcore testhost preview symbols nupkg assets symbols system directoryservices protocols preview symbols nupkg assets symbols runtime win microsoft netcore dotnethost preview symbols nupkg assets symbols system diagnostics eventlog preview symbols nupkg assets symbols system diagnostics diagnosticsource preview symbols nupkg assets symbols system diagnostics performancecounter preview symbols nupkg assets symbols system directoryservices preview symbols nupkg assets symbols system directoryservices accountmanagement preview symbols nupkg assets symbols system drawing common preview symbols nupkg assets symbols system io filesystem accesscontrol preview symbols nupkg assets symbols system componentmodel composition preview symbols nupkg assets symbols system componentmodel composition registration preview symbols nupkg assets symbols system composition preview symbols nupkg assets symbols system composition convention preview symbols nupkg assets symbols system composition attributedmodel preview symbols nupkg assets symbols system composition runtime preview symbols nupkg assets symbols system composition hosting preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols microsoft netcore app osx preview symbols nupkg assets symbols microsoft netcore app runtime linux musl preview symbols nupkg assets symbols microsoft netcore app runtime mono android arm preview symbols nupkg assets symbols microsoft netcore app runtime mono android preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm aot linux preview symbols nupkg assets symbols microsoft netcore app runtime mono tvos preview symbols nupkg assets symbols microsoft netcore app linux preview symbols nupkg assets symbols microsoft netcore app win arm preview symbols nupkg assets symbols microsoft netcore app runtime osx preview symbols nupkg assets symbols microsoft netcore app runtime win preview symbols nupkg assets symbols microsoft netcore app runtime mono tvossimulator preview symbols nupkg assets symbols microsoft netcore app runtime linux preview symbols nupkg assets symbols microsoft netcore app runtime mono iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono linux musl preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm aot osx preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm linux preview symbols nupkg assets symbols microsoft netcore app runtime mono maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm osx preview symbols nupkg system memory data assets symbols microsoft netcore app runtime mono linux preview symbols nupkg system net http winhttphandler system net http json assets symbols microsoft net hostmodel preview symbols nupkg assets symbols microsoft net hostmodel pgo preview symbols nupkg assets symbols microsoft ilverification preview symbols nupkg system numerics tensors system reflection metadata system reflection metadataloadcontext system reflection context system resources extensions system runtime caching system security cryptography pkcs system runtime compilerservices unsafe system security accesscontrol system security cryptography protecteddata system security cryptography xml system security principal windows system security permissions system servicemodel syndication system serviceprocess servicecontroller system speech system text encoding codepages system text encodings web system data odbc system composition typedparts system directoryservices system diagnostics performancecounter system formats system directoryservices protocols system formats cbor system io packaging assets symbols microsoft extensions dependencyinjection preview symbols nupkg assets symbols microsoft extensions configuration json preview symbols nupkg assets symbols microsoft extensions http preview symbols nupkg assets symbols microsoft extensions logging configuration preview symbols nupkg assets symbols microsoft extensions primitives preview symbols nupkg assets symbols microsoft extensions options dataannotations preview symbols nupkg assets symbols microsoft extensions configuration ini preview symbols nupkg assets symbols microsoft extensions configuration abstractions preview symbols nupkg assets symbols system serviceprocess servicecontroller preview symbols nupkg assets symbols system text encoding codepages preview symbols nupkg assets symbols system speech preview symbols nupkg assets symbols system text json preview symbols nupkg assets symbols system text encodings web preview symbols nupkg assets symbols system threading accesscontrol preview symbols nupkg assets symbols system threading tasks dataflow preview symbols nupkg assets symbols system threading channels preview symbols nupkg assets symbols system servicemodel syndication preview symbols nupkg assets symbols runtime osx microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux microsoft netcore testhost preview symbols nupkg assets symbols runtime linux runtime native system io ports preview symbols nupkg assets symbols runtime native system io ports preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime osx microsoft netcore ilasm preview symbols nupkg assets symbols runtime osx microsoft netcore ildasm preview symbols nupkg assets symbols runtime osx microsoft netcore testhost preview symbols nupkg assets symbols runtime win microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostpolicy preview symbols nupkg microsoft netcore app runtime mono llvm aot linux runtime linux musl arm microsoft netcore dotnethost runtime linux microsoft netcore dotnethost runtime linux runtime native system io ports runtime osx microsoft netcore dotnetapphost microsoft netcore ildasm runtime linux musl arm microsoft netcore ildasm runtime linux musl arm microsoft netcore testhost runtime osx microsoft netcore dotnethost runtime osx microsoft netcore ilasm runtime osx microsoft netcore dotnethostpolicy runtime osx microsoft netcore dotnethostresolver runtime osx microsoft netcore ildasm runtime win arm microsoft netcore dotnetapphost runtime osx microsoft netcore testhost runtime win arm microsoft netcore dotnethost runtime osx runtime native system io ports runtime win microsoft netcore dotnetapphost runtime win arm microsoft netcore dotnethostpolicy runtime win arm microsoft netcore dotnethostresolver runtime win arm microsoft netcore ilasm runtime win arm microsoft netcore ildasm runtime osx microsoft netcore testhost runtime win microsoft netcore dotnethostpolicy runtime win microsoft netcore dotnethostresolver runtime win microsoft netcore dotnethost runtime win microsoft netcore dotnetapphost runtime win microsoft netcore dotnethost runtime win microsoft netcore ilasm runtime win microsoft netcore ildasm microsoft netcore app runtime mono linux runtime win microsoft netcore testhost runtime win microsoft netcore dotnethostresolver runtime win microsoft netcore dotnethostpolicy runtime win microsoft netcore ilasm microsoft netcore app linux arm microsoft net runtime webassembly sdk microsoft net sdk il microsoft net workload mono toolchain manifest microsoft diagnostics tracing eventsource redist microsoft extensions caching abstractions microsoft extensions caching memory microsoft netcore app linux musl microsoft extensions configuration binder microsoft extensions configuration abstractions microsoft extensions configuration microsoft extensions hosting systemd microsoft extensions configuration commandline microsoft extensions configuration environmentvariables microsoft extensions configuration fileextensions runtime win microsoft netcore testhost runtime win microsoft netcore dotnethostpolicy assets symbols microsoft netcore app runtime aot osx cross iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross tvossimulator preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android preview symbols nupkg assets symbols microsoft netcore app host win preview symbols nupkg assets symbols microsoft netcore app linux musl arm preview symbols nupkg assets symbols microsoft netcore app win preview symbols nupkg assets symbols microsoft netcore app runtime linux musl arm preview symbols nupkg assets symbols microsoft netcore app runtime mono maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime mono osx preview symbols nupkg assets symbols microsoft netcore app runtime mono osx preview symbols nupkg system text json system threading accesscontrol system threading channels system threading tasks dataflow system windows extensions system io pipes accesscontrol system io ports system management system io pipelines runtime win microsoft netcore ildasm runtime win microsoft netcore dotnethostresolver runtime win microsoft netcore ilasm runtime win microsoft netcore testhost system collections immutable system codedom system componentmodel composition system componentmodel composition registration system composition system composition convention system composition attributedmodel system composition hosting system composition runtime assets symbols microsoft io redist preview symbols nupkg system diagnostics diagnosticsource system data oledb system diagnostics eventlog system directoryservices accountmanagement system drawing common system io filesystem accesscontrol system configuration configurationmanager assets symbols microsoft extensions hosting preview symbols nupkg assets symbols microsoft extensions hostfactoryresolver sources preview symbols nupkg assets symbols microsoft extensions hosting abstractions preview symbols nupkg assets symbols microsoft extensions hosting systemd preview symbols nupkg assets symbols microsoft extensions logging console preview symbols nupkg assets symbols microsoft extensions logging preview symbols nupkg assets symbols microsoft extensions logging eventsource preview symbols nupkg assets symbols microsoft extensions logging eventlog preview symbols nupkg assets symbols microsoft extensions logging tracesource preview symbols nupkg assets symbols microsoft extensions options preview symbols nupkg assets symbols microsoft extensions options configurationextensions preview symbols nupkg assets symbols microsoft extensions hosting windowsservices preview symbols nupkg assets symbols microsoft extensions configuration usersecrets preview symbols nupkg assets symbols microsoft extensions configuration environmentvariables preview symbols nupkg assets symbols microsoft extensions configuration fileextensions preview symbols nupkg assets symbols microsoft diagnostics tracing eventsource redist preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux musl microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux musl microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore testhost preview symbols nupkg assets symbols runtime linux musl microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime win microsoft netcore dotnetapphost preview symbols nupkg assets symbols system data odbc preview symbols nupkg assets symbols system composition typedparts preview symbols nupkg assets symbols runtime linux microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux microsoft crossosdiag private coreclr preview symbols nupkg runtime linux arm microsoft netcore dotnetapphost microsoft registry accesscontrol assets symbols runtime linux arm microsoft netcore testhost preview symbols nupkg microsoft windows compatibility microsoft xmlserializer generator runtime linux arm microsoft netcore testhost runtime linux arm microsoft netcore dotnethost runtime linux arm microsoft netcore dotnethostpolicy runtime linux arm microsoft netcore dotnethostresolver runtime linux arm microsoft netcore ildasm runtime linux arm microsoft netcore ilasm runtime linux arm runtime native system io ports runtime linux microsoft netcore dotnethostresolver runtime linux microsoft netcore dotnetapphost runtime linux microsoft netcore dotnethostpolicy runtime linux microsoft netcore ilasm runtime linux microsoft netcore ildasm runtime linux microsoft netcore testhost microsoft netcore app runtime mono llvm aot linux runtime linux musl arm microsoft netcore dotnethostpolicy microsoft netcore app runtime win arm microsoft netcore app runtime win microsoft netcore dotnethost microsoft netcore dotnethostpolicy microsoft netcore ilasm microsoft netcore dotnethostresolver microsoft netcore app runtime mono win runtime win microsoft netcore ildasm runtime linux musl microsoft netcore dotnetapphost runtime win arm microsoft netcore testhost runtime osx microsoft netcore ildasm runtime osx microsoft netcore dotnethostresolver runtime linux musl microsoft netcore dotnethost runtime linux musl microsoft netcore dotnetapphost runtime linux musl microsoft netcore dotnethostpolicy runtime linux musl microsoft netcore dotnethostresolver runtime linux musl microsoft netcore ilasm runtime linux musl microsoft netcore ildasm runtime linux musl microsoft netcore testhost runtime linux musl microsoft netcore dotnethost runtime linux musl microsoft netcore dotnethostpolicy runtime linux musl microsoft netcore dotnethostresolver microsoft netcore app composite microsoft extensions http microsoft net runtime android sample mono microsoft net runtime ios sample mono microsoft net runtime wasm sample mono microsoft net runtime monoaotcompiler task microsoft net runtime runtimeconfigparser task microsoft netcore app linux microsoft netcore app linux musl arm microsoft netcore app runtime mono ios arm microsoft netcore app runtime mono browser wasm microsoft netcore app runtime mono ios microsoft netcore app osx microsoft netcore app win arm microsoft netcore app runtime aot osx cross browser wasm microsoft netcore app host linux musl microsoft netcore app win microsoft netcore app host osx microsoft netcore app runtime aot linux cross android assets symbols microsoft netcore app runtime aot linux cross android arm preview symbols nupkg assets symbols microsoft netcore app runtime aot linux cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross ios preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross tvossimulator preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android preview symbols nupkg assets symbols microsoft netcore app composite preview symbols nupkg assets symbols microsoft netcore app linux musl preview symbols nupkg assets symbols microsoft netcore app runtime linux arm preview symbols nupkg assets symbols microsoft netcore app runtime win arm preview symbols nupkg assets symbols microsoft netcore dotnetapphost preview symbols nupkg assets symbols microsoft netcore dotnethost preview symbols nupkg assets symbols microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols microsoft netcore dotnethostresolver preview symbols nupkg assets symbols microsoft netcore ilasm preview symbols nupkg assets symbols microsoft private corefx oob preview symbols nupkg assets symbols microsoft registry preview symbols nupkg assets symbols microsoft registry accesscontrol preview symbols nupkg assets symbols microsoft netcore app runtime mono android preview symbols nupkg assets symbols microsoft netcore app runtime mono ios preview symbols nupkg assets symbols microsoft netcore app runtime mono iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm linux preview symbols nupkg assets symbols microsoft extensions configuration xml preview symbols nupkg assets symbols microsoft extensions dependencyinjection specification tests preview symbols nupkg assets symbols microsoft extensions dependencyinjection abstractions preview symbols nupkg assets symbols microsoft extensions dependencymodel preview symbols nupkg assets symbols microsoft extensions fileproviders abstractions preview symbols nupkg assets symbols microsoft extensions fileproviders composite preview symbols nupkg assets symbols microsoft extensions fileproviders physical preview symbols nupkg assets symbols microsoft extensions filesystemglobbing preview symbols nupkg assets symbols microsoft extensions logging abstractions preview symbols nupkg assets symbols microsoft extensions logging debug preview symbols nupkg assets symbols microsoft extensions configuration commandline preview symbols nupkg assets symbols microsoft aspnetcore internal transport preview symbols nupkg assets symbols microsoft extensions configuration binder preview symbols nupkg assets symbols dotnet pgo preview symbols nupkg assets symbols microsoft extensions caching memory preview symbols nupkg assets symbols microsoft extensions configuration preview symbols nupkg assets symbols microsoft extensions caching abstractions preview symbols nupkg assets symbols microsoft bcl asyncinterfaces preview symbols nupkg assets symbols dotnet ilverify preview symbols nupkg assets symbols ilcompiler reflection readytorun experimental preview symbols nupkg warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning git fetch failed with exit code back off seconds before retry x packages microsoft dotnet arcade sdk beta tools sdktasks signingvalidation proj error netcore engineering telemetry build the signchecktask task returned false but did not log an error x validatesigning runtime entry found in generated contract does not match validatesigning x steps were not validated for contract x contract was not validated x powershell exited with code signing ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency source code validation warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency prep ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency changes michelle mcdaniel merged pr use dotnetstage storage account for x repo propagation
1
5,738
5,919,739,395
IssuesEvent
2017-05-22 18:29:00
angular/material2
https://api.github.com/repos/angular/material2
closed
Support markdown in source code docs
feature good for community contribution infrastructure P4: nice to have
#### Bug, feature request, or proposal: Feature request / Proposal #### What is the expected behavior? It'll be nice to have markdown formatting in the documentation pages. #### What is the current behavior? No markdown. ![2017-04-06 11_25_08-angular material](https://cloud.githubusercontent.com/assets/901354/24747187/d6a1dfde-1abb-11e7-80f1-3bdb027e6366.png) #### What are the steps to reproduce? E.g. https://material.angular.io/components/component/radio #### What is the use-case or motivation for changing an existing behavior? Better docs :zap: :sun_behind_small_cloud: :rainbow: #### Which versions of Angular, Material, OS, browsers are affected? n/a #### Is there anything else we should know? If of interest, I can start a PR. I did something siminilar in a project that took your dgeni configuration as a starting point. Requires some changes to the nunjucks templates.
1.0
Support markdown in source code docs - #### Bug, feature request, or proposal: Feature request / Proposal #### What is the expected behavior? It'll be nice to have markdown formatting in the documentation pages. #### What is the current behavior? No markdown. ![2017-04-06 11_25_08-angular material](https://cloud.githubusercontent.com/assets/901354/24747187/d6a1dfde-1abb-11e7-80f1-3bdb027e6366.png) #### What are the steps to reproduce? E.g. https://material.angular.io/components/component/radio #### What is the use-case or motivation for changing an existing behavior? Better docs :zap: :sun_behind_small_cloud: :rainbow: #### Which versions of Angular, Material, OS, browsers are affected? n/a #### Is there anything else we should know? If of interest, I can start a PR. I did something siminilar in a project that took your dgeni configuration as a starting point. Requires some changes to the nunjucks templates.
infrastructure
support markdown in source code docs bug feature request or proposal feature request proposal what is the expected behavior it ll be nice to have markdown formatting in the documentation pages what is the current behavior no markdown what are the steps to reproduce e g what is the use case or motivation for changing an existing behavior better docs zap sun behind small cloud rainbow which versions of angular material os browsers are affected n a is there anything else we should know if of interest i can start a pr i did something siminilar in a project that took your dgeni configuration as a starting point requires some changes to the nunjucks templates
1
35,173
30,816,462,199
IssuesEvent
2023-08-01 13:46:12
grafana/agent
https://api.github.com/repos/grafana/agent
reopened
Adapt prometheus.exporter.blackbox target block to accept targets from other components
enhancement type/infrastructure
### Request I wish to be able to assign targets to the prometheus.exporter.blackbox targets block in grafana agent flow mode, without statically assigning them in the river configuration. ### Use case I am looking to have several json files containing service discovery targets, which are discovered via discovery.file, relabelled in discovery.relabel and ultimately passed/consumed by prometheus.exporter.blackbox as targets to run icmp/htttp tests on. Following this would be a standard prometheus.scrape of the exporter and passed onto mimir. The current prometheus standard mechanism to do this with prometheus.scrape and the params seems to concatenate strings within an array as a single lookup. i.e api/v0/component/prometheus.exporter.blackbox.icmp/metrics?module=icmp_test&target=grafana.com&target=football.com&target=yahoo.com
1.0
Adapt prometheus.exporter.blackbox target block to accept targets from other components - ### Request I wish to be able to assign targets to the prometheus.exporter.blackbox targets block in grafana agent flow mode, without statically assigning them in the river configuration. ### Use case I am looking to have several json files containing service discovery targets, which are discovered via discovery.file, relabelled in discovery.relabel and ultimately passed/consumed by prometheus.exporter.blackbox as targets to run icmp/htttp tests on. Following this would be a standard prometheus.scrape of the exporter and passed onto mimir. The current prometheus standard mechanism to do this with prometheus.scrape and the params seems to concatenate strings within an array as a single lookup. i.e api/v0/component/prometheus.exporter.blackbox.icmp/metrics?module=icmp_test&target=grafana.com&target=football.com&target=yahoo.com
infrastructure
adapt prometheus exporter blackbox target block to accept targets from other components request i wish to be able to assign targets to the prometheus exporter blackbox targets block in grafana agent flow mode without statically assigning them in the river configuration use case i am looking to have several json files containing service discovery targets which are discovered via discovery file relabelled in discovery relabel and ultimately passed consumed by prometheus exporter blackbox as targets to run icmp htttp tests on following this would be a standard prometheus scrape of the exporter and passed onto mimir the current prometheus standard mechanism to do this with prometheus scrape and the params seems to concatenate strings within an array as a single lookup i e api component prometheus exporter blackbox icmp metrics module icmp test target grafana com target football com target yahoo com
1
29,800
24,283,839,345
IssuesEvent
2022-09-28 19:58:00
dotnet/project-system
https://api.github.com/repos/dotnet/project-system
closed
Add VS insertion detailed description
Area-Infrastructure Triage-Approved
As per the changes in [this PR](https://github.com/dotnet/project-system/pull/8420), we moved to using MicroBuild to create our VS insertion PRs. MicroBuild does not provide detailed descriptions for their VS insertion PRs. To provide the same convince that we had prior, we'll need to add this mechanism to our repo. - Isolate the code from [Roslyn Insertion Tool](https://github.com/dotnet/roslyn-tools/tree/main/src/RoslynInsertionTool) that created this description - Create a small, single purpose tool in our repo that simply spits out this description string - Assign description string to a variable in the pipeline - Assign the variable to the `InsertionDescription` value in the MicroBuild Insertion task
1.0
Add VS insertion detailed description - As per the changes in [this PR](https://github.com/dotnet/project-system/pull/8420), we moved to using MicroBuild to create our VS insertion PRs. MicroBuild does not provide detailed descriptions for their VS insertion PRs. To provide the same convince that we had prior, we'll need to add this mechanism to our repo. - Isolate the code from [Roslyn Insertion Tool](https://github.com/dotnet/roslyn-tools/tree/main/src/RoslynInsertionTool) that created this description - Create a small, single purpose tool in our repo that simply spits out this description string - Assign description string to a variable in the pipeline - Assign the variable to the `InsertionDescription` value in the MicroBuild Insertion task
infrastructure
add vs insertion detailed description as per the changes in we moved to using microbuild to create our vs insertion prs microbuild does not provide detailed descriptions for their vs insertion prs to provide the same convince that we had prior we ll need to add this mechanism to our repo isolate the code from that created this description create a small single purpose tool in our repo that simply spits out this description string assign description string to a variable in the pipeline assign the variable to the insertiondescription value in the microbuild insertion task
1
37,296
9,986,335,242
IssuesEvent
2019-07-10 18:50:23
EIDSS/EIDSS7
https://api.github.com/repos/EIDSS/EIDSS7
closed
Error when trying to login to EIDSS from Icon on Main Menu
Build 81.0 bug
**Summary** Tried to load EIDSS and received an error message **To Reproduce** Steps to reproduce the behavior: 1. Log in as N/A 2. Go to 3. Click on **Expected behavior** EIDSS Login page should be displayed **Screenshots** ![image](https://user-images.githubusercontent.com/52708365/60986297-028c9b80-a2f4-11e9-9e3a-5ce0c8134da8.png) **Additional details:** - Build: 81 - Script title (enter ad hoc if not script-based): ABE01 **Issue severity (Optional)** Severity (critical, major, minor, low): Critical **Additional context** Add any other context about the problem here.
1.0
Error when trying to login to EIDSS from Icon on Main Menu - **Summary** Tried to load EIDSS and received an error message **To Reproduce** Steps to reproduce the behavior: 1. Log in as N/A 2. Go to 3. Click on **Expected behavior** EIDSS Login page should be displayed **Screenshots** ![image](https://user-images.githubusercontent.com/52708365/60986297-028c9b80-a2f4-11e9-9e3a-5ce0c8134da8.png) **Additional details:** - Build: 81 - Script title (enter ad hoc if not script-based): ABE01 **Issue severity (Optional)** Severity (critical, major, minor, low): Critical **Additional context** Add any other context about the problem here.
non_infrastructure
error when trying to login to eidss from icon on main menu summary tried to load eidss and received an error message to reproduce steps to reproduce the behavior log in as n a go to click on expected behavior eidss login page should be displayed screenshots additional details build script title enter ad hoc if not script based issue severity optional severity critical major minor low critical additional context add any other context about the problem here
0
777,706
27,291,656,336
IssuesEvent
2023-02-23 17:01:21
sebastien-d-me/SebBlog
https://api.github.com/repos/sebastien-d-me/SebBlog
opened
Test the visuals of the site
Priority: Critical Statut: Not started Type : Front-end Type : Back-end
#### Description: Test the pages of the site to make sure they look good and that they are responsive. ------------ ###### Estimated time: 1 day(s) ###### Difficulty: ⭐
1.0
Test the visuals of the site - #### Description: Test the pages of the site to make sure they look good and that they are responsive. ------------ ###### Estimated time: 1 day(s) ###### Difficulty: ⭐
non_infrastructure
test the visuals of the site description test the pages of the site to make sure they look good and that they are responsive estimated time day s difficulty ⭐
0
8,912
7,733,071,071
IssuesEvent
2018-05-26 06:41:54
mytimecoin/pravda
https://api.github.com/repos/mytimecoin/pravda
closed
Aggregate CLI
infrastructure ux
Currently we have logically independent command line tools for forth, asm and vm. Actually they have one code base (at least every tool depends on asm). Idea is to make all in one CLI. It should: 1. [x] Compile ASM to bytecode. 2. [x] Compile Forth to bytecode. 4. [x] Generate pravda-compatible key pairs. 8. [x] Run and debug VM programs (with simle introspective database and stack implementation).
1.0
Aggregate CLI - Currently we have logically independent command line tools for forth, asm and vm. Actually they have one code base (at least every tool depends on asm). Idea is to make all in one CLI. It should: 1. [x] Compile ASM to bytecode. 2. [x] Compile Forth to bytecode. 4. [x] Generate pravda-compatible key pairs. 8. [x] Run and debug VM programs (with simle introspective database and stack implementation).
infrastructure
aggregate cli currently we have logically independent command line tools for forth asm and vm actually they have one code base at least every tool depends on asm idea is to make all in one cli it should compile asm to bytecode compile forth to bytecode generate pravda compatible key pairs run and debug vm programs with simle introspective database and stack implementation
1
8,590
7,504,364,828
IssuesEvent
2018-04-10 03:11:00
msmunter/star.vote
https://api.github.com/repos/msmunter/star.vote
closed
Organizations Abstract
enhancement infrastructure
Site admin needs ability to create organizations for a single user or group of users to create polls and surveys for as an organizational unit. Likely to represent real-world organizations. First iteration simply a layer to provide meaningful indexing and collecting of related users and data.
1.0
Organizations Abstract - Site admin needs ability to create organizations for a single user or group of users to create polls and surveys for as an organizational unit. Likely to represent real-world organizations. First iteration simply a layer to provide meaningful indexing and collecting of related users and data.
infrastructure
organizations abstract site admin needs ability to create organizations for a single user or group of users to create polls and surveys for as an organizational unit likely to represent real world organizations first iteration simply a layer to provide meaningful indexing and collecting of related users and data
1
604,601
18,715,357,538
IssuesEvent
2021-11-03 03:20:09
AY2122S1-CS2103T-F11-1/tp
https://api.github.com/repos/AY2122S1-CS2103T-F11-1/tp
closed
Addtoclass improper handling of invalid cmds
type.Bug priority.High severity.Medium
eg. "addtoclass 01" returns successfully added when nothing happens
1.0
Addtoclass improper handling of invalid cmds - eg. "addtoclass 01" returns successfully added when nothing happens
non_infrastructure
addtoclass improper handling of invalid cmds eg addtoclass returns successfully added when nothing happens
0
15,733
11,688,280,324
IssuesEvent
2020-03-05 14:17:47
danmermel/cryptario
https://api.github.com/repos/danmermel/cryptario
closed
rationalise lambda deployment
infrastructure
There seems to be a lot of repetition in this... we can turn it into a more streamlined script. - The `./deploy.sh` should have an array of clue types (anagram, container etc). - It should loop through this list, performing the tasks currently in `./<cluetype>/prepare.sh` - then it should deploy the built zip and tidy up This will save us modifying bash scripts many times.
1.0
rationalise lambda deployment - There seems to be a lot of repetition in this... we can turn it into a more streamlined script. - The `./deploy.sh` should have an array of clue types (anagram, container etc). - It should loop through this list, performing the tasks currently in `./<cluetype>/prepare.sh` - then it should deploy the built zip and tidy up This will save us modifying bash scripts many times.
infrastructure
rationalise lambda deployment there seems to be a lot of repetition in this we can turn it into a more streamlined script the deploy sh should have an array of clue types anagram container etc it should loop through this list performing the tasks currently in prepare sh then it should deploy the built zip and tidy up this will save us modifying bash scripts many times
1
157,003
19,910,016,398
IssuesEvent
2022-01-25 16:17:25
elastic/kibana
https://api.github.com/repos/elastic/kibana
closed
[Security Solution][Rule Registry] ECS template uses constant_keyword for data_stream fields
bug v8.0.0 impact:critical fixed Team: SecuritySolution
ECS defines `data_stream.dataset`, `data_stream.namespace`, and `data_stream.type` as `constant_keyword` fields, however, this prevents documents from populating those fields with arbitrary values when written. The [signals index mapping](https://github.com/elastic/kibana/blob/main/x-pack/plugins/security_solution/server/lib/detection_engine/routes/index/ecs_mapping.json#L332-L344) in the security solution modified the ECS mapping to make those fields `keyword` so that the values could be copied over from source documents. However, they are now defined as `constant_keyword` in the rule registry [ECS field map](https://github.com/elastic/kibana/blob/main/x-pack/plugins/rule_registry/common/assets/field_maps/ecs_field_map.ts#L418-L432). This leads to errors when attempting to create alerts from Elastic Endpoint events that use those fields. ``` [2022-01-19T11:10:30.339-10:00][ERROR][plugins.ruleRegistry] ResponseError: {"took":1,"errors":true,"items":[{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"023208357eb961f3c14706f47e1f6101f5f574b6ee53a7ae1f19eee3e66e9677","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id '023208357eb961f3c14706f47e1f6101f5f574b6ee53a7ae1f19eee3e66e9677'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"b0c596cadd40d120de2cf71a4dc123dfd85346aa0d2ea7780ca4277aa8f6abc8","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'b0c596cadd40d120de2cf71a4dc123dfd85346aa0d2ea7780ca4277aa8f6abc8'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"ef5aae969474fc164d70072ab993078b25d53be538fff26f3967dc3e41fc610c","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'ef5aae969474fc164d70072ab993078b25d53be538fff26f3967dc3e41fc610c'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"fb6f1a6ad731e7321a9df0e91c5e304ee22fe7630f34f78358d22bf74f17b8be","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'fb6f1a6ad731e7321a9df0e91c5e304ee22fe7630f34f78358d22bf74f17b8be'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"938dcccaee66a55d79228a50c3ff91a5347ccd0ec5e6eb962482af4c60bc3bc6","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id '938dcccaee66a55d79228a50c3ff91a5347ccd0ec5e6eb962482af4c60bc3bc6'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"c4cd379d9e208ee4bc3d05ca0f551d2559ed3f8eaf96fc5e812173933cca049e","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'c4cd379d9e208ee4bc3d05ca0f551d2559ed3f8eaf96fc5e812173933cca049e'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"10e36594a58d19ff5ad694dce65c5a152330816d4bac71e6f0d730cb19629a16","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id '10e36594a58d19ff5ad694dce65c5a152330816d4bac71e6f0d730cb19629a16'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"a0ec2c562c8e735696492c3d2d89b7ed9c7d7399480fbfd158056bf849077a79","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'a0ec2c562c8e735696492c3d2d89b7ed9c7d7399480fbfd158056bf849077a79'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"b56fd551c0ed6a8eb11f5784e91d724455fef2e3ca8386567687b82e72ed8ccd","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'b56fd551c0ed6a8eb11f5784e91d724455fef2e3ca8386567687b82e72ed8ccd'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}}]} at /home/kevin/development/kibana/x-pack/plugins/rule_registry/server/rule_data_client/rule_data_client.ts:198:31 at runMicrotasks (<anonymous>) at processTicksAndRejections (node:internal/process/task_queues:96:5) at alertWithPersistence (/home/kevin/development/kibana/x-pack/plugins/rule_registry/server/utils/create_persistence_rule_type_wrapper.ts:95:34) at /home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/rule_types/factories/bulk_create_factory.ts:48:39 at /home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/signals/executors/eql.ts:141:28 at Object.executor (/home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/rule_types/eql/create_eql_alert_type.ts:66:22) at /home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/rule_types/create_security_rule_type_wrapper.ts:261:33 at Object.executor (/home/kevin/development/kibana/x-pack/plugins/rule_registry/server/utils/create_persistence_rule_type_wrapper.ts:21:23) at TaskRunner.executeAlerts (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:324:30) at promiseResult (/home/kevin/development/kibana/x-pack/plugins/alerting/server/lib/result_type.ts:47:17) at TaskRunner.loadRuleAttributesAndRun (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:576:14) at errorAsRuleTaskRunResult (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:1137:12) at TaskRunner.run (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:641:45) at TaskManagerRunner.run (/home/kevin/development/kibana/x-pack/plugins/task_manager/server/task_running/task_runner.ts:305:22) ```
True
[Security Solution][Rule Registry] ECS template uses constant_keyword for data_stream fields - ECS defines `data_stream.dataset`, `data_stream.namespace`, and `data_stream.type` as `constant_keyword` fields, however, this prevents documents from populating those fields with arbitrary values when written. The [signals index mapping](https://github.com/elastic/kibana/blob/main/x-pack/plugins/security_solution/server/lib/detection_engine/routes/index/ecs_mapping.json#L332-L344) in the security solution modified the ECS mapping to make those fields `keyword` so that the values could be copied over from source documents. However, they are now defined as `constant_keyword` in the rule registry [ECS field map](https://github.com/elastic/kibana/blob/main/x-pack/plugins/rule_registry/common/assets/field_maps/ecs_field_map.ts#L418-L432). This leads to errors when attempting to create alerts from Elastic Endpoint events that use those fields. ``` [2022-01-19T11:10:30.339-10:00][ERROR][plugins.ruleRegistry] ResponseError: {"took":1,"errors":true,"items":[{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"023208357eb961f3c14706f47e1f6101f5f574b6ee53a7ae1f19eee3e66e9677","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id '023208357eb961f3c14706f47e1f6101f5f574b6ee53a7ae1f19eee3e66e9677'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"b0c596cadd40d120de2cf71a4dc123dfd85346aa0d2ea7780ca4277aa8f6abc8","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'b0c596cadd40d120de2cf71a4dc123dfd85346aa0d2ea7780ca4277aa8f6abc8'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"ef5aae969474fc164d70072ab993078b25d53be538fff26f3967dc3e41fc610c","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'ef5aae969474fc164d70072ab993078b25d53be538fff26f3967dc3e41fc610c'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"fb6f1a6ad731e7321a9df0e91c5e304ee22fe7630f34f78358d22bf74f17b8be","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'fb6f1a6ad731e7321a9df0e91c5e304ee22fe7630f34f78358d22bf74f17b8be'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"938dcccaee66a55d79228a50c3ff91a5347ccd0ec5e6eb962482af4c60bc3bc6","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id '938dcccaee66a55d79228a50c3ff91a5347ccd0ec5e6eb962482af4c60bc3bc6'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"c4cd379d9e208ee4bc3d05ca0f551d2559ed3f8eaf96fc5e812173933cca049e","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'c4cd379d9e208ee4bc3d05ca0f551d2559ed3f8eaf96fc5e812173933cca049e'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"10e36594a58d19ff5ad694dce65c5a152330816d4bac71e6f0d730cb19629a16","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id '10e36594a58d19ff5ad694dce65c5a152330816d4bac71e6f0d730cb19629a16'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"a0ec2c562c8e735696492c3d2d89b7ed9c7d7399480fbfd158056bf849077a79","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'a0ec2c562c8e735696492c3d2d89b7ed9c7d7399480fbfd158056bf849077a79'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}},{"create":{"_index":".internal.alerts-security.alerts-default-000001","_id":"b56fd551c0ed6a8eb11f5784e91d724455fef2e3ca8386567687b82e72ed8ccd","status":400,"error":{"type":"mapper_parsing_exception","reason":"failed to parse field [data_stream.dataset] of type [constant_keyword] in document with id 'b56fd551c0ed6a8eb11f5784e91d724455fef2e3ca8386567687b82e72ed8ccd'. Preview of field's value: 'endpoint.events.process'","caused_by":{"type":"illegal_argument_exception","reason":"[constant_keyword] field [data_stream.dataset] only accepts values that are equal to the value defined in the mappings [endpoint.alerts], but got [endpoint.events.process]"}}}}]} at /home/kevin/development/kibana/x-pack/plugins/rule_registry/server/rule_data_client/rule_data_client.ts:198:31 at runMicrotasks (<anonymous>) at processTicksAndRejections (node:internal/process/task_queues:96:5) at alertWithPersistence (/home/kevin/development/kibana/x-pack/plugins/rule_registry/server/utils/create_persistence_rule_type_wrapper.ts:95:34) at /home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/rule_types/factories/bulk_create_factory.ts:48:39 at /home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/signals/executors/eql.ts:141:28 at Object.executor (/home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/rule_types/eql/create_eql_alert_type.ts:66:22) at /home/kevin/development/kibana/x-pack/plugins/security_solution/server/lib/detection_engine/rule_types/create_security_rule_type_wrapper.ts:261:33 at Object.executor (/home/kevin/development/kibana/x-pack/plugins/rule_registry/server/utils/create_persistence_rule_type_wrapper.ts:21:23) at TaskRunner.executeAlerts (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:324:30) at promiseResult (/home/kevin/development/kibana/x-pack/plugins/alerting/server/lib/result_type.ts:47:17) at TaskRunner.loadRuleAttributesAndRun (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:576:14) at errorAsRuleTaskRunResult (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:1137:12) at TaskRunner.run (/home/kevin/development/kibana/x-pack/plugins/alerting/server/task_runner/task_runner.ts:641:45) at TaskManagerRunner.run (/home/kevin/development/kibana/x-pack/plugins/task_manager/server/task_running/task_runner.ts:305:22) ```
non_infrastructure
ecs template uses constant keyword for data stream fields ecs defines data stream dataset data stream namespace and data stream type as constant keyword fields however this prevents documents from populating those fields with arbitrary values when written the in the security solution modified the ecs mapping to make those fields keyword so that the values could be copied over from source documents however they are now defined as constant keyword in the rule registry this leads to errors when attempting to create alerts from elastic endpoint events that use those fields responseerror took errors true items of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got create index internal alerts security alerts default id status error type mapper parsing exception reason failed to parse field of type in document with id preview of field s value endpoint events process caused by type illegal argument exception reason field only accepts values that are equal to the value defined in the mappings but got at home kevin development kibana x pack plugins rule registry server rule data client rule data client ts at runmicrotasks at processticksandrejections node internal process task queues at alertwithpersistence home kevin development kibana x pack plugins rule registry server utils create persistence rule type wrapper ts at home kevin development kibana x pack plugins security solution server lib detection engine rule types factories bulk create factory ts at home kevin development kibana x pack plugins security solution server lib detection engine signals executors eql ts at object executor home kevin development kibana x pack plugins security solution server lib detection engine rule types eql create eql alert type ts at home kevin development kibana x pack plugins security solution server lib detection engine rule types create security rule type wrapper ts at object executor home kevin development kibana x pack plugins rule registry server utils create persistence rule type wrapper ts at taskrunner executealerts home kevin development kibana x pack plugins alerting server task runner task runner ts at promiseresult home kevin development kibana x pack plugins alerting server lib result type ts at taskrunner loadruleattributesandrun home kevin development kibana x pack plugins alerting server task runner task runner ts at errorasruletaskrunresult home kevin development kibana x pack plugins alerting server task runner task runner ts at taskrunner run home kevin development kibana x pack plugins alerting server task runner task runner ts at taskmanagerrunner run home kevin development kibana x pack plugins task manager server task running task runner ts
0
15,000
8,729,212,281
IssuesEvent
2018-12-10 19:36:08
mapbox/mapbox-gl-native
https://api.github.com/repos/mapbox/mapbox-gl-native
closed
User dot sometimes jitters during panning gesture
annotations iOS performance
Sometimes, the user dot (user location annotation view) moves inconsistently as the user pans the map view from side to side; in other words, it sometimes darts forward or backtracks, producing a jarring jittering effect. To illustrate the problem, here’s a 30&nbsp;fps recording at half speed ([original screen recording](https://www.dropbox.com/s/758utro56nkiv80/jitter.mp4?dl=0)): ![jitter](https://user-images.githubusercontent.com/1231218/44617763-ba6ca380-a81d-11e8-9c78-9109db675b24.gif) This effect is distinct from the issue in #5489, in which the map view lags behind the annotation views but the annotation views move at a consistent rate. That issue also reproduces during camera animations driven by mbgl, such as drift animations following gestures. By contrast, this issue only reproduces during panning gestures, even slow ones in which the underlying map is able to move at a consistent rate. It’s fairly difficult to reproduce reliably: scrubbing the same map region repeatedly will reliably reproduce the issue, but then it’ll stop reproducing after you switch applications or stop interacting with the map for awhile. The user dot differs from any other annotation view in that its `center` property is set inside an instantaneous UIView animation block that is triggered by `-glkView:drawInRect:` after telling mbgl to render a frame: https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L987-L989 https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L5743 https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L5939-L5953 `-glkView:drawInRect:` is driven by a CADisplayLink, which #2985 proposes eliminating. (Optionally, `-updateFromDisplayLink` will also throttle rendering, but that functionality isn’t enabled here.) Meanwhile, every other annotation view’s `center` property is set directly via `-mapViewDidFinishRenderingFrameFullyRendered:` after mbgl finishes rendering a frame: https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L5805 `-mapViewDidFinishRenderingFrameFullyRendered:` can be called not only after `-glkView:drawInRect:` asks mbgl to render a frame but also after mbgl renders a frame on its own volition. Perhaps not coincidentally, I’ve only been able to reproduce this issue when labels fade in and out as I pan the map, as seen in the recording above. That fading is driven entirely by a timer in mbgl, as are the drift animations in #5489. The iOS and macOS map SDKs use mbgl’s synchronous rendering path rather than the asynchronous rendering path that the Android map SDK uses. So on each frame rendered because of CADisplayLink, `-updateAnnotationViews` gets called before `-updateUserLocationAnnotationView`. ### Configuration **Mapbox SDK versions:** v4.3.0, but probably earlier **iOS/macOS versions:** 11.4.1 **Device/simulator models:** iPhone 8 **Xcode version:** 10.0 beta 6 /ref https://github.com/mapbox/mapbox-gl-native/issues/8874#issuecomment-300602917 /cc @mapbox/maps-ios
True
User dot sometimes jitters during panning gesture - Sometimes, the user dot (user location annotation view) moves inconsistently as the user pans the map view from side to side; in other words, it sometimes darts forward or backtracks, producing a jarring jittering effect. To illustrate the problem, here’s a 30&nbsp;fps recording at half speed ([original screen recording](https://www.dropbox.com/s/758utro56nkiv80/jitter.mp4?dl=0)): ![jitter](https://user-images.githubusercontent.com/1231218/44617763-ba6ca380-a81d-11e8-9c78-9109db675b24.gif) This effect is distinct from the issue in #5489, in which the map view lags behind the annotation views but the annotation views move at a consistent rate. That issue also reproduces during camera animations driven by mbgl, such as drift animations following gestures. By contrast, this issue only reproduces during panning gestures, even slow ones in which the underlying map is able to move at a consistent rate. It’s fairly difficult to reproduce reliably: scrubbing the same map region repeatedly will reliably reproduce the issue, but then it’ll stop reproducing after you switch applications or stop interacting with the map for awhile. The user dot differs from any other annotation view in that its `center` property is set inside an instantaneous UIView animation block that is triggered by `-glkView:drawInRect:` after telling mbgl to render a frame: https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L987-L989 https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L5743 https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L5939-L5953 `-glkView:drawInRect:` is driven by a CADisplayLink, which #2985 proposes eliminating. (Optionally, `-updateFromDisplayLink` will also throttle rendering, but that functionality isn’t enabled here.) Meanwhile, every other annotation view’s `center` property is set directly via `-mapViewDidFinishRenderingFrameFullyRendered:` after mbgl finishes rendering a frame: https://github.com/mapbox/mapbox-gl-native/blob/d297bf10ef89e97da30e1a00dd49560e18bcb3f0/platform/ios/src/MGLMapView.mm#L5805 `-mapViewDidFinishRenderingFrameFullyRendered:` can be called not only after `-glkView:drawInRect:` asks mbgl to render a frame but also after mbgl renders a frame on its own volition. Perhaps not coincidentally, I’ve only been able to reproduce this issue when labels fade in and out as I pan the map, as seen in the recording above. That fading is driven entirely by a timer in mbgl, as are the drift animations in #5489. The iOS and macOS map SDKs use mbgl’s synchronous rendering path rather than the asynchronous rendering path that the Android map SDK uses. So on each frame rendered because of CADisplayLink, `-updateAnnotationViews` gets called before `-updateUserLocationAnnotationView`. ### Configuration **Mapbox SDK versions:** v4.3.0, but probably earlier **iOS/macOS versions:** 11.4.1 **Device/simulator models:** iPhone 8 **Xcode version:** 10.0 beta 6 /ref https://github.com/mapbox/mapbox-gl-native/issues/8874#issuecomment-300602917 /cc @mapbox/maps-ios
non_infrastructure
user dot sometimes jitters during panning gesture sometimes the user dot user location annotation view moves inconsistently as the user pans the map view from side to side in other words it sometimes darts forward or backtracks producing a jarring jittering effect to illustrate the problem here’s a nbsp fps recording at half speed this effect is distinct from the issue in in which the map view lags behind the annotation views but the annotation views move at a consistent rate that issue also reproduces during camera animations driven by mbgl such as drift animations following gestures by contrast this issue only reproduces during panning gestures even slow ones in which the underlying map is able to move at a consistent rate it’s fairly difficult to reproduce reliably scrubbing the same map region repeatedly will reliably reproduce the issue but then it’ll stop reproducing after you switch applications or stop interacting with the map for awhile the user dot differs from any other annotation view in that its center property is set inside an instantaneous uiview animation block that is triggered by glkview drawinrect after telling mbgl to render a frame glkview drawinrect is driven by a cadisplaylink which proposes eliminating optionally updatefromdisplaylink will also throttle rendering but that functionality isn’t enabled here meanwhile every other annotation view’s center property is set directly via mapviewdidfinishrenderingframefullyrendered after mbgl finishes rendering a frame mapviewdidfinishrenderingframefullyrendered can be called not only after glkview drawinrect asks mbgl to render a frame but also after mbgl renders a frame on its own volition perhaps not coincidentally i’ve only been able to reproduce this issue when labels fade in and out as i pan the map as seen in the recording above that fading is driven entirely by a timer in mbgl as are the drift animations in the ios and macos map sdks use mbgl’s synchronous rendering path rather than the asynchronous rendering path that the android map sdk uses so on each frame rendered because of cadisplaylink updateannotationviews gets called before updateuserlocationannotationview configuration mapbox sdk versions but probably earlier ios macos versions device simulator models iphone xcode version beta ref cc mapbox maps ios
0
117,511
17,484,857,756
IssuesEvent
2021-08-09 09:39:10
AlexRogalskiy/charts
https://api.github.com/repos/AlexRogalskiy/charts
opened
CVE-2020-11022 (Medium) detected in jquery-1.9.1.js, jquery-1.8.1.min.js
security vulnerability
## CVE-2020-11022 - Medium Severity Vulnerability <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Libraries - <b>jquery-1.9.1.js</b>, <b>jquery-1.8.1.min.js</b></p></summary> <p> <details><summary><b>jquery-1.9.1.js</b></p></summary> <p>JavaScript library for DOM operations</p> <p>Library home page: <a href="https://cdnjs.cloudflare.com/ajax/libs/jquery/1.9.1/jquery.js">https://cdnjs.cloudflare.com/ajax/libs/jquery/1.9.1/jquery.js</a></p> <p>Path to dependency file: charts/node_modules/tinygradient/bower_components/tinycolor/index.html</p> <p>Path to vulnerable library: /node_modules/tinygradient/bower_components/tinycolor/demo/jquery-1.9.1.js</p> <p> Dependency Hierarchy: - :x: **jquery-1.9.1.js** (Vulnerable Library) </details> <details><summary><b>jquery-1.8.1.min.js</b></p></summary> <p>JavaScript library for DOM operations</p> <p>Library home page: <a href="https://cdnjs.cloudflare.com/ajax/libs/jquery/1.8.1/jquery.min.js">https://cdnjs.cloudflare.com/ajax/libs/jquery/1.8.1/jquery.min.js</a></p> <p>Path to dependency file: charts/node_modules/redeyed/examples/browser/index.html</p> <p>Path to vulnerable library: /node_modules/redeyed/examples/browser/index.html</p> <p> Dependency Hierarchy: - :x: **jquery-1.8.1.min.js** (Vulnerable Library) </details> <p>Found in HEAD commit: <a href="https://github.com/AlexRogalskiy/charts/commit/f60b50f19fc43d1c1caf90f5f9b2588f2bfd05f6">f60b50f19fc43d1c1caf90f5f9b2588f2bfd05f6</a></p> <p>Found in base branch: <b>master</b></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/medium_vul.png' width=19 height=20> Vulnerability Details</summary> <p> In jQuery versions greater than or equal to 1.2 and before 3.5.0, passing HTML from untrusted sources - even after sanitizing it - to one of jQuery's DOM manipulation methods (i.e. .html(), .append(), and others) may execute untrusted code. This problem is patched in jQuery 3.5.0. <p>Publish Date: 2020-04-29 <p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11022>CVE-2020-11022</a></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>6.1</b>)</summary> <p> Base Score Metrics: - Exploitability Metrics: - Attack Vector: Network - Attack Complexity: Low - Privileges Required: None - User Interaction: Required - Scope: Changed - Impact Metrics: - Confidentiality Impact: Low - Integrity Impact: Low - Availability Impact: None </p> For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>. </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary> <p> <p>Type: Upgrade version</p> <p>Origin: <a href="https://blog.jquery.com/2020/04/10/jquery-3-5-0-released/">https://blog.jquery.com/2020/04/10/jquery-3-5-0-released/</a></p> <p>Release Date: 2020-04-29</p> <p>Fix Resolution: jQuery - 3.5.0</p> </p> </details> <p></p> *** Step up your Open Source Security Game with WhiteSource [here](https://www.whitesourcesoftware.com/full_solution_bolt_github)
True
CVE-2020-11022 (Medium) detected in jquery-1.9.1.js, jquery-1.8.1.min.js - ## CVE-2020-11022 - Medium Severity Vulnerability <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Libraries - <b>jquery-1.9.1.js</b>, <b>jquery-1.8.1.min.js</b></p></summary> <p> <details><summary><b>jquery-1.9.1.js</b></p></summary> <p>JavaScript library for DOM operations</p> <p>Library home page: <a href="https://cdnjs.cloudflare.com/ajax/libs/jquery/1.9.1/jquery.js">https://cdnjs.cloudflare.com/ajax/libs/jquery/1.9.1/jquery.js</a></p> <p>Path to dependency file: charts/node_modules/tinygradient/bower_components/tinycolor/index.html</p> <p>Path to vulnerable library: /node_modules/tinygradient/bower_components/tinycolor/demo/jquery-1.9.1.js</p> <p> Dependency Hierarchy: - :x: **jquery-1.9.1.js** (Vulnerable Library) </details> <details><summary><b>jquery-1.8.1.min.js</b></p></summary> <p>JavaScript library for DOM operations</p> <p>Library home page: <a href="https://cdnjs.cloudflare.com/ajax/libs/jquery/1.8.1/jquery.min.js">https://cdnjs.cloudflare.com/ajax/libs/jquery/1.8.1/jquery.min.js</a></p> <p>Path to dependency file: charts/node_modules/redeyed/examples/browser/index.html</p> <p>Path to vulnerable library: /node_modules/redeyed/examples/browser/index.html</p> <p> Dependency Hierarchy: - :x: **jquery-1.8.1.min.js** (Vulnerable Library) </details> <p>Found in HEAD commit: <a href="https://github.com/AlexRogalskiy/charts/commit/f60b50f19fc43d1c1caf90f5f9b2588f2bfd05f6">f60b50f19fc43d1c1caf90f5f9b2588f2bfd05f6</a></p> <p>Found in base branch: <b>master</b></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/medium_vul.png' width=19 height=20> Vulnerability Details</summary> <p> In jQuery versions greater than or equal to 1.2 and before 3.5.0, passing HTML from untrusted sources - even after sanitizing it - to one of jQuery's DOM manipulation methods (i.e. .html(), .append(), and others) may execute untrusted code. This problem is patched in jQuery 3.5.0. <p>Publish Date: 2020-04-29 <p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2020-11022>CVE-2020-11022</a></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>6.1</b>)</summary> <p> Base Score Metrics: - Exploitability Metrics: - Attack Vector: Network - Attack Complexity: Low - Privileges Required: None - User Interaction: Required - Scope: Changed - Impact Metrics: - Confidentiality Impact: Low - Integrity Impact: Low - Availability Impact: None </p> For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>. </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary> <p> <p>Type: Upgrade version</p> <p>Origin: <a href="https://blog.jquery.com/2020/04/10/jquery-3-5-0-released/">https://blog.jquery.com/2020/04/10/jquery-3-5-0-released/</a></p> <p>Release Date: 2020-04-29</p> <p>Fix Resolution: jQuery - 3.5.0</p> </p> </details> <p></p> *** Step up your Open Source Security Game with WhiteSource [here](https://www.whitesourcesoftware.com/full_solution_bolt_github)
non_infrastructure
cve medium detected in jquery js jquery min js cve medium severity vulnerability vulnerable libraries jquery js jquery min js jquery js javascript library for dom operations library home page a href path to dependency file charts node modules tinygradient bower components tinycolor index html path to vulnerable library node modules tinygradient bower components tinycolor demo jquery js dependency hierarchy x jquery js vulnerable library jquery min js javascript library for dom operations library home page a href path to dependency file charts node modules redeyed examples browser index html path to vulnerable library node modules redeyed examples browser index html dependency hierarchy x jquery min js vulnerable library found in head commit a href found in base branch master vulnerability details in jquery versions greater than or equal to and before passing html from untrusted sources even after sanitizing it to one of jquery s dom manipulation methods i e html append and others may execute untrusted code this problem is patched in jquery publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction required scope changed impact metrics confidentiality impact low integrity impact low availability impact none for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution jquery step up your open source security game with whitesource
0
12,482
9,799,915,456
IssuesEvent
2019-06-11 15:17:37
dotnet/corefx
https://api.github.com/repos/dotnet/corefx
closed
[source-build] Implement a source-build workflow for GenAPI
area-Infrastructure
We need GenAPI for product build to produce not supported assemblies. GenAPI depends on CCI which isn't part of source build. To deal with this, we'll depend on a pre-built version GenAPI during the online portion of SourceBuild ('$(OfflineBuild)' != 'true' AND '$(DotNetBuildFromSource)' == 'true'). During this phase we'll make sure all the generated source files are copied to a directory under a specified location: `$(DotNetSourceBuildIntermediatePath)`. We'll write files in a subfolder pattern similar to intermediate (including project name and configuration) so that we can find them again later. During the offline portion of source build ('$(OfflineBuild)' == 'true' AND '$(DotNetBuildFromSource)' == 'true') we won't depend on GenAPI and will instead have targets which look for the pre-generated files under `$(DotNetSourceBuildIntermediatePath)`. We'll error if we cannot find them. /cc @dseefeld @safern @ViktorHofer @Anipik
1.0
[source-build] Implement a source-build workflow for GenAPI - We need GenAPI for product build to produce not supported assemblies. GenAPI depends on CCI which isn't part of source build. To deal with this, we'll depend on a pre-built version GenAPI during the online portion of SourceBuild ('$(OfflineBuild)' != 'true' AND '$(DotNetBuildFromSource)' == 'true'). During this phase we'll make sure all the generated source files are copied to a directory under a specified location: `$(DotNetSourceBuildIntermediatePath)`. We'll write files in a subfolder pattern similar to intermediate (including project name and configuration) so that we can find them again later. During the offline portion of source build ('$(OfflineBuild)' == 'true' AND '$(DotNetBuildFromSource)' == 'true') we won't depend on GenAPI and will instead have targets which look for the pre-generated files under `$(DotNetSourceBuildIntermediatePath)`. We'll error if we cannot find them. /cc @dseefeld @safern @ViktorHofer @Anipik
infrastructure
implement a source build workflow for genapi we need genapi for product build to produce not supported assemblies genapi depends on cci which isn t part of source build to deal with this we ll depend on a pre built version genapi during the online portion of sourcebuild offlinebuild true and dotnetbuildfromsource true during this phase we ll make sure all the generated source files are copied to a directory under a specified location dotnetsourcebuildintermediatepath we ll write files in a subfolder pattern similar to intermediate including project name and configuration so that we can find them again later during the offline portion of source build offlinebuild true and dotnetbuildfromsource true we won t depend on genapi and will instead have targets which look for the pre generated files under dotnetsourcebuildintermediatepath we ll error if we cannot find them cc dseefeld safern viktorhofer anipik
1
11,152
8,968,330,659
IssuesEvent
2019-01-29 07:40:40
pinussilvestrus/zeebe-modeler
https://api.github.com/repos/pinussilvestrus/zeebe-modeler
closed
Switch default branch to master
enhancement infrastructure
- [ ] Switch to master branch as default in GitHub - [ ] Switch to master branch in [`sync-task`](https://github.com/pinussilvestrus/zeebe-modeler/blob/next/tasks/sync-fork.js#L15) Depending on refactoring in [`base-modeler`](https://github.com/camunda/camunda-modeler/issues/866).
1.0
Switch default branch to master - - [ ] Switch to master branch as default in GitHub - [ ] Switch to master branch in [`sync-task`](https://github.com/pinussilvestrus/zeebe-modeler/blob/next/tasks/sync-fork.js#L15) Depending on refactoring in [`base-modeler`](https://github.com/camunda/camunda-modeler/issues/866).
infrastructure
switch default branch to master switch to master branch as default in github switch to master branch in depending on refactoring in
1
2,329
3,619,701,871
IssuesEvent
2016-02-08 16:59:06
dotnet/roslyn
https://api.github.com/repos/dotnet/roslyn
opened
Binaries should be signed with SHA2 certs
2 - Ready Area-Infrastructure Feature Request
We need to move our SHA1 certs -> SHA2 certs as Windows stopped support SHA1 at the start of the year. Basically, look for all usages of <AuthenticodeCertificateName> with a value that is a SHA1 cert, and replace it with a SHA2 equivalent. The authenticode mapping is here: ``` XML <?xml version="1.0" encoding="utf-8" ?> <CertificateMappings> <Authenticode> <Certificate Name="Microsoft" Cert="401" /> <Certificate Name="Microsoft400" Cert="400" /> <Certificate Name="Microsoft402" Cert="402" /> <Certificate Name="MobileDevice" Cert="30" /> <Certificate Name="NativeAssembly" Cert="65" /> <Certificate Name="ExceptionPack" Cert="49" /> <Certificate Name="Xml94" Cert="94" /> <Certificate Name="AppxWin81" Cert="300" /> <Certificate Name="Appx" Cert="320" /> <Certificate Name="Vsix" Cert="160" /> <Certificate Name="VsixSHA2" Cert="100040160" /> <Certificate Name="MicrosoftSHA1" Cert="10006" /> <Certificate Name="WindowsPhone" Cert="123" /> <Certificate Name="MicrosoftSHA2" Cert="200" /> <Certificate Name="Microsoft201" Cert="201" /> <Certificate Name="MSDynamicCodePublish" Cert="216" /> <Certificate Name="MSDynamicCodePublishDual" Cert="219" /> <Certificate Name="WindowsPhone223" Cert="223" /> <Certificate Name="WindowsPhone623" Cert="623" /> <Certificate Name="WindowsPhone691" Cert="691" /> <Certificate Name="MicrosoftWinBlue" Cert="444" /> <!-- Single Sign --> <Certificate Name="Microsoft445" Cert="445" /> <Certificate Name="Microsoft644" Cert="644" /> <Certificate Name="Microsoft645" Cert="645" /> <Certificate Name="MicrosoftWin8WinBlue" Cert="253" /> <!-- Dual Sign --> <Certificate Name="Microsoft253" Cert="254" /> <!-- 252 w/PH --> <Certificate Name="MicrosoftSHA1Win8WinBlue" Cert="255" /> <!-- Triple Sign --> <Certificate Name="PPMicrosoftWin8WinBlue" Cert="553" /> <Certificate Name="Microsoft553" Cert="554" /> <Certificate Name="PPMicrosoftSHA1Win8WinBlue" Cert="555" /> <Certificate Name="Microsoft411" Cert="411" /> <!-- 401 w/PH --> </Authenticode> </CertificateMappings> ```
1.0
Binaries should be signed with SHA2 certs - We need to move our SHA1 certs -> SHA2 certs as Windows stopped support SHA1 at the start of the year. Basically, look for all usages of <AuthenticodeCertificateName> with a value that is a SHA1 cert, and replace it with a SHA2 equivalent. The authenticode mapping is here: ``` XML <?xml version="1.0" encoding="utf-8" ?> <CertificateMappings> <Authenticode> <Certificate Name="Microsoft" Cert="401" /> <Certificate Name="Microsoft400" Cert="400" /> <Certificate Name="Microsoft402" Cert="402" /> <Certificate Name="MobileDevice" Cert="30" /> <Certificate Name="NativeAssembly" Cert="65" /> <Certificate Name="ExceptionPack" Cert="49" /> <Certificate Name="Xml94" Cert="94" /> <Certificate Name="AppxWin81" Cert="300" /> <Certificate Name="Appx" Cert="320" /> <Certificate Name="Vsix" Cert="160" /> <Certificate Name="VsixSHA2" Cert="100040160" /> <Certificate Name="MicrosoftSHA1" Cert="10006" /> <Certificate Name="WindowsPhone" Cert="123" /> <Certificate Name="MicrosoftSHA2" Cert="200" /> <Certificate Name="Microsoft201" Cert="201" /> <Certificate Name="MSDynamicCodePublish" Cert="216" /> <Certificate Name="MSDynamicCodePublishDual" Cert="219" /> <Certificate Name="WindowsPhone223" Cert="223" /> <Certificate Name="WindowsPhone623" Cert="623" /> <Certificate Name="WindowsPhone691" Cert="691" /> <Certificate Name="MicrosoftWinBlue" Cert="444" /> <!-- Single Sign --> <Certificate Name="Microsoft445" Cert="445" /> <Certificate Name="Microsoft644" Cert="644" /> <Certificate Name="Microsoft645" Cert="645" /> <Certificate Name="MicrosoftWin8WinBlue" Cert="253" /> <!-- Dual Sign --> <Certificate Name="Microsoft253" Cert="254" /> <!-- 252 w/PH --> <Certificate Name="MicrosoftSHA1Win8WinBlue" Cert="255" /> <!-- Triple Sign --> <Certificate Name="PPMicrosoftWin8WinBlue" Cert="553" /> <Certificate Name="Microsoft553" Cert="554" /> <Certificate Name="PPMicrosoftSHA1Win8WinBlue" Cert="555" /> <Certificate Name="Microsoft411" Cert="411" /> <!-- 401 w/PH --> </Authenticode> </CertificateMappings> ```
infrastructure
binaries should be signed with certs we need to move our certs certs as windows stopped support at the start of the year basically look for all usages of with a value that is a cert and replace it with a equivalent the authenticode mapping is here xml
1
10,749
8,705,858,193
IssuesEvent
2018-12-06 00:02:38
APSIMInitiative/ApsimX
https://api.github.com/repos/APSIMInitiative/ApsimX
closed
time series x-axis not re-scaling correctly as specified
bug interface/infrastructure
Happening in any model with time series data. Doesn't seem to be a way to specify an alternative date on the x-axis. Model may crash depending on what is entered.
1.0
time series x-axis not re-scaling correctly as specified - Happening in any model with time series data. Doesn't seem to be a way to specify an alternative date on the x-axis. Model may crash depending on what is entered.
infrastructure
time series x axis not re scaling correctly as specified happening in any model with time series data doesn t seem to be a way to specify an alternative date on the x axis model may crash depending on what is entered
1
295,285
25,466,408,537
IssuesEvent
2022-11-25 05:09:21
pingcap/tidb
https://api.github.com/repos/pingcap/tidb
closed
unstable test: lightning_max_random
type/bug component/test severity/major component/lightning may-affects-6.3 affects-6.4
## Bug Report Please answer these questions before submitting your issue. Thanks! ### 1. Minimal reproduce step (Required) /run-integration-br-test <!-- a step by step guide for reproducing the bug. --> ### 2. What did you expect to see? (Required) CI success ### 3. What did you see instead (Required) ![img_v2_9c0360b4-648a-4a33-acd7-8b2b363c267g](https://user-images.githubusercontent.com/25972139/191669033-49e6b2f8-b8de-4be8-9f7b-8cd2c0cf8139.jpg) ### 4. What is your TiDB version? (Required) 3f43ecfd5217a4a4fd68a5679fdf4c4e83cdb99e <!-- Paste the output of SELECT tidb_version() -->
1.0
unstable test: lightning_max_random - ## Bug Report Please answer these questions before submitting your issue. Thanks! ### 1. Minimal reproduce step (Required) /run-integration-br-test <!-- a step by step guide for reproducing the bug. --> ### 2. What did you expect to see? (Required) CI success ### 3. What did you see instead (Required) ![img_v2_9c0360b4-648a-4a33-acd7-8b2b363c267g](https://user-images.githubusercontent.com/25972139/191669033-49e6b2f8-b8de-4be8-9f7b-8cd2c0cf8139.jpg) ### 4. What is your TiDB version? (Required) 3f43ecfd5217a4a4fd68a5679fdf4c4e83cdb99e <!-- Paste the output of SELECT tidb_version() -->
non_infrastructure
unstable test lightning max random bug report please answer these questions before submitting your issue thanks minimal reproduce step required run integration br test what did you expect to see required ci success what did you see instead required what is your tidb version required
0
23,012
15,737,410,831
IssuesEvent
2021-03-30 02:51:49
APSIMInitiative/ApsimX
https://api.github.com/repos/APSIMInitiative/ApsimX
closed
Slurp validation uses SoilN
bug interface/infrastructure
@hol353 - do we want to change these to nutrient? This will probably have an impact on the stats.
1.0
Slurp validation uses SoilN - @hol353 - do we want to change these to nutrient? This will probably have an impact on the stats.
infrastructure
slurp validation uses soiln do we want to change these to nutrient this will probably have an impact on the stats
1
33,485
27,499,117,760
IssuesEvent
2023-03-05 13:47:53
WebvigLaboratories/ynti-roadmap
https://api.github.com/repos/WebvigLaboratories/ynti-roadmap
opened
Modify signup to include payment authorization
alpha infrastructure
**Summary** Before launch to production, new signups should include a subscription plan (including a 30-day trial) **Intended Outcome** Authorized users should be part of a subscription plan. **How will it work?** More on this later.
1.0
Modify signup to include payment authorization - **Summary** Before launch to production, new signups should include a subscription plan (including a 30-day trial) **Intended Outcome** Authorized users should be part of a subscription plan. **How will it work?** More on this later.
infrastructure
modify signup to include payment authorization summary before launch to production new signups should include a subscription plan including a day trial intended outcome authorized users should be part of a subscription plan how will it work more on this later
1
6,917
3,482,406,188
IssuesEvent
2015-12-29 23:08:14
ArcticaProject/nx-libs
https://api.github.com/repos/ArcticaProject/nx-libs
closed
remove libXinerama from build
code cleanup
I have stumbled over this commit: http://cgit.freedesktop.org/xorg/xserver/commit/?id=2c69deb92e11542f615df0f24fdc03e3b4415475 I think we should include that into 3.6.x to simplify the build process. commit 2c69deb92e11542f615df0f24fdc03e3b4415475 Author: Rémi Cardona <remi@gentoo.org> Date: Fri Jul 3 10:51:50 2009 +0200 configure: libXinerama isn't needed anymore since libXinerama commit 90d4d23bf2e94721149ddc0a80093b10a82e8845 and xineramaproto commit 21477147613c28c968b5e1eb9d8aea7017dd399d, the server no longer needs libXinerama. Signed-off-by: Rémi Cardona <remi@gentoo.org>
1.0
remove libXinerama from build - I have stumbled over this commit: http://cgit.freedesktop.org/xorg/xserver/commit/?id=2c69deb92e11542f615df0f24fdc03e3b4415475 I think we should include that into 3.6.x to simplify the build process. commit 2c69deb92e11542f615df0f24fdc03e3b4415475 Author: Rémi Cardona <remi@gentoo.org> Date: Fri Jul 3 10:51:50 2009 +0200 configure: libXinerama isn't needed anymore since libXinerama commit 90d4d23bf2e94721149ddc0a80093b10a82e8845 and xineramaproto commit 21477147613c28c968b5e1eb9d8aea7017dd399d, the server no longer needs libXinerama. Signed-off-by: Rémi Cardona <remi@gentoo.org>
non_infrastructure
remove libxinerama from build i have stumbled over this commit i think we should include that into x to simplify the build process commit author rémi cardona date fri jul configure libxinerama isn t needed anymore since libxinerama commit and xineramaproto commit the server no longer needs libxinerama signed off by rémi cardona
0
7,978
7,176,789,014
IssuesEvent
2018-01-31 11:14:31
pytest-dev/pytest
https://api.github.com/repos/pytest-dev/pytest
closed
Pytest internal error with last release on travis
type: bug type: infrastructure
With py.test 3.4 NoneType has no attribute testcollected. - https://travis-ci.org/Kinto/kinto/jobs/335549257 - https://travis-ci.org/mozilla/PollBot/jobs/335527508 ``` INTERNALERROR> File "/home/travis/build/mozilla/PollBot/.tox/py35/lib/python3.5/site-packages/_pytest/terminal.py", line 315, in pytest_runtest_logfinish INTERNALERROR> last_item = len(self._progress_nodeids_reported) == self._session.testscollected INTERNALERROR> AttributeError: 'NoneType' object has no attribute 'testscollected' ```
1.0
Pytest internal error with last release on travis - With py.test 3.4 NoneType has no attribute testcollected. - https://travis-ci.org/Kinto/kinto/jobs/335549257 - https://travis-ci.org/mozilla/PollBot/jobs/335527508 ``` INTERNALERROR> File "/home/travis/build/mozilla/PollBot/.tox/py35/lib/python3.5/site-packages/_pytest/terminal.py", line 315, in pytest_runtest_logfinish INTERNALERROR> last_item = len(self._progress_nodeids_reported) == self._session.testscollected INTERNALERROR> AttributeError: 'NoneType' object has no attribute 'testscollected' ```
infrastructure
pytest internal error with last release on travis with py test nonetype has no attribute testcollected internalerror file home travis build mozilla pollbot tox lib site packages pytest terminal py line in pytest runtest logfinish internalerror last item len self progress nodeids reported self session testscollected internalerror attributeerror nonetype object has no attribute testscollected
1
575,738
17,048,448,366
IssuesEvent
2021-07-06 05:13:05
ballerina-platform/ballerina-lang
https://api.github.com/repos/ballerina-platform/ballerina-lang
closed
Add a flag to LS for configuring the LS internal compilations to run online
Priority/High SwanLakeDump Team/LanguageServer Type/Improvement
**Description:** $title Currently, the language server strictly enforce the builds to run offline, in order to avoid the central calls and to improve the response time for the users. We need to make this a configurable value by setting a system property. **Affected Versions:** Swanlake-alpha1 at least
1.0
Add a flag to LS for configuring the LS internal compilations to run online - **Description:** $title Currently, the language server strictly enforce the builds to run offline, in order to avoid the central calls and to improve the response time for the users. We need to make this a configurable value by setting a system property. **Affected Versions:** Swanlake-alpha1 at least
non_infrastructure
add a flag to ls for configuring the ls internal compilations to run online description title currently the language server strictly enforce the builds to run offline in order to avoid the central calls and to improve the response time for the users we need to make this a configurable value by setting a system property affected versions swanlake at least
0
17,778
12,551,378,459
IssuesEvent
2020-06-06 14:33:34
javahippie/clj-test-containers
https://api.github.com/repos/javahippie/clj-test-containers
closed
Switch from Boot to Leiningen
enhancement infrastructure
As boot is not maintained anymore, Leiningen poses a more stable option
1.0
Switch from Boot to Leiningen - As boot is not maintained anymore, Leiningen poses a more stable option
infrastructure
switch from boot to leiningen as boot is not maintained anymore leiningen poses a more stable option
1
13,562
10,324,290,600
IssuesEvent
2019-09-01 07:46:13
dotnet/corefx
https://api.github.com/repos/dotnet/corefx
closed
Problem with building source code
area-Infrastructure os-windows question
I used the [Development environment setup for Windows][1] for pre-required setups and installed CMake-3.14.6. I executed `.\build.cmd -restore -build -buildtests -test` And got the following result: ``` C:\Program Files (x86)\Microsoft Visual Studio\2019\Preview\MSBuild\Current\Bin\Microsoft.Common.CurrentVersion.targets(775,5): error : The OutputPath property is not set for project 'VCTargetsPath.vcxproj'. Please check to make sure that you have specified a valid combination of Configuration and Platform for this project. Configuration='Debug' Platform='x64'. You may be seeing this message because you are trying to build a project without a solution file, and have specified a non-default Configuration or Platform that doesn't exist for this project. [C:\code\corefx\artifacts\obj\native\netcoreapp-Windows_NT-Debug-x64\CMakeFiles\3.14.6\VCTargetsPath.vcxproj] [C:\code\corefx\src\Native\build-native.proj] C:\Program Files (x86)\Microsoft Visual Studio\2019\Preview\MSBuild\Current\Bin\Microsoft.Common.CurrentVersion.targets(775,5): error : The OutputPath property is not set for project 'VCTargetsPath.vcxproj'. Please check to make sure that you have specified a valid combination of Configuration and Platform for this project. Configuration='Debug' Platform='x64'. You may be seeing this message because you are trying to build a project without a solution file, and have specified a non-default Configuration or Platform that doesn't exist for this project. [C:\code\corefx\artifacts\obj\native\netcoreapp-Windows_NT-Debug-x64\CMakeFiles\3.14.6\VCTargetsPath.vcxproj] [C:\code\corefx\src\Native\build-native.proj] C:\code\corefx\src\Native\build-native.proj(50,5): error MSB3073: The command ""C:\code\corefx\src\Native\build-native.cmd" x64 Debug Windows_NT outconfig netcoreapp-Windows_NT-Debug-x64" exited with code 1. ``` Information ``` VCTargetsPath: C:\Program Files (x86)\Microsoft Visual Studio\2019\BuildTools\MSBuild\Microsoft\VC\v160 Visual Studio 2019 16.3 preview 2 .NET Core SDK (reflecting any global.json): Version: 3.0.100-preview8-013656 Commit: 8bf06ffc8d Runtime Environment: OS Name: Windows OS Version: 10.0.18362 OS Platform: Windows RID: win10-x64 Base Path: C:\Program Files\dotnet\sdk\3.0.100-preview8-013656\ Host (useful for support): Version: 3.0.0-preview8-28405-07 Commit: d01b2fb7bc .NET Core SDKs installed: 2.1.800-preview-009696 [C:\Program Files\dotnet\sdk] 2.1.800 [C:\Program Files\dotnet\sdk] 2.2.300 [C:\Program Files\dotnet\sdk] 3.0.100-preview6-012264 [C:\Program Files\dotnet\sdk] 3.0.100-preview8-013656 [C:\Program Files\dotnet\sdk] ``` [1]:https://github.com/dotnet/corefx/wiki/Development-environment-setup-for-Windows
1.0
Problem with building source code - I used the [Development environment setup for Windows][1] for pre-required setups and installed CMake-3.14.6. I executed `.\build.cmd -restore -build -buildtests -test` And got the following result: ``` C:\Program Files (x86)\Microsoft Visual Studio\2019\Preview\MSBuild\Current\Bin\Microsoft.Common.CurrentVersion.targets(775,5): error : The OutputPath property is not set for project 'VCTargetsPath.vcxproj'. Please check to make sure that you have specified a valid combination of Configuration and Platform for this project. Configuration='Debug' Platform='x64'. You may be seeing this message because you are trying to build a project without a solution file, and have specified a non-default Configuration or Platform that doesn't exist for this project. [C:\code\corefx\artifacts\obj\native\netcoreapp-Windows_NT-Debug-x64\CMakeFiles\3.14.6\VCTargetsPath.vcxproj] [C:\code\corefx\src\Native\build-native.proj] C:\Program Files (x86)\Microsoft Visual Studio\2019\Preview\MSBuild\Current\Bin\Microsoft.Common.CurrentVersion.targets(775,5): error : The OutputPath property is not set for project 'VCTargetsPath.vcxproj'. Please check to make sure that you have specified a valid combination of Configuration and Platform for this project. Configuration='Debug' Platform='x64'. You may be seeing this message because you are trying to build a project without a solution file, and have specified a non-default Configuration or Platform that doesn't exist for this project. [C:\code\corefx\artifacts\obj\native\netcoreapp-Windows_NT-Debug-x64\CMakeFiles\3.14.6\VCTargetsPath.vcxproj] [C:\code\corefx\src\Native\build-native.proj] C:\code\corefx\src\Native\build-native.proj(50,5): error MSB3073: The command ""C:\code\corefx\src\Native\build-native.cmd" x64 Debug Windows_NT outconfig netcoreapp-Windows_NT-Debug-x64" exited with code 1. ``` Information ``` VCTargetsPath: C:\Program Files (x86)\Microsoft Visual Studio\2019\BuildTools\MSBuild\Microsoft\VC\v160 Visual Studio 2019 16.3 preview 2 .NET Core SDK (reflecting any global.json): Version: 3.0.100-preview8-013656 Commit: 8bf06ffc8d Runtime Environment: OS Name: Windows OS Version: 10.0.18362 OS Platform: Windows RID: win10-x64 Base Path: C:\Program Files\dotnet\sdk\3.0.100-preview8-013656\ Host (useful for support): Version: 3.0.0-preview8-28405-07 Commit: d01b2fb7bc .NET Core SDKs installed: 2.1.800-preview-009696 [C:\Program Files\dotnet\sdk] 2.1.800 [C:\Program Files\dotnet\sdk] 2.2.300 [C:\Program Files\dotnet\sdk] 3.0.100-preview6-012264 [C:\Program Files\dotnet\sdk] 3.0.100-preview8-013656 [C:\Program Files\dotnet\sdk] ``` [1]:https://github.com/dotnet/corefx/wiki/Development-environment-setup-for-Windows
infrastructure
problem with building source code i used the for pre required setups and installed cmake i executed build cmd restore build buildtests test and got the following result c program files microsoft visual studio preview msbuild current bin microsoft common currentversion targets error the outputpath property is not set for project vctargetspath vcxproj please check to make sure that you have specified a valid combination of configuration and platform for this project configuration debug platform you may be seeing this message because you are trying to build a project without a solution file and have specified a non default configuration or platform that doesn t exist for this project c program files microsoft visual studio preview msbuild current bin microsoft common currentversion targets error the outputpath property is not set for project vctargetspath vcxproj please check to make sure that you have specified a valid combination of configuration and platform for this project configuration debug platform you may be seeing this message because you are trying to build a project without a solution file and have specified a non default configuration or platform that doesn t exist for this project c code corefx src native build native proj error the command c code corefx src native build native cmd debug windows nt outconfig netcoreapp windows nt debug exited with code information vctargetspath c program files microsoft visual studio buildtools msbuild microsoft vc visual studio preview net core sdk reflecting any global json version commit runtime environment os name windows os version os platform windows rid base path c program files dotnet sdk host useful for support version commit net core sdks installed preview
1
140,716
21,188,480,874
IssuesEvent
2022-04-08 14:56:22
department-of-veterans-affairs/va.gov-team
https://api.github.com/repos/department-of-veterans-affairs/va.gov-team
opened
VAOS Vaccine Workflow Update
vaos-product-design
## User Story / Problem Statement As a Veteran who uses VAOS, I want to schedule a vaccine appointment. **Background** ## Product - [ ] Product Outline / Initiative Summary - [ ] Release Plan - [ ] Update product guide ### Collaboration Cycle VSP Collaboration Cycle checkpoints: - [ ] Project Kickoff - [ ] Midpoint Review - [ ] Staging Review - [ ] Privacy & Security Review - [ ] Full Accessibility & 508 Office Audit - [ ] Contact Center Review ## Research TBD ## Design TBD ## Definition of Done A Veteran can schedule a vaccine appointment in VAOS.
1.0
VAOS Vaccine Workflow Update - ## User Story / Problem Statement As a Veteran who uses VAOS, I want to schedule a vaccine appointment. **Background** ## Product - [ ] Product Outline / Initiative Summary - [ ] Release Plan - [ ] Update product guide ### Collaboration Cycle VSP Collaboration Cycle checkpoints: - [ ] Project Kickoff - [ ] Midpoint Review - [ ] Staging Review - [ ] Privacy & Security Review - [ ] Full Accessibility & 508 Office Audit - [ ] Contact Center Review ## Research TBD ## Design TBD ## Definition of Done A Veteran can schedule a vaccine appointment in VAOS.
non_infrastructure
vaos vaccine workflow update user story problem statement as a veteran who uses vaos i want to schedule a vaccine appointment background product product outline initiative summary release plan update product guide collaboration cycle vsp collaboration cycle checkpoints project kickoff midpoint review staging review privacy security review full accessibility office audit contact center review research tbd design tbd definition of done a veteran can schedule a vaccine appointment in vaos
0
367,763
10,861,527,760
IssuesEvent
2019-11-14 11:16:38
MarcTowler/ItsLit-RPG-Tracker
https://api.github.com/repos/MarcTowler/ItsLit-RPG-Tracker
closed
Monster Fight Additional Areas
GAPI Medium Priority enhancement
Following on from #5, I currently have hard coded the bot and GAPI to only post in the starter area (level 1-5)... Need to look at how I am going to expand that to other level grouping
1.0
Monster Fight Additional Areas - Following on from #5, I currently have hard coded the bot and GAPI to only post in the starter area (level 1-5)... Need to look at how I am going to expand that to other level grouping
non_infrastructure
monster fight additional areas following on from i currently have hard coded the bot and gapi to only post in the starter area level need to look at how i am going to expand that to other level grouping
0
32,315
8,826,638,901
IssuesEvent
2019-01-03 03:38:55
scipy/scipy
https://api.github.com/repos/scipy/scipy
closed
noprefix.h removal causing wheel build failures
Build issues prio-high
gh-9561 removed the use of numpy's `noprefix.h` from master. It was then backported and caused wheel build failures: https://travis-ci.org/MacPython/scipy-wheels/builds/463460018. gh-9572 then reverted the change in `maintenance/1.2.x`. So current status is that master passes regular CI, but is breaking the wheel builds. We need to: - figure out the problem and fix it - understand why wheel build issues were not picked up in our regular CI.
1.0
noprefix.h removal causing wheel build failures - gh-9561 removed the use of numpy's `noprefix.h` from master. It was then backported and caused wheel build failures: https://travis-ci.org/MacPython/scipy-wheels/builds/463460018. gh-9572 then reverted the change in `maintenance/1.2.x`. So current status is that master passes regular CI, but is breaking the wheel builds. We need to: - figure out the problem and fix it - understand why wheel build issues were not picked up in our regular CI.
non_infrastructure
noprefix h removal causing wheel build failures gh removed the use of numpy s noprefix h from master it was then backported and caused wheel build failures gh then reverted the change in maintenance x so current status is that master passes regular ci but is breaking the wheel builds we need to figure out the problem and fix it understand why wheel build issues were not picked up in our regular ci
0
26,124
19,681,606,283
IssuesEvent
2022-01-11 17:17:49
google/web-stories-wp
https://api.github.com/repos/google/web-stories-wp
opened
Karma: Explore running tests in parallel
Type: Infrastructure Pod: WP & Infra
<!-- NOTE: For help requests, support questions, or general feedback, please use the WordPress.org forums instead: https://wordpress.org/support/plugin/web-stories/ --> ## Task Description <!-- A clear and concise description of what this task is about. --> As was mentioned multiple times over the course of this project and again this week, it might be beneficial to split up Karma tests across multiple CI jobs in parallel to speed things up and shorten the feedback loop. [`karma-parallel`](https://www.npmjs.com/package/karma-parallel) looks like a promising candidate for that. We might be able to use it in combination with a [test matrix](https://docs.github.com/en/actions/learn-github-actions/workflow-syntax-for-github-actions#jobsjob_idstrategymatrix) to pass a custom `shardIndex`, but not sure if that works.
1.0
Karma: Explore running tests in parallel - <!-- NOTE: For help requests, support questions, or general feedback, please use the WordPress.org forums instead: https://wordpress.org/support/plugin/web-stories/ --> ## Task Description <!-- A clear and concise description of what this task is about. --> As was mentioned multiple times over the course of this project and again this week, it might be beneficial to split up Karma tests across multiple CI jobs in parallel to speed things up and shorten the feedback loop. [`karma-parallel`](https://www.npmjs.com/package/karma-parallel) looks like a promising candidate for that. We might be able to use it in combination with a [test matrix](https://docs.github.com/en/actions/learn-github-actions/workflow-syntax-for-github-actions#jobsjob_idstrategymatrix) to pass a custom `shardIndex`, but not sure if that works.
infrastructure
karma explore running tests in parallel task description as was mentioned multiple times over the course of this project and again this week it might be beneficial to split up karma tests across multiple ci jobs in parallel to speed things up and shorten the feedback loop looks like a promising candidate for that we might be able to use it in combination with a to pass a custom shardindex but not sure if that works
1
72,822
13,925,576,031
IssuesEvent
2020-10-21 17:01:58
vektorprogrammet/vektorprogrammet
https://api.github.com/repos/vektorprogrammet/vektorprogrammet
closed
Forms with unsued imports
Code Quality
- [x] AssignInterviewType - [x] CreateSemesterType - [x] CreateTeamMembershipType - [x] CreateUserType - [x] FeedbackType - [x] ImageGalleryType ~~- [ ] ReceiptType~~ - [x] ScheduleInterviewType - [x] SchoolCapacityType - [x] InterviewNewTimeType Example: ![image](https://user-images.githubusercontent.com/46197518/94649471-08a1da00-02f5-11eb-9ff3-4350bf0a5170.png)
1.0
Forms with unsued imports - - [x] AssignInterviewType - [x] CreateSemesterType - [x] CreateTeamMembershipType - [x] CreateUserType - [x] FeedbackType - [x] ImageGalleryType ~~- [ ] ReceiptType~~ - [x] ScheduleInterviewType - [x] SchoolCapacityType - [x] InterviewNewTimeType Example: ![image](https://user-images.githubusercontent.com/46197518/94649471-08a1da00-02f5-11eb-9ff3-4350bf0a5170.png)
non_infrastructure
forms with unsued imports assigninterviewtype createsemestertype createteammembershiptype createusertype feedbacktype imagegallerytype receipttype scheduleinterviewtype schoolcapacitytype interviewnewtimetype example
0
584
2,776,042,330
IssuesEvent
2015-05-04 19:30:03
dotnet/corefx
https://api.github.com/repos/dotnet/corefx
closed
Remove properties not relevant to code formatting from corefx.vssettings
Infrastructure up for grabs
Looks like we have a few properties that are unrelated to formatting in corefx.vssettings such as: ``` <PropertyValue name="HighlightReferences">0</PropertyValue> <PropertyValue name="ProgressDialogDelaySeconds">2</PropertyValue> ``` We should remove them so that only C# formatting settings are in that file.
1.0
Remove properties not relevant to code formatting from corefx.vssettings - Looks like we have a few properties that are unrelated to formatting in corefx.vssettings such as: ``` <PropertyValue name="HighlightReferences">0</PropertyValue> <PropertyValue name="ProgressDialogDelaySeconds">2</PropertyValue> ``` We should remove them so that only C# formatting settings are in that file.
infrastructure
remove properties not relevant to code formatting from corefx vssettings looks like we have a few properties that are unrelated to formatting in corefx vssettings such as we should remove them so that only c formatting settings are in that file
1
388,650
26,776,239,863
IssuesEvent
2023-01-31 17:20:47
iotaledger/firefly
https://api.github.com/repos/iotaledger/firefly
closed
[Task]: Write Governance documentation
type:documentation context:governance
### Task description Once the implementation is finalized, write documentation on how Governance works. ### Requirements _TBD_ ### Creation checklist - [x] I have assigned this task to the correct people - [X] I have added the most appropriate labels - [X] I have linked the correct milestone and/or project
1.0
[Task]: Write Governance documentation - ### Task description Once the implementation is finalized, write documentation on how Governance works. ### Requirements _TBD_ ### Creation checklist - [x] I have assigned this task to the correct people - [X] I have added the most appropriate labels - [X] I have linked the correct milestone and/or project
non_infrastructure
write governance documentation task description once the implementation is finalized write documentation on how governance works requirements tbd creation checklist i have assigned this task to the correct people i have added the most appropriate labels i have linked the correct milestone and or project
0
54,827
7,926,515,210
IssuesEvent
2018-07-06 02:37:24
jupyter/repo2docker
https://api.github.com/repos/jupyter/repo2docker
closed
Document using commit hashes with --ref
documentation reproducibility
Didn't see this in the docs- can we confirm the status of this capability on r2d? If so we should document it- Thanks @choldgraf for mentioning this
1.0
Document using commit hashes with --ref - Didn't see this in the docs- can we confirm the status of this capability on r2d? If so we should document it- Thanks @choldgraf for mentioning this
non_infrastructure
document using commit hashes with ref didn t see this in the docs can we confirm the status of this capability on if so we should document it thanks choldgraf for mentioning this
0
7,917
7,134,083,228
IssuesEvent
2018-01-22 19:37:34
kaitai-io/kaitai_struct
https://api.github.com/repos/kaitai-io/kaitai_struct
opened
unforking repositories
infrastructure
Some repositories are forks of some external repos. This creates problems when submitting PRs. It would be better if those were unforked. Admin would need to contact GitHub support and ask them to effectuate it. - [ ] https://github.com/kaitai-io/kaitai_struct_csharp_runtime Procedure explained at https://stackoverflow.com/a/44140289/2375119
1.0
unforking repositories - Some repositories are forks of some external repos. This creates problems when submitting PRs. It would be better if those were unforked. Admin would need to contact GitHub support and ask them to effectuate it. - [ ] https://github.com/kaitai-io/kaitai_struct_csharp_runtime Procedure explained at https://stackoverflow.com/a/44140289/2375119
infrastructure
unforking repositories some repositories are forks of some external repos this creates problems when submitting prs it would be better if those were unforked admin would need to contact github support and ask them to effectuate it procedure explained at
1
570,765
17,023,177,071
IssuesEvent
2021-07-03 00:43:25
tomhughes/trac-tickets
https://api.github.com/repos/tomhughes/trac-tickets
closed
OSM key natural violates mysql keywords
Component: admin Priority: minor Resolution: invalid Type: enhancement
**[Submitted to the original trac issue database at 3.13pm, Wednesday, 12th September 2007]** 'natural' is a reserved word for MySQL, so if you import to pgsql using osm2pgsql, then import to mysql, mysql gives errors on the 'natural' column. Perhaps we should change natural to natural_ or something.
1.0
OSM key natural violates mysql keywords - **[Submitted to the original trac issue database at 3.13pm, Wednesday, 12th September 2007]** 'natural' is a reserved word for MySQL, so if you import to pgsql using osm2pgsql, then import to mysql, mysql gives errors on the 'natural' column. Perhaps we should change natural to natural_ or something.
non_infrastructure
osm key natural violates mysql keywords natural is a reserved word for mysql so if you import to pgsql using then import to mysql mysql gives errors on the natural column perhaps we should change natural to natural or something
0
19,073
13,536,131,207
IssuesEvent
2020-09-16 08:36:29
topcoder-platform/qa-fun
https://api.github.com/repos/topcoder-platform/qa-fun
closed
alignment issue in post under “Crowdtesting & QA”
UX/Usability
Steps to Reproduce: 1. Go to https://www.topcoder.com/case-study-types/crowdtesting-qa/ 2. Scroll down 2. Observe the alignment of posts under “Crowdtesting & QA” Expected Result: Under “Crowdtesting & QA” all posts should be aligned properly Actual Result: Posts are not aligned properly in a straight row. Screenshots or screencast: Device/OS/Browser Information: <Detailed device: Lenovo Desktop, Operating System: Windows 10 Enterprise and Browser information: Google Chrome Version 80.0.3987.122 > ![2](https://user-images.githubusercontent.com/56633093/81052337-deccbe80-8ee0-11ea-8ecd-fb396b6998db.png)
True
alignment issue in post under “Crowdtesting & QA” - Steps to Reproduce: 1. Go to https://www.topcoder.com/case-study-types/crowdtesting-qa/ 2. Scroll down 2. Observe the alignment of posts under “Crowdtesting & QA” Expected Result: Under “Crowdtesting & QA” all posts should be aligned properly Actual Result: Posts are not aligned properly in a straight row. Screenshots or screencast: Device/OS/Browser Information: <Detailed device: Lenovo Desktop, Operating System: Windows 10 Enterprise and Browser information: Google Chrome Version 80.0.3987.122 > ![2](https://user-images.githubusercontent.com/56633093/81052337-deccbe80-8ee0-11ea-8ecd-fb396b6998db.png)
non_infrastructure
alignment issue in post under “crowdtesting qa” steps to reproduce go to scroll down observe the alignment of posts under “crowdtesting qa” expected result under “crowdtesting qa” all posts should be aligned properly actual result posts are not aligned properly in a straight row screenshots or screencast device os browser information
0
119,306
10,038,173,119
IssuesEvent
2019-07-18 14:39:10
w3c/webrtc-pc
https://api.github.com/repos/w3c/webrtc-pc
closed
RTCDataChannel.send during 'closing' state
Needs Test PR exists TPAC 2018
Let's look at the following scenario: Peer A and B have an `open` data channel. If peer A closes the channel, peer B's channel will go into the `closing` state until all pending messages of both peers have been sent. If peer B calls the `.send` method, it will throw an exception since the channel is not in the `open` state any more. But peer B has no way of knowing that unless it polls `.readyState`. Do we need to address that with an... (I'm reluctant to say that) event?
1.0
RTCDataChannel.send during 'closing' state - Let's look at the following scenario: Peer A and B have an `open` data channel. If peer A closes the channel, peer B's channel will go into the `closing` state until all pending messages of both peers have been sent. If peer B calls the `.send` method, it will throw an exception since the channel is not in the `open` state any more. But peer B has no way of knowing that unless it polls `.readyState`. Do we need to address that with an... (I'm reluctant to say that) event?
non_infrastructure
rtcdatachannel send during closing state let s look at the following scenario peer a and b have an open data channel if peer a closes the channel peer b s channel will go into the closing state until all pending messages of both peers have been sent if peer b calls the send method it will throw an exception since the channel is not in the open state any more but peer b has no way of knowing that unless it polls readystate do we need to address that with an i m reluctant to say that event
0
34,052
28,132,956,389
IssuesEvent
2023-04-01 03:34:38
AdaCore/learn
https://api.github.com/repos/AdaCore/learn
closed
Examples are incomplete when only reading the PDF versions
website infrastructure
All of the examples in the courses have example files that can be downloaded. E.g. in the [Hello World example in Ada,](https://learn.adacore.com/courses/intro-to-ada/chapters/imperative_language.html) only the source code of greet.adb is shown. However, the example involves the use of the files main.gpr and main.adc. There is no way to know this just from reading the PDF file. Thus, I suggest either including the source code of the additional example files in the PDF just underneath the .adb source code, or making a ZIP archive containing the book along with all of the example files. For example, for the course [Introduction to Ada,](https://learn.adacore.com/courses/intro-to-ada/index.html) you would create a ZIP archive containing the PDF and a subfolder for each of the examples where the subfolder contains the code files of the corresponding example. The subfolders could be prefixed with numbers to ensure that they are sorted in the correct order. For example: introduction_to_ada.zip: - introduction_to_ada.pdf - Examples/ - 01.Imperative_Language.Greet/ - greet.adb - main.adc - main.gpr - 02.Imperative_Language.Greet_2/ - greet.adb - main.adc - main.gpr - 03.Imperative_Language.Check_Positive/ - check_positive.adb - main.adc - main.gpr - etc. The same would be done for all of the other courses offered on [learn.adacore.com.](https://learn.adacore.com/index.html) Aside: thank you very much for creating these resources! Not everyone has the money to spare for Barnes' book, especially if one is a student completing a course in Ada.
1.0
Examples are incomplete when only reading the PDF versions - All of the examples in the courses have example files that can be downloaded. E.g. in the [Hello World example in Ada,](https://learn.adacore.com/courses/intro-to-ada/chapters/imperative_language.html) only the source code of greet.adb is shown. However, the example involves the use of the files main.gpr and main.adc. There is no way to know this just from reading the PDF file. Thus, I suggest either including the source code of the additional example files in the PDF just underneath the .adb source code, or making a ZIP archive containing the book along with all of the example files. For example, for the course [Introduction to Ada,](https://learn.adacore.com/courses/intro-to-ada/index.html) you would create a ZIP archive containing the PDF and a subfolder for each of the examples where the subfolder contains the code files of the corresponding example. The subfolders could be prefixed with numbers to ensure that they are sorted in the correct order. For example: introduction_to_ada.zip: - introduction_to_ada.pdf - Examples/ - 01.Imperative_Language.Greet/ - greet.adb - main.adc - main.gpr - 02.Imperative_Language.Greet_2/ - greet.adb - main.adc - main.gpr - 03.Imperative_Language.Check_Positive/ - check_positive.adb - main.adc - main.gpr - etc. The same would be done for all of the other courses offered on [learn.adacore.com.](https://learn.adacore.com/index.html) Aside: thank you very much for creating these resources! Not everyone has the money to spare for Barnes' book, especially if one is a student completing a course in Ada.
infrastructure
examples are incomplete when only reading the pdf versions all of the examples in the courses have example files that can be downloaded e g in the only the source code of greet adb is shown however the example involves the use of the files main gpr and main adc there is no way to know this just from reading the pdf file thus i suggest either including the source code of the additional example files in the pdf just underneath the adb source code or making a zip archive containing the book along with all of the example files for example for the course you would create a zip archive containing the pdf and a subfolder for each of the examples where the subfolder contains the code files of the corresponding example the subfolders could be prefixed with numbers to ensure that they are sorted in the correct order for example introduction to ada zip introduction to ada pdf examples imperative language greet greet adb main adc main gpr imperative language greet greet adb main adc main gpr imperative language check positive check positive adb main adc main gpr etc the same would be done for all of the other courses offered on aside thank you very much for creating these resources not everyone has the money to spare for barnes book especially if one is a student completing a course in ada
1
13,299
10,195,901,529
IssuesEvent
2019-08-12 19:19:40
sciencehistory/scihist_digicoll
https://api.github.com/repos/sciencehistory/scihist_digicoll
opened
consider bulk creation of derivatives/dzi
infrastructure
When we do our first import into new app production, we'll need to create derivatives and DZI files for everything. This takes a while. For DZI, initial estimate is ~131 hours -- but that's before allowing for further slowdown due to exhausting burst allowance on our EC2. (Not sure current estimate for non-dzi derivatives). Is this a problem? Having to wait that long might be a problem (inconvenient). Exhausting burst credits might be a problem (makes deployment environment behave atypically until burst credits build up again). Might we ever need to do this after initial import? Probably not typically -- we keep backups of our derivatives to avoid it -- but potentially in case of some kind of castrostophic failure, or if we discover existing derivatives had been created improperly. So any techniques to speed it up could be useful in the future. At present derivatives creation routines do not apply any concurrency, they just create one derivative at a time, one after the other. ## Possible ways to speed things up ### Create one temporary EC2 for bulk derivative creation It could potentially be a much higher capacity EC2 (without 'burst', if possible?). It would need the Rails app deployed to it, which should be possible to get capistrano to do, possibly just by giving it a capistrano `:app` role and including it in auto-discover. We would execute derivative creations on that server. This would have some temporary cost associated. This would not require any app code changes. Because of MRI "GIL", one deriv creation process would still only use one core. :( ### Let deriv creation work in separate 'batches' instead of one process for entire run Still without making our deriv creation code use concurrency, we could instead figure out a way to have deriv creation commands create only a portion of derivatives. Either by only creating some types of derivatives, or splitting our entire assets into portions and having a command that only creates derivs for the 1/N xth batch. Multiple deriv creation 'batch' commands could then run on the same server to use multiple cores, or be split to multiple temporary servers. If on same existing server, still 'using all burst' issues. Some temporary cost (if extra servers), some minor app code changes, some confusion in orchestrating the batches. Would have more flexibility on scaling up, not limited by the maximum EC2 server size that exists, as many servers as we want. ### Add thread-based concurrency to deriv-creation logic We could add multi-threading to derivative creation routines. This should speed things up some, despite the MRI "GIL", because while threads are busy downloading/uploading bytes, other threads can do work. Could be run on existing server, or in new server. If existing server, still 'burst all used up' worries. Still only actually uses one core, unless combined with separate processes for separate batches as above. ### Have deriv-creation use the ActiveJob/resque pool The deriv-creation process would enqueue jobs for each Asset, for bg ActiveJob/resque workers to handle. We can now scale simply by scaling jobs servers. Multiple cores on a server could be used, so long as sufficient worker processes are running. This is probably the way to scale horizontally with least "reinventing the wheel". The trick is that the bulk creation will fill up the jobs queue, meaning other app work won't happen until the queue is clear. **Unless** we get different workers on different servers handling different resque queues. * Need to figure out how to do this, and get workers on the 'ordinary' jobs server(s) handling all queues except our special, say, "bulk_batch" queue. And workers on special bulk-batch jobs servers handling only that special bulk_batch queue. * Need to make sure our batch jobs to enqueue all this work enqueues to the special `bulk_batch` queue.
1.0
consider bulk creation of derivatives/dzi - When we do our first import into new app production, we'll need to create derivatives and DZI files for everything. This takes a while. For DZI, initial estimate is ~131 hours -- but that's before allowing for further slowdown due to exhausting burst allowance on our EC2. (Not sure current estimate for non-dzi derivatives). Is this a problem? Having to wait that long might be a problem (inconvenient). Exhausting burst credits might be a problem (makes deployment environment behave atypically until burst credits build up again). Might we ever need to do this after initial import? Probably not typically -- we keep backups of our derivatives to avoid it -- but potentially in case of some kind of castrostophic failure, or if we discover existing derivatives had been created improperly. So any techniques to speed it up could be useful in the future. At present derivatives creation routines do not apply any concurrency, they just create one derivative at a time, one after the other. ## Possible ways to speed things up ### Create one temporary EC2 for bulk derivative creation It could potentially be a much higher capacity EC2 (without 'burst', if possible?). It would need the Rails app deployed to it, which should be possible to get capistrano to do, possibly just by giving it a capistrano `:app` role and including it in auto-discover. We would execute derivative creations on that server. This would have some temporary cost associated. This would not require any app code changes. Because of MRI "GIL", one deriv creation process would still only use one core. :( ### Let deriv creation work in separate 'batches' instead of one process for entire run Still without making our deriv creation code use concurrency, we could instead figure out a way to have deriv creation commands create only a portion of derivatives. Either by only creating some types of derivatives, or splitting our entire assets into portions and having a command that only creates derivs for the 1/N xth batch. Multiple deriv creation 'batch' commands could then run on the same server to use multiple cores, or be split to multiple temporary servers. If on same existing server, still 'using all burst' issues. Some temporary cost (if extra servers), some minor app code changes, some confusion in orchestrating the batches. Would have more flexibility on scaling up, not limited by the maximum EC2 server size that exists, as many servers as we want. ### Add thread-based concurrency to deriv-creation logic We could add multi-threading to derivative creation routines. This should speed things up some, despite the MRI "GIL", because while threads are busy downloading/uploading bytes, other threads can do work. Could be run on existing server, or in new server. If existing server, still 'burst all used up' worries. Still only actually uses one core, unless combined with separate processes for separate batches as above. ### Have deriv-creation use the ActiveJob/resque pool The deriv-creation process would enqueue jobs for each Asset, for bg ActiveJob/resque workers to handle. We can now scale simply by scaling jobs servers. Multiple cores on a server could be used, so long as sufficient worker processes are running. This is probably the way to scale horizontally with least "reinventing the wheel". The trick is that the bulk creation will fill up the jobs queue, meaning other app work won't happen until the queue is clear. **Unless** we get different workers on different servers handling different resque queues. * Need to figure out how to do this, and get workers on the 'ordinary' jobs server(s) handling all queues except our special, say, "bulk_batch" queue. And workers on special bulk-batch jobs servers handling only that special bulk_batch queue. * Need to make sure our batch jobs to enqueue all this work enqueues to the special `bulk_batch` queue.
infrastructure
consider bulk creation of derivatives dzi when we do our first import into new app production we ll need to create derivatives and dzi files for everything this takes a while for dzi initial estimate is hours but that s before allowing for further slowdown due to exhausting burst allowance on our not sure current estimate for non dzi derivatives is this a problem having to wait that long might be a problem inconvenient exhausting burst credits might be a problem makes deployment environment behave atypically until burst credits build up again might we ever need to do this after initial import probably not typically we keep backups of our derivatives to avoid it but potentially in case of some kind of castrostophic failure or if we discover existing derivatives had been created improperly so any techniques to speed it up could be useful in the future at present derivatives creation routines do not apply any concurrency they just create one derivative at a time one after the other possible ways to speed things up create one temporary for bulk derivative creation it could potentially be a much higher capacity without burst if possible it would need the rails app deployed to it which should be possible to get capistrano to do possibly just by giving it a capistrano app role and including it in auto discover we would execute derivative creations on that server this would have some temporary cost associated this would not require any app code changes because of mri gil one deriv creation process would still only use one core let deriv creation work in separate batches instead of one process for entire run still without making our deriv creation code use concurrency we could instead figure out a way to have deriv creation commands create only a portion of derivatives either by only creating some types of derivatives or splitting our entire assets into portions and having a command that only creates derivs for the n xth batch multiple deriv creation batch commands could then run on the same server to use multiple cores or be split to multiple temporary servers if on same existing server still using all burst issues some temporary cost if extra servers some minor app code changes some confusion in orchestrating the batches would have more flexibility on scaling up not limited by the maximum server size that exists as many servers as we want add thread based concurrency to deriv creation logic we could add multi threading to derivative creation routines this should speed things up some despite the mri gil because while threads are busy downloading uploading bytes other threads can do work could be run on existing server or in new server if existing server still burst all used up worries still only actually uses one core unless combined with separate processes for separate batches as above have deriv creation use the activejob resque pool the deriv creation process would enqueue jobs for each asset for bg activejob resque workers to handle we can now scale simply by scaling jobs servers multiple cores on a server could be used so long as sufficient worker processes are running this is probably the way to scale horizontally with least reinventing the wheel the trick is that the bulk creation will fill up the jobs queue meaning other app work won t happen until the queue is clear unless we get different workers on different servers handling different resque queues need to figure out how to do this and get workers on the ordinary jobs server s handling all queues except our special say bulk batch queue and workers on special bulk batch jobs servers handling only that special bulk batch queue need to make sure our batch jobs to enqueue all this work enqueues to the special bulk batch queue
1
19,382
3,442,224,639
IssuesEvent
2015-12-14 21:42:43
westerndevs/western-devs-website
https://api.github.com/repos/westerndevs/western-devs-website
closed
Updates to home page
redesign
Ideas: - Include a blurb on what Western Devs is all about - Include a random selection of "What We've Done" - Include a random selection of "Where We'll Be" - Include the most recent podcast - Include a random bio of one of the devs - Twitter stream from the WD account
1.0
Updates to home page - Ideas: - Include a blurb on what Western Devs is all about - Include a random selection of "What We've Done" - Include a random selection of "Where We'll Be" - Include the most recent podcast - Include a random bio of one of the devs - Twitter stream from the WD account
non_infrastructure
updates to home page ideas include a blurb on what western devs is all about include a random selection of what we ve done include a random selection of where we ll be include the most recent podcast include a random bio of one of the devs twitter stream from the wd account
0
15,664
10,332,666,731
IssuesEvent
2019-09-03 01:31:01
vuetifyjs/vuetify
https://api.github.com/repos/vuetifyjs/vuetify
closed
[Bug Report] Wrong Typescript definition for theme
Service: Theme T: bug typescript
### Environment **Vuetify Version:** 2.0.0 **Last working version:** 1.5.16 **Vue Version:** 2.6.10 **Browsers:** Chrome 75.0.3770.142 **OS:** Linux x86_64 ### Steps to reproduce Open main.ts in the codesandbox => tslint error ### Expected Behavior No linting error ### Actual Behavior `Type '{ base: string; darken1: string; }' is missing the following properties from type 'VuetifyParsedThemeItem': lighten5, lighten4, lighten3, lighten2, and 4 more. ts(2345)` ### Reproduction Link <a href="https://codesandbox.io/s/vue-template-hok88" target="_blank">https://codesandbox.io/s/vue-template-hok88</a> ### Other comments In the `VuetifyParsedThemeItem` definition all the lighten and darken properties are required. It means that the following example from the *official documentation* does not work : ``` // src/plugins/vuetify/theme.js import colors from 'vuetify/lib/util/colors' export default { primary: { base: colors.purple.base, darken1: colors.purple.darken2, }, secondary: colors.indigo, // All keys will generate theme styles, // Here we add a custom `tertiary` color tertiary: colors.pink.base, } ``` Shouldn't the lighten and darken variants be optional so you can set only the ones you need ? Like so : ``` export interface VuetifyParsedThemeItem { [name: string]: string base: string lighten5?: string lighten4?: string lighten3?: string lighten2?: string lighten1?: string darken1?: string darken2?: string darken3?: string darken4?: string } ``` <!-- generated by vuetify-issue-helper. DO NOT REMOVE -->
1.0
[Bug Report] Wrong Typescript definition for theme - ### Environment **Vuetify Version:** 2.0.0 **Last working version:** 1.5.16 **Vue Version:** 2.6.10 **Browsers:** Chrome 75.0.3770.142 **OS:** Linux x86_64 ### Steps to reproduce Open main.ts in the codesandbox => tslint error ### Expected Behavior No linting error ### Actual Behavior `Type '{ base: string; darken1: string; }' is missing the following properties from type 'VuetifyParsedThemeItem': lighten5, lighten4, lighten3, lighten2, and 4 more. ts(2345)` ### Reproduction Link <a href="https://codesandbox.io/s/vue-template-hok88" target="_blank">https://codesandbox.io/s/vue-template-hok88</a> ### Other comments In the `VuetifyParsedThemeItem` definition all the lighten and darken properties are required. It means that the following example from the *official documentation* does not work : ``` // src/plugins/vuetify/theme.js import colors from 'vuetify/lib/util/colors' export default { primary: { base: colors.purple.base, darken1: colors.purple.darken2, }, secondary: colors.indigo, // All keys will generate theme styles, // Here we add a custom `tertiary` color tertiary: colors.pink.base, } ``` Shouldn't the lighten and darken variants be optional so you can set only the ones you need ? Like so : ``` export interface VuetifyParsedThemeItem { [name: string]: string base: string lighten5?: string lighten4?: string lighten3?: string lighten2?: string lighten1?: string darken1?: string darken2?: string darken3?: string darken4?: string } ``` <!-- generated by vuetify-issue-helper. DO NOT REMOVE -->
non_infrastructure
wrong typescript definition for theme environment vuetify version last working version vue version browsers chrome os linux steps to reproduce open main ts in the codesandbox tslint error expected behavior no linting error actual behavior type base string string is missing the following properties from type vuetifyparsedthemeitem and more ts reproduction link other comments in the vuetifyparsedthemeitem definition all the lighten and darken properties are required it means that the following example from the official documentation does not work src plugins vuetify theme js import colors from vuetify lib util colors export default primary base colors purple base colors purple secondary colors indigo all keys will generate theme styles here we add a custom tertiary color tertiary colors pink base shouldn t the lighten and darken variants be optional so you can set only the ones you need like so export interface vuetifyparsedthemeitem string base string string string string string string string string string string
0
19,705
6,758,115,430
IssuesEvent
2017-10-24 13:16:18
elastic/elasticsearch
https://api.github.com/repos/elastic/elasticsearch
reopened
Build is failing with Gradle 4.2
build
Not sure what causes it but when I run: ```sh gradle :plugins:repository-azure:check ``` I'm getting (tested on 5.6, 6.0 and 6.x branches): ``` * What went wrong: Execution failed for task ':plugins:repository-azure:integTestCluster#installRepositoryAzurePlugin'. > A problem occurred starting process 'command '/Users/dpilato/Documents/Elasticsearch/dev/elasticsearch/es-5.x/elasticsearch/plugins/repository-azure/build/cluster/integTestCluster node0/elasticsearch-5.6.3-SNAPSHOT/bin/elasticsearch-plugin'' ``` Note that on 6.0 and 6.x the message is a bit different as it fails when running `bin/elasticsearch-keystore`. I checked manually the directory and I'm able to run `bin/elasticsearch-plugin` or `bin/elasticsearch-keystore` manually. ```sh $ gradle -version ------------------------------------------------------------ Gradle 4.2 ------------------------------------------------------------ Build time: 2017-09-20 14:48:23 UTC Revision: 5ba503cc17748671c83ce35d7da1cffd6e24dfbd Groovy: 2.4.11 Ant: Apache Ant(TM) version 1.9.6 compiled on June 29 2015 JVM: 1.8.0_144 (Oracle Corporation 25.144-b01) OS: Mac OS X 10.12.6 x86_64 ``` Running with `gradlew` works: ```sh ./gradlew :plugins:repository-azure:check ``` gradlew reports a 3.3 version of Gradle.
1.0
Build is failing with Gradle 4.2 - Not sure what causes it but when I run: ```sh gradle :plugins:repository-azure:check ``` I'm getting (tested on 5.6, 6.0 and 6.x branches): ``` * What went wrong: Execution failed for task ':plugins:repository-azure:integTestCluster#installRepositoryAzurePlugin'. > A problem occurred starting process 'command '/Users/dpilato/Documents/Elasticsearch/dev/elasticsearch/es-5.x/elasticsearch/plugins/repository-azure/build/cluster/integTestCluster node0/elasticsearch-5.6.3-SNAPSHOT/bin/elasticsearch-plugin'' ``` Note that on 6.0 and 6.x the message is a bit different as it fails when running `bin/elasticsearch-keystore`. I checked manually the directory and I'm able to run `bin/elasticsearch-plugin` or `bin/elasticsearch-keystore` manually. ```sh $ gradle -version ------------------------------------------------------------ Gradle 4.2 ------------------------------------------------------------ Build time: 2017-09-20 14:48:23 UTC Revision: 5ba503cc17748671c83ce35d7da1cffd6e24dfbd Groovy: 2.4.11 Ant: Apache Ant(TM) version 1.9.6 compiled on June 29 2015 JVM: 1.8.0_144 (Oracle Corporation 25.144-b01) OS: Mac OS X 10.12.6 x86_64 ``` Running with `gradlew` works: ```sh ./gradlew :plugins:repository-azure:check ``` gradlew reports a 3.3 version of Gradle.
non_infrastructure
build is failing with gradle not sure what causes it but when i run sh gradle plugins repository azure check i m getting tested on and x branches what went wrong execution failed for task plugins repository azure integtestcluster installrepositoryazureplugin a problem occurred starting process command users dpilato documents elasticsearch dev elasticsearch es x elasticsearch plugins repository azure build cluster integtestcluster elasticsearch snapshot bin elasticsearch plugin note that on and x the message is a bit different as it fails when running bin elasticsearch keystore i checked manually the directory and i m able to run bin elasticsearch plugin or bin elasticsearch keystore manually sh gradle version gradle build time utc revision groovy ant apache ant tm version compiled on june jvm oracle corporation os mac os x running with gradlew works sh gradlew plugins repository azure check gradlew reports a version of gradle
0
15,910
11,760,648,555
IssuesEvent
2020-03-13 20:01:05
bradyrx/climpred
https://api.github.com/repos/bradyrx/climpred
reopened
parallelize bootstrap
infrastructure performance
#### Code Sample https://stackoverflow.com/questions/56281148/parallelized-bootstrapping-with-replacement-with-xarray-dask #### Problem description I want to perform N=1000 bootstrapping with replacement on gridded data. One computation takes about 0.5s. I have access to a supercomputer exclusive node with 48 cores. Because the resampling are independent of each other, I naively hope to distribute the workload on all or at least many cores and get a performance increase by .8 * ncores. But I dont get it.
1.0
parallelize bootstrap - #### Code Sample https://stackoverflow.com/questions/56281148/parallelized-bootstrapping-with-replacement-with-xarray-dask #### Problem description I want to perform N=1000 bootstrapping with replacement on gridded data. One computation takes about 0.5s. I have access to a supercomputer exclusive node with 48 cores. Because the resampling are independent of each other, I naively hope to distribute the workload on all or at least many cores and get a performance increase by .8 * ncores. But I dont get it.
infrastructure
parallelize bootstrap code sample problem description i want to perform n bootstrapping with replacement on gridded data one computation takes about i have access to a supercomputer exclusive node with cores because the resampling are independent of each other i naively hope to distribute the workload on all or at least many cores and get a performance increase by ncores but i dont get it
1
211,287
16,437,060,137
IssuesEvent
2021-05-20 10:24:47
docker-mailserver/docker-mailserver
https://api.github.com/repos/docker-mailserver/docker-mailserver
closed
[FR] Documentation PR preview deploys
area/ci area/documentation kind/feature request kind/improvement priority/medium
# Feature Request There was interest in having PRs for documentation updates to have CI add a comment with link to preview the changes visually. This has been discussed during the Github Wiki to MkDocs (via Github Pages) migration work. A free service can provide this functionality, and be integrated via Github Actions for CI. ## Context I have offered to contribute this, however as this project now exists as an organization, **it requires a bit more effort on behalf of organization members to make arrangements for being granted an open-source organization team plan (free if approved)** on either of the two popular services: - Netlify is more open about their support for this [here](https://www.netlify.com/legal/open-source-policy), with requirements and actions required to get approval. - Vercel is my original choice, they briefly mention some form of support for open-source projects beyond the personal hobby account [near the bottom of their pricing page](https://vercel.com/pricing). I've done most of my research into supporting Vercel, but from what I can tell it should be a similar process with Netlify: - Connecting the organization/team and project to the service. - A configuration file to disable default default branch and PR behaviour (lacks context of when it should be triggered) - A third-party Github Action that only triggers under the PR event for PRs that actually touch the docs. ### Is your Feature Request related to a Problem? It would assist with PR reviews related to documentation contributions. ### Describe the Solution you'd like Leveraging the free tier support of Vercel or Netlify services with the preview deploy links. The organization has already expressed interest in keeping deployment of docs tied to Github Pages. That does have some slight disadvantages compared to these services feature wise (eg rewrites, redirects, 404 handling, cache control, etc), but with the above plan of action the service can specifically only deploy previews AFAIK. ### Are you going to implement it? Yes, because I know the probability of someone else doing it is low and I can learn from it. ### What are you going to contribute?? Everything required to enable the feature. ## Additional context ~~I cannot proceed further with either service until the organization~~ (**EDIT:** I've been made a member, I'll take care of it) decides on a service to use and has taken action to be granted approval for the open-source free team plan. ### Alternatives you've considered I'm not sure of what other alternatives we have, other than more DIY, but this would raise the difficulty and add more maintenance burden due to low bus factor than using one of these popular services would. ### Who will that Feature be useful to? Maintainers and/or reviewers of pull requests for documentation. ### What have you done already? Investigated required tasks and effort to contribute the feature.
1.0
[FR] Documentation PR preview deploys - # Feature Request There was interest in having PRs for documentation updates to have CI add a comment with link to preview the changes visually. This has been discussed during the Github Wiki to MkDocs (via Github Pages) migration work. A free service can provide this functionality, and be integrated via Github Actions for CI. ## Context I have offered to contribute this, however as this project now exists as an organization, **it requires a bit more effort on behalf of organization members to make arrangements for being granted an open-source organization team plan (free if approved)** on either of the two popular services: - Netlify is more open about their support for this [here](https://www.netlify.com/legal/open-source-policy), with requirements and actions required to get approval. - Vercel is my original choice, they briefly mention some form of support for open-source projects beyond the personal hobby account [near the bottom of their pricing page](https://vercel.com/pricing). I've done most of my research into supporting Vercel, but from what I can tell it should be a similar process with Netlify: - Connecting the organization/team and project to the service. - A configuration file to disable default default branch and PR behaviour (lacks context of when it should be triggered) - A third-party Github Action that only triggers under the PR event for PRs that actually touch the docs. ### Is your Feature Request related to a Problem? It would assist with PR reviews related to documentation contributions. ### Describe the Solution you'd like Leveraging the free tier support of Vercel or Netlify services with the preview deploy links. The organization has already expressed interest in keeping deployment of docs tied to Github Pages. That does have some slight disadvantages compared to these services feature wise (eg rewrites, redirects, 404 handling, cache control, etc), but with the above plan of action the service can specifically only deploy previews AFAIK. ### Are you going to implement it? Yes, because I know the probability of someone else doing it is low and I can learn from it. ### What are you going to contribute?? Everything required to enable the feature. ## Additional context ~~I cannot proceed further with either service until the organization~~ (**EDIT:** I've been made a member, I'll take care of it) decides on a service to use and has taken action to be granted approval for the open-source free team plan. ### Alternatives you've considered I'm not sure of what other alternatives we have, other than more DIY, but this would raise the difficulty and add more maintenance burden due to low bus factor than using one of these popular services would. ### Who will that Feature be useful to? Maintainers and/or reviewers of pull requests for documentation. ### What have you done already? Investigated required tasks and effort to contribute the feature.
non_infrastructure
documentation pr preview deploys feature request there was interest in having prs for documentation updates to have ci add a comment with link to preview the changes visually this has been discussed during the github wiki to mkdocs via github pages migration work a free service can provide this functionality and be integrated via github actions for ci context i have offered to contribute this however as this project now exists as an organization it requires a bit more effort on behalf of organization members to make arrangements for being granted an open source organization team plan free if approved on either of the two popular services netlify is more open about their support for this with requirements and actions required to get approval vercel is my original choice they briefly mention some form of support for open source projects beyond the personal hobby account i ve done most of my research into supporting vercel but from what i can tell it should be a similar process with netlify connecting the organization team and project to the service a configuration file to disable default default branch and pr behaviour lacks context of when it should be triggered a third party github action that only triggers under the pr event for prs that actually touch the docs is your feature request related to a problem it would assist with pr reviews related to documentation contributions describe the solution you d like leveraging the free tier support of vercel or netlify services with the preview deploy links the organization has already expressed interest in keeping deployment of docs tied to github pages that does have some slight disadvantages compared to these services feature wise eg rewrites redirects handling cache control etc but with the above plan of action the service can specifically only deploy previews afaik are you going to implement it yes because i know the probability of someone else doing it is low and i can learn from it what are you going to contribute everything required to enable the feature additional context i cannot proceed further with either service until the organization edit i ve been made a member i ll take care of it decides on a service to use and has taken action to be granted approval for the open source free team plan alternatives you ve considered i m not sure of what other alternatives we have other than more diy but this would raise the difficulty and add more maintenance burden due to low bus factor than using one of these popular services would who will that feature be useful to maintainers and or reviewers of pull requests for documentation what have you done already investigated required tasks and effort to contribute the feature
0
37,127
9,962,884,617
IssuesEvent
2019-07-07 18:22:08
raphw/byte-buddy
https://api.github.com/repos/raphw/byte-buddy
closed
Publish Gradle plugin to official repository
build
The Gradle plugin should be published in the official repository upon release: See: https://discuss.gradle.org/t/upload-artifact-to-plugin-portal-without-plugin/19344/5
1.0
Publish Gradle plugin to official repository - The Gradle plugin should be published in the official repository upon release: See: https://discuss.gradle.org/t/upload-artifact-to-plugin-portal-without-plugin/19344/5
non_infrastructure
publish gradle plugin to official repository the gradle plugin should be published in the official repository upon release see
0
26,843
20,767,014,023
IssuesEvent
2022-03-15 21:49:02
dotnet/runtime
https://api.github.com/repos/dotnet/runtime
closed
[Linux/arm64] System.Net.NameResolution.Tests randomly fail
arch-arm64 os-linux test-bug area-Infrastructure-coreclr test-corefx
These four corefx tests are randomly failing on Linux/arm64 (with or without JitStress or JitStressRegs): * System.Net.NameResolution.Tests.GetHostEntryTest.Dns_GetHostEntry_HostString_Ok(hostName: \"\") * System.Net.NameResolution.Tests.GetHostEntryTest.Dns_GetHostEntryAsync_HostString_Ok(hostName: \"\") * System.Net.NameResolution.Tests.GetHostByNameTest.DnsObsoleteBeginEndGetHostByName_EmptyString_ReturnsHostName * System.Net.NameResolution.Tests.GetHostByNameTest.DnsObsoleteGetHostByName_EmptyString_ReturnsHostName I believe the root cause was always **System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable** ``` MESSAGE: System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable +++++++++++++++++++ STACK TRACE: at System.Net.Dns.InternalGetHostByName(String hostName) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 65 at System.Net.Dns.ResolveCallback(Object context) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 208 --- End of stack trace from previous location where exception was thrown --- at System.Net.Dns.HostResolutionEndHelper(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 358 at System.Net.Dns.EndGetHostByName(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 383 at System.Net.NameResolution.Tests.GetHostByNameTest.DnsObsoleteBeginEndGetHostByName_EmptyString_ReturnsHostName() in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/tests/FunctionalTests/GetHostByNameTest.cs:line 117 ``` ``` Stacktrace MESSAGE: System.AggregateException : One or more errors occurred. (One or more errors occurred. (Resource temporarily unavailable)) (One or more errors occurred. (Resource temporarily unavailable))\n---- System.AggregateException : One or more errors occurred. (Resource temporarily unavailable)\n-------- System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable\n---- System.AggregateException : One or more errors occurred. (Resource temporarily unavailable)\n-------- System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable +++++++++++++++++++ STACK TRACE: at System.Threading.Tasks.TaskTimeoutExtensions.WhenAllOrAnyFailed(Task[] tasks) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/Common/tests/System/Threading/Tasks/TaskTimeoutExtensions.cs:line 103 at System.Threading.Tasks.TaskTimeoutExtensions.WhenAllOrAnyFailed(Task[] tasks, Int32 millisecondsTimeout) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/Common/tests/System/Threading/Tasks/TaskTimeoutExtensions.cs:line 65 at System.Net.NameResolution.Tests.GetHostEntryTest.TestGetHostEntryAsync(Func`1 getHostEntryFunc) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/tests/FunctionalTests/GetHostEntryTest.cs:line 41 --- End of stack trace from previous location where exception was thrown --- ----- Inner Stack Trace dotnet/coreclr#1 (System.AggregateException) ----- ----- Inner Stack Trace ----- at System.Net.Dns.InternalGetHostByName(String hostName) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 65 at System.Net.Dns.ResolveCallback(Object context) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 208 --- End of stack trace from previous location where exception was thrown --- at System.Net.Dns.HostResolutionEndHelper(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 358 at System.Net.Dns.EndGetHostEntry(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 500 at System.Threading.Tasks.TaskFactory`1.FromAsyncCoreLogic(IAsyncResult iar, Func`2 endFunction, Action`1 endAction, Task`1 promise, Boolean requiresSynchronization) --- End of stack trace from previous location where exception was thrown --- at System.Threading.Tasks.TaskTimeoutExtensions.WhenAllOrAnyFailed(Task[] tasks) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/Common/tests/System/Threading/Tasks/TaskTimeoutExtensions.cs:line 77 ----- Inner Stack Trace dotnet/coreclr#2 (System.AggregateException) ----- ----- Inner Stack Trace ----- at System.Net.Dns.InternalGetHostByName(String hostName) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 65 at System.Net.Dns.ResolveCallback(Object context) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 208 --- End of stack trace from previous location where exception was thrown --- at System.Net.Dns.HostResolutionEndHelper(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 358 at System.Net.Dns.EndGetHostEntry(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 500 at System.Threading.Tasks.TaskFactory`1.FromAsyncCoreLogic(IAsyncResult iar, Func`2 endFunction, Action`1 endAction, Task`1 promise, Boolean requiresSynchronization) ``` https://ci.dot.net/job/dotnet_coreclr/job/master/job/jitstress/job/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_tst_prtest/8/ https://ci.dot.net/job/dotnet_coreclr/job/master/job/jitstress/job/arm64_cross_checked_ubuntu16.04_corefx_jitstress2_tst_prtest/9/ https://github.com/dotnet/corefx/issues/24355 could be a related issue
1.0
[Linux/arm64] System.Net.NameResolution.Tests randomly fail - These four corefx tests are randomly failing on Linux/arm64 (with or without JitStress or JitStressRegs): * System.Net.NameResolution.Tests.GetHostEntryTest.Dns_GetHostEntry_HostString_Ok(hostName: \"\") * System.Net.NameResolution.Tests.GetHostEntryTest.Dns_GetHostEntryAsync_HostString_Ok(hostName: \"\") * System.Net.NameResolution.Tests.GetHostByNameTest.DnsObsoleteBeginEndGetHostByName_EmptyString_ReturnsHostName * System.Net.NameResolution.Tests.GetHostByNameTest.DnsObsoleteGetHostByName_EmptyString_ReturnsHostName I believe the root cause was always **System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable** ``` MESSAGE: System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable +++++++++++++++++++ STACK TRACE: at System.Net.Dns.InternalGetHostByName(String hostName) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 65 at System.Net.Dns.ResolveCallback(Object context) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 208 --- End of stack trace from previous location where exception was thrown --- at System.Net.Dns.HostResolutionEndHelper(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 358 at System.Net.Dns.EndGetHostByName(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 383 at System.Net.NameResolution.Tests.GetHostByNameTest.DnsObsoleteBeginEndGetHostByName_EmptyString_ReturnsHostName() in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/tests/FunctionalTests/GetHostByNameTest.cs:line 117 ``` ``` Stacktrace MESSAGE: System.AggregateException : One or more errors occurred. (One or more errors occurred. (Resource temporarily unavailable)) (One or more errors occurred. (Resource temporarily unavailable))\n---- System.AggregateException : One or more errors occurred. (Resource temporarily unavailable)\n-------- System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable\n---- System.AggregateException : One or more errors occurred. (Resource temporarily unavailable)\n-------- System.Net.Internals.SocketExceptionFactory+ExtendedSocketException : Resource temporarily unavailable +++++++++++++++++++ STACK TRACE: at System.Threading.Tasks.TaskTimeoutExtensions.WhenAllOrAnyFailed(Task[] tasks) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/Common/tests/System/Threading/Tasks/TaskTimeoutExtensions.cs:line 103 at System.Threading.Tasks.TaskTimeoutExtensions.WhenAllOrAnyFailed(Task[] tasks, Int32 millisecondsTimeout) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/Common/tests/System/Threading/Tasks/TaskTimeoutExtensions.cs:line 65 at System.Net.NameResolution.Tests.GetHostEntryTest.TestGetHostEntryAsync(Func`1 getHostEntryFunc) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/tests/FunctionalTests/GetHostEntryTest.cs:line 41 --- End of stack trace from previous location where exception was thrown --- ----- Inner Stack Trace dotnet/coreclr#1 (System.AggregateException) ----- ----- Inner Stack Trace ----- at System.Net.Dns.InternalGetHostByName(String hostName) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 65 at System.Net.Dns.ResolveCallback(Object context) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 208 --- End of stack trace from previous location where exception was thrown --- at System.Net.Dns.HostResolutionEndHelper(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 358 at System.Net.Dns.EndGetHostEntry(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 500 at System.Threading.Tasks.TaskFactory`1.FromAsyncCoreLogic(IAsyncResult iar, Func`2 endFunction, Action`1 endAction, Task`1 promise, Boolean requiresSynchronization) --- End of stack trace from previous location where exception was thrown --- at System.Threading.Tasks.TaskTimeoutExtensions.WhenAllOrAnyFailed(Task[] tasks) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/Common/tests/System/Threading/Tasks/TaskTimeoutExtensions.cs:line 77 ----- Inner Stack Trace dotnet/coreclr#2 (System.AggregateException) ----- ----- Inner Stack Trace ----- at System.Net.Dns.InternalGetHostByName(String hostName) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 65 at System.Net.Dns.ResolveCallback(Object context) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 208 --- End of stack trace from previous location where exception was thrown --- at System.Net.Dns.HostResolutionEndHelper(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 358 at System.Net.Dns.EndGetHostEntry(IAsyncResult asyncResult) in /mnt/j/workspace/dotnet_coreclr/master/jitstress/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_prtest/_/fx/src/System.Net.NameResolution/src/System/Net/DNS.cs:line 500 at System.Threading.Tasks.TaskFactory`1.FromAsyncCoreLogic(IAsyncResult iar, Func`2 endFunction, Action`1 endAction, Task`1 promise, Boolean requiresSynchronization) ``` https://ci.dot.net/job/dotnet_coreclr/job/master/job/jitstress/job/arm64_cross_checked_ubuntu16.04_corefx_jitstressregs0x10_tst_prtest/8/ https://ci.dot.net/job/dotnet_coreclr/job/master/job/jitstress/job/arm64_cross_checked_ubuntu16.04_corefx_jitstress2_tst_prtest/9/ https://github.com/dotnet/corefx/issues/24355 could be a related issue
infrastructure
system net nameresolution tests randomly fail these four corefx tests are randomly failing on linux with or without jitstress or jitstressregs system net nameresolution tests gethostentrytest dns gethostentry hoststring ok hostname system net nameresolution tests gethostentrytest dns gethostentryasync hoststring ok hostname system net nameresolution tests gethostbynametest dnsobsoletebeginendgethostbyname emptystring returnshostname system net nameresolution tests gethostbynametest dnsobsoletegethostbyname emptystring returnshostname i believe the root cause was always system net internals socketexceptionfactory extendedsocketexception resource temporarily unavailable message system net internals socketexceptionfactory extendedsocketexception resource temporarily unavailable stack trace at system net dns internalgethostbyname string hostname in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net dns resolvecallback object context in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line end of stack trace from previous location where exception was thrown at system net dns hostresolutionendhelper iasyncresult asyncresult in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net dns endgethostbyname iasyncresult asyncresult in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net nameresolution tests gethostbynametest dnsobsoletebeginendgethostbyname emptystring returnshostname in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution tests functionaltests gethostbynametest cs line stacktrace message system aggregateexception one or more errors occurred one or more errors occurred resource temporarily unavailable one or more errors occurred resource temporarily unavailable n system aggregateexception one or more errors occurred resource temporarily unavailable n system net internals socketexceptionfactory extendedsocketexception resource temporarily unavailable n system aggregateexception one or more errors occurred resource temporarily unavailable n system net internals socketexceptionfactory extendedsocketexception resource temporarily unavailable stack trace at system threading tasks tasktimeoutextensions whenalloranyfailed task tasks in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src common tests system threading tasks tasktimeoutextensions cs line at system threading tasks tasktimeoutextensions whenalloranyfailed task tasks millisecondstimeout in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src common tests system threading tasks tasktimeoutextensions cs line at system net nameresolution tests gethostentrytest testgethostentryasync func gethostentryfunc in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution tests functionaltests gethostentrytest cs line end of stack trace from previous location where exception was thrown inner stack trace dotnet coreclr system aggregateexception inner stack trace at system net dns internalgethostbyname string hostname in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net dns resolvecallback object context in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line end of stack trace from previous location where exception was thrown at system net dns hostresolutionendhelper iasyncresult asyncresult in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net dns endgethostentry iasyncresult asyncresult in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system threading tasks taskfactory fromasynccorelogic iasyncresult iar func endfunction action endaction task promise boolean requiressynchronization end of stack trace from previous location where exception was thrown at system threading tasks tasktimeoutextensions whenalloranyfailed task tasks in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src common tests system threading tasks tasktimeoutextensions cs line inner stack trace dotnet coreclr system aggregateexception inner stack trace at system net dns internalgethostbyname string hostname in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net dns resolvecallback object context in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line end of stack trace from previous location where exception was thrown at system net dns hostresolutionendhelper iasyncresult asyncresult in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system net dns endgethostentry iasyncresult asyncresult in mnt j workspace dotnet coreclr master jitstress cross checked corefx prtest fx src system net nameresolution src system net dns cs line at system threading tasks taskfactory fromasynccorelogic iasyncresult iar func endfunction action endaction task promise boolean requiressynchronization could be a related issue
1
23,275
16,018,131,410
IssuesEvent
2021-04-20 18:43:27
cu-mkp/m-k-manuscript-data
https://api.github.com/repos/cu-mkp/m-k-manuscript-data
closed
2021-03-30 + 2021-04-06 tasks
deployment infrastructure
carrying over from #1971: - [x] review Performant re-redesign (with Caroline) - [x] update from Greg? - [x] Follow-up to EP sandbox additions - [ ] cu-mkp/manuscript-object#76 (set goals, etc) - [x] #1964: areas of work (spring 2021 onward) - [x] see updates commented to issue - [x] brainstorm about sandbox things (https://github.com/cu-mkp/manuscript-object/issues/1) and https://github.com/cu-mkp/sandbox/issues
1.0
2021-03-30 + 2021-04-06 tasks - carrying over from #1971: - [x] review Performant re-redesign (with Caroline) - [x] update from Greg? - [x] Follow-up to EP sandbox additions - [ ] cu-mkp/manuscript-object#76 (set goals, etc) - [x] #1964: areas of work (spring 2021 onward) - [x] see updates commented to issue - [x] brainstorm about sandbox things (https://github.com/cu-mkp/manuscript-object/issues/1) and https://github.com/cu-mkp/sandbox/issues
infrastructure
tasks carrying over from review performant re redesign with caroline update from greg follow up to ep sandbox additions cu mkp manuscript object set goals etc areas of work spring onward see updates commented to issue brainstorm about sandbox things and
1
12,148
3,587,110,962
IssuesEvent
2016-01-30 03:16:25
hoch/WAAX
https://api.github.com/repos/hoch/WAAX
closed
Generate plug-ins documentation with JSDoc.
Documentation
Plug-ins JS files have JSDoc documentation inside, but never have been used.
1.0
Generate plug-ins documentation with JSDoc. - Plug-ins JS files have JSDoc documentation inside, but never have been used.
non_infrastructure
generate plug ins documentation with jsdoc plug ins js files have jsdoc documentation inside but never have been used
0
67,262
20,961,596,680
IssuesEvent
2022-03-27 21:46:24
abedmaatalla/imsdroid
https://api.github.com/repos/abedmaatalla/imsdroid
closed
MESSAGE is not received by the Application Server
Priority-Medium Type-Defect auto-migrated
``` a) Before posting your issue you MUST answer to the questions otherwise it will be rejected (invalid status) by us b) Please check the issue tacker to avoid duplication c) Please provide network capture (wireshark) or Android log (DDMS output) if you want quick response What steps will reproduce the problem? 1. 2.Register its OK 3.Instant Messaging. What is the expected output? What do you see instead? T´m testing a instant messaging client with an IMS Service developped in SDS Ericcson over Eclipse. The SIP MESSAGE should go to the AS who is listening at an uri. When i send the MESSAGE to this URI the P-CSCF(port 5081) forwards it to he S-CSCF and I-CSCF.I have no error in my DDMS or the Android Log. But the AS doest not receive the MESSAGE. Any suggestion? thanks What version of the product are you using? On what operating system? Please provide any additional information below. ``` Original issue reported on code.google.com by `fcgrava...@gmail.com` on 29 Apr 2012 at 3:01
1.0
MESSAGE is not received by the Application Server - ``` a) Before posting your issue you MUST answer to the questions otherwise it will be rejected (invalid status) by us b) Please check the issue tacker to avoid duplication c) Please provide network capture (wireshark) or Android log (DDMS output) if you want quick response What steps will reproduce the problem? 1. 2.Register its OK 3.Instant Messaging. What is the expected output? What do you see instead? T´m testing a instant messaging client with an IMS Service developped in SDS Ericcson over Eclipse. The SIP MESSAGE should go to the AS who is listening at an uri. When i send the MESSAGE to this URI the P-CSCF(port 5081) forwards it to he S-CSCF and I-CSCF.I have no error in my DDMS or the Android Log. But the AS doest not receive the MESSAGE. Any suggestion? thanks What version of the product are you using? On what operating system? Please provide any additional information below. ``` Original issue reported on code.google.com by `fcgrava...@gmail.com` on 29 Apr 2012 at 3:01
non_infrastructure
message is not received by the application server a before posting your issue you must answer to the questions otherwise it will be rejected invalid status by us b please check the issue tacker to avoid duplication c please provide network capture wireshark or android log ddms output if you want quick response what steps will reproduce the problem register its ok instant messaging what is the expected output what do you see instead t´m testing a instant messaging client with an ims service developped in sds ericcson over eclipse the sip message should go to the as who is listening at an uri when i send the message to this uri the p cscf port forwards it to he s cscf and i cscf i have no error in my ddms or the android log but the as doest not receive the message any suggestion thanks what version of the product are you using on what operating system please provide any additional information below original issue reported on code google com by fcgrava gmail com on apr at
0
1,911
3,200,821,319
IssuesEvent
2015-10-02 00:02:06
mispy/hybrid
https://api.github.com/repos/mispy/hybrid
closed
Pathing when there are no paths to be found
performance
It doesn't have to be super efficient, but it shouldn't lock up the game to lock someone up, so to speak
True
Pathing when there are no paths to be found - It doesn't have to be super efficient, but it shouldn't lock up the game to lock someone up, so to speak
non_infrastructure
pathing when there are no paths to be found it doesn t have to be super efficient but it shouldn t lock up the game to lock someone up so to speak
0
20,646
14,099,301,161
IssuesEvent
2020-11-06 01:02:11
noahtalerman/test-issues-kolide
https://api.github.com/repos/noahtalerman/test-issues-kolide
opened
[CLOSED] Create an email subpackage
Component: Development Infrastructure
<a href="https://github.com/marpaia"><img src="https://avatars2.githubusercontent.com/u/927168?v=4" align="left" width="96" height="96" hspace="10"></img></a> **Issue by [marpaia](https://github.com/marpaia)** _Monday Aug 08, 2016 at 18:27 GMT_ _Originally opened as https://github.com/kolide/fleet/issues/49_ ---- Create subpackage which abstractly allows for - sending emails in the application - defining HTML templates and sending HTML email - DKIM / email security settings, if available - verifying an email address for a user - sending emails like "click here to verify that you wanted to do X"
1.0
[CLOSED] Create an email subpackage - <a href="https://github.com/marpaia"><img src="https://avatars2.githubusercontent.com/u/927168?v=4" align="left" width="96" height="96" hspace="10"></img></a> **Issue by [marpaia](https://github.com/marpaia)** _Monday Aug 08, 2016 at 18:27 GMT_ _Originally opened as https://github.com/kolide/fleet/issues/49_ ---- Create subpackage which abstractly allows for - sending emails in the application - defining HTML templates and sending HTML email - DKIM / email security settings, if available - verifying an email address for a user - sending emails like "click here to verify that you wanted to do X"
infrastructure
create an email subpackage issue by monday aug at gmt originally opened as create subpackage which abstractly allows for sending emails in the application defining html templates and sending html email dkim email security settings if available verifying an email address for a user sending emails like click here to verify that you wanted to do x
1
955
2,994,102,043
IssuesEvent
2015-07-22 09:33:24
gratipay/gratipay.com
https://api.github.com/repos/gratipay/gratipay.com
closed
intermittent bad cert in the chain
Security
![image](https://cloud.githubusercontent.com/assets/226638/6783075/dc74a2e6-d145-11e4-9f9c-3cf3af51c1b3.png) <bountysource-plugin> --- Want to back this issue? **[Post a bounty on it!](https://www.bountysource.com/issues/9912968-intermittent-bad-cert-in-the-chain?utm_campaign=plugin&utm_content=tracker%2F85909&utm_medium=issues&utm_source=github)** We accept bounties via [Bountysource](https://www.bountysource.com/?utm_campaign=plugin&utm_content=tracker%2F85909&utm_medium=issues&utm_source=github). </bountysource-plugin>
True
intermittent bad cert in the chain - ![image](https://cloud.githubusercontent.com/assets/226638/6783075/dc74a2e6-d145-11e4-9f9c-3cf3af51c1b3.png) <bountysource-plugin> --- Want to back this issue? **[Post a bounty on it!](https://www.bountysource.com/issues/9912968-intermittent-bad-cert-in-the-chain?utm_campaign=plugin&utm_content=tracker%2F85909&utm_medium=issues&utm_source=github)** We accept bounties via [Bountysource](https://www.bountysource.com/?utm_campaign=plugin&utm_content=tracker%2F85909&utm_medium=issues&utm_source=github). </bountysource-plugin>
non_infrastructure
intermittent bad cert in the chain want to back this issue we accept bounties via
0
406,700
11,901,653,407
IssuesEvent
2020-03-30 12:49:07
pythonindia/junction
https://api.github.com/repos/pythonindia/junction
closed
Blacken the code!
priority-low
Well, it'd make the codebase easier to read IMO. Plus, it'll help do away with years of different code styles being used in various parts of the codebase.
1.0
Blacken the code! - Well, it'd make the codebase easier to read IMO. Plus, it'll help do away with years of different code styles being used in various parts of the codebase.
non_infrastructure
blacken the code well it d make the codebase easier to read imo plus it ll help do away with years of different code styles being used in various parts of the codebase
0
19,103
13,187,580,542
IssuesEvent
2020-08-13 03:53:01
icecube-trac/tix3
https://api.github.com/repos/icecube-trac/tix3
closed
HitSpool interface: variable HsSender location (Trac #945)
Migrated from Trac enhancement infrastructure
it would be nice to have an option on where the HSSender should run. standard is 2ndbuild on SPS but in case we need to switch (e.g. to pdaq2). Changes to be made: 1. in HSWorker.py:821 sender.connect("tcp://2ndbuild:55560") 2ndbuild has to be replace by a variable string with its value being connected to the machine specified when running the fabric script for deploying the HSInterface. This result in chnge number 2. fabric script for deploying http://code.icecube.wisc.edu/daq/projects/hitspool/trunk/fabfile.py : change DEPLOY_TARGET etc. <details> <summary><em>Migrated from https://code.icecube.wisc.edu/ticket/945 , reported by dheereman and owned by dheereman</em></summary> <p> ```json { "status": "closed", "changetime": "2015-08-10T22:35:41", "description": "\nit would be nice to have an option on where the HSSender should run. standard is 2ndbuild on SPS but in case we need to switch (e.g. to pdaq2).\n\nChanges to be made:\n1. in HSWorker.py:821\n\n sender.connect(\"tcp://2ndbuild:55560\")\n\n2ndbuild has to be replace by a variable string with its value being connected to the machine specified when running the fabric script for deploying the HSInterface.\n\nThis result in chnge number\n\n2. fabric script for deploying http://code.icecube.wisc.edu/daq/projects/hitspool/trunk/fabfile.py :\n\n change DEPLOY_TARGET\n etc. ", "reporter": "dheereman", "cc": "dheereman", "resolution": "wontfix", "_ts": "1439246141758578", "component": "infrastructure", "summary": "HitSpool interface: variable HsSender location", "priority": "normal", "keywords": "", "time": "2015-04-21T09:52:58", "milestone": "", "owner": "dheereman", "type": "enhancement" } ``` </p> </details>
1.0
HitSpool interface: variable HsSender location (Trac #945) - it would be nice to have an option on where the HSSender should run. standard is 2ndbuild on SPS but in case we need to switch (e.g. to pdaq2). Changes to be made: 1. in HSWorker.py:821 sender.connect("tcp://2ndbuild:55560") 2ndbuild has to be replace by a variable string with its value being connected to the machine specified when running the fabric script for deploying the HSInterface. This result in chnge number 2. fabric script for deploying http://code.icecube.wisc.edu/daq/projects/hitspool/trunk/fabfile.py : change DEPLOY_TARGET etc. <details> <summary><em>Migrated from https://code.icecube.wisc.edu/ticket/945 , reported by dheereman and owned by dheereman</em></summary> <p> ```json { "status": "closed", "changetime": "2015-08-10T22:35:41", "description": "\nit would be nice to have an option on where the HSSender should run. standard is 2ndbuild on SPS but in case we need to switch (e.g. to pdaq2).\n\nChanges to be made:\n1. in HSWorker.py:821\n\n sender.connect(\"tcp://2ndbuild:55560\")\n\n2ndbuild has to be replace by a variable string with its value being connected to the machine specified when running the fabric script for deploying the HSInterface.\n\nThis result in chnge number\n\n2. fabric script for deploying http://code.icecube.wisc.edu/daq/projects/hitspool/trunk/fabfile.py :\n\n change DEPLOY_TARGET\n etc. ", "reporter": "dheereman", "cc": "dheereman", "resolution": "wontfix", "_ts": "1439246141758578", "component": "infrastructure", "summary": "HitSpool interface: variable HsSender location", "priority": "normal", "keywords": "", "time": "2015-04-21T09:52:58", "milestone": "", "owner": "dheereman", "type": "enhancement" } ``` </p> </details>
infrastructure
hitspool interface variable hssender location trac it would be nice to have an option on where the hssender should run standard is on sps but in case we need to switch e g to changes to be made in hsworker py sender connect tcp has to be replace by a variable string with its value being connected to the machine specified when running the fabric script for deploying the hsinterface this result in chnge number fabric script for deploying change deploy target etc migrated from reported by dheereman and owned by dheereman json status closed changetime description nit would be nice to have an option on where the hssender should run standard is on sps but in case we need to switch e g to n nchanges to be made in hsworker py n n sender connect tcp n has to be replace by a variable string with its value being connected to the machine specified when running the fabric script for deploying the hsinterface n nthis result in chnge number n fabric script for deploying n n change deploy target n etc reporter dheereman cc dheereman resolution wontfix ts component infrastructure summary hitspool interface variable hssender location priority normal keywords time milestone owner dheereman type enhancement
1
20,163
11,404,494,994
IssuesEvent
2020-01-31 09:55:54
elastic/beats
https://api.github.com/repos/elastic/beats
opened
Port notice generator to Golang
Team:Services
Currently, the NOTICE.txt file is generated using the Python script `dev-tools/generate_notice.py`. To integrate better with `mage` and to utilize Golang specific tools, we should port the script to Golang.
1.0
Port notice generator to Golang - Currently, the NOTICE.txt file is generated using the Python script `dev-tools/generate_notice.py`. To integrate better with `mage` and to utilize Golang specific tools, we should port the script to Golang.
non_infrastructure
port notice generator to golang currently the notice txt file is generated using the python script dev tools generate notice py to integrate better with mage and to utilize golang specific tools we should port the script to golang
0
26,436
20,112,714,204
IssuesEvent
2022-02-07 16:26:27
GCTC-NTGC/gc-digital-talent
https://api.github.com/repos/GCTC-NTGC/gc-digital-talent
closed
ODP-G02 - Confirm TLS is configured securely
infrastructure
Reference [CATS document](https://canada-ca.github.io/CATS-STAE/oidc1-en.pdf) section 4.1.1 Confirm TLS is configured in a complaint way on our server ``` TLS MUST be configured according to the Guidance on Securely Configuring Network Protocols [ITSP.40.062]. ```
1.0
ODP-G02 - Confirm TLS is configured securely - Reference [CATS document](https://canada-ca.github.io/CATS-STAE/oidc1-en.pdf) section 4.1.1 Confirm TLS is configured in a complaint way on our server ``` TLS MUST be configured according to the Guidance on Securely Configuring Network Protocols [ITSP.40.062]. ```
infrastructure
odp confirm tls is configured securely reference section confirm tls is configured in a complaint way on our server tls must be configured according to the guidance on securely configuring network protocols
1
23,935
16,717,956,150
IssuesEvent
2021-06-10 01:12:41
dotnet/runtime
https://api.github.com/repos/dotnet/runtime
closed
Build failed: Validate-DotNet/main #runtime-92382-.NET6
area-Infrastructure untriaged
Build [#runtime-92382-.NET6](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_build/results?buildId=1166416) failed ## :x: : internal / Validate-DotNet failed ### Summary **Finished** - Wed, 02 Jun 2021 03:57:16 GMT **Duration** - 291 minutes **Requested for** - DotNet Bot **Reason** - manual ### Details #### Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/164) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.PGO.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 5 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Symbols missing for 4 packages - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - PowerShell exited with code '1'. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/251) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/271) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - ValidateSymbols: Entry found in generated contract does not match ValidateSymbols. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - ValidateSourcelink: Entry found in generated contract does not match ValidateSourcelink. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - Steps were not validated for contract. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - Contract was not validated. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - PowerShell exited with code '1'. #### Required Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/151) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/227) - Number of checksums and assets don't match. Checksums: 182. Assets: 794. Assets with no corresponding checksum are: assets/symbols/System.Security.Principal.Windows.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Permissions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Cryptography.Xml.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.DirectoryServices.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.DirectoryServices.AccountManagement.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.DirectoryServices.Protocols.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Drawing.Common.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Formats.Asn1.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Formats.Cbor.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.FileSystem.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Packaging.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Pipelines.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Pipes.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Data.OleDb.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Memory.Data.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Net.Http.Json.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Net.Http.WinHttpHandler.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Numerics.Tensors.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Reflection.Context.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Reflection.Metadata.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Reflection.MetadataLoadContext.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Cryptography.ProtectedData.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Management.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Data.Odbc.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Configuration.ConfigurationManager.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.CodeDom.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Collections.Immutable.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.ComponentModel.Composition.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.ComponentModel.Composition.Registration.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.AttributedModel.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.Convention.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.Hosting.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.Runtime.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg Runtime/6.0.0-preview.6.21301.6/runtime-productVersion.txt assets/symbols/runtime.linux-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy assets/symbols/runtime.linux-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.Win32.Registry.AccessControl Microsoft.Win32.SystemEvents Microsoft.Windows.Compatibility Microsoft.XmlSerializer.Generator runtime.linux-arm.Microsoft.NETCore.DotNetAppHost runtime.linux-arm.Microsoft.NETCore.DotNetHost runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver assets/symbols/System.ServiceModel.Syndication.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg Runtime/6.0.0-preview.6.21301.6/productVersion.txt runtime.linux-arm64.Microsoft.NETCore.ILDAsm runtime.linux-arm64.Microsoft.NETCore.TestHost runtime.linux-arm64.runtime.native.System.IO.Ports runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64 Microsoft.NETCore.Platforms Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64 Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64 Microsoft.NETCore.App.Runtime.Mono.osx-arm64 Microsoft.NETCore.App.Runtime.osx-x64 Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.TestHost runtime.osx-x64.Microsoft.NETCore.DotNetHost runtime.osx-x64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.ILDAsm runtime.win-arm64.Microsoft.NETCore.DotNetHost runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.win-x64.Microsoft.NETCore.DotNetAppHost runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Diagnostics.DiagnosticSource.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Diagnostics.EventLog.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Diagnostics.PerformanceCounter.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Resources.Extensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Runtime.Caching.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Runtime.CompilerServices.Unsafe.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Cryptography.Pkcs.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Runtime.Mono.linux-x64 assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Crossgen2.linux-arm64 Microsoft.Extensions.Hosting.WindowsServices dotnet-ilverify Microsoft.Extensions.Hosting.Abstractions Microsoft.Diagnostics.Tracing.EventSource.Redist Microsoft.Bcl.AsyncInterfaces Microsoft.Extensions.Caching.Abstractions Microsoft.Extensions.Caching.Memory Microsoft.NETCore.App.Crossgen2.osx-arm64 Microsoft.Extensions.Configuration.UserSecrets Microsoft.Extensions.Configuration.Xml Microsoft.Extensions.DependencyInjection Microsoft.Extensions.DependencyInjection.Abstractions Microsoft.Extensions.DependencyInjection.Specification.Tests Microsoft.Extensions.Hosting Microsoft.Extensions.Configuration.Ini Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64 assets/symbols/Microsoft.NETCore.App.Host.win-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.Android.Sample.Mono.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.iOS.Sample.Mono.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.MonoAOTCompiler.Task.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.RuntimeConfigParser.Task.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.wasm.Sample.Mono.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.WebAssembly.Sdk.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NET.Runtime.WebAssembly.Sdk Microsoft.NET.Runtime.MonoAOTCompiler.Task Microsoft.NET.Runtime.RuntimeConfigParser.Task Microsoft.NET.Sdk.IL Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100 Microsoft.NETCore.App.Crossgen2.linux-musl-arm Microsoft.NETCore.App.Crossgen2.linux-musl-x64 Microsoft.Extensions.Configuration Microsoft.Extensions.Configuration.Binder Microsoft.Extensions.Configuration.Abstractions Microsoft.Extensions.Configuration.CommandLine Microsoft.Extensions.Configuration.EnvironmentVariables Microsoft.Extensions.Hosting.Systemd Microsoft.Extensions.Configuration.FileExtensions Microsoft.Extensions.Configuration.Json Microsoft.Extensions.DependencyModel Microsoft.Extensions.FileProviders.Abstractions Microsoft.Extensions.FileProviders.Physical Microsoft.Extensions.FileProviders.Composite Microsoft.Extensions.FileSystemGlobbing Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64 assets/symbols/runtime.linux-arm.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64 Microsoft.NETCore.App.Runtime.linux-musl-arm Microsoft.NETCore.App.Crossgen2.osx-x64 Microsoft.NETCore.App.Crossgen2.win-x64 Microsoft.NETCore.App.Crossgen2.win-arm Microsoft.NETCore.App.Host.linux-arm Microsoft.NETCore.App.Host.linux-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm Microsoft.NETCore.App.Host.linux-musl-arm Microsoft.NETCore.App.Host.osx-arm64 Microsoft.NETCore.App.Host.win-arm Microsoft.NETCore.App.Host.win-x86 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64 assets/symbols/Microsoft.NETCore.App.PGO.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Ref.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Composite.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.BrowserDebugHost.Transport.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Text.Encodings.Web.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Threading.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Threading.Channels.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Threading.Tasks.Dataflow.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Windows.Extensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.Win32.Registry Microsoft.NETCore.TestHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64 Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64 Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64 Microsoft.NETCore.App.Runtime.Mono.osx-x64 runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver runtime.win-arm.Microsoft.NETCore.DotNetAppHost runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy runtime.osx-x64.Microsoft.NETCore.ILAsm runtime.osx-x64.Microsoft.NETCore.ILDAsm runtime.osx-x64.Microsoft.NETCore.TestHost runtime.osx-x64.runtime.native.System.IO.Ports runtime.win-arm.Microsoft.NETCore.DotNetHost runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy runtime.win-arm64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.DotNetHostResolver runtime.win-arm64.Microsoft.NETCore.ILDAsm runtime.win-arm.Microsoft.NETCore.ILAsm runtime.osx-arm64.Microsoft.NETCore.TestHost runtime.win-arm64.Microsoft.NETCore.ILAsm runtime.win-arm64.Microsoft.NETCore.TestHost runtime.win-x64.Microsoft.NETCore.DotNetHost runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy runtime.win-x64.Microsoft.NETCore.ILAsm runtime.win-x64.Microsoft.NETCore.ILDAsm runtime.win-x64.Microsoft.NETCore.DotNetHostResolver runtime.win-arm.Microsoft.NETCore.TestHost runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost runtime.osx-arm64.Microsoft.NETCore.ILDAsm runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg runtime.win-x86.Microsoft.NETCore.DotNetHost assets/symbols/Microsoft.NETCore.App.Runtime.win-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Win32.SystemEvents.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Windows.Compatibility.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.XmlSerializer.Generator.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg System.Net.Http.Json System.Security.Principal.Windows System.Security.Cryptography.Xml System.ServiceProcess.ServiceController System.ServiceModel.Syndication System.Speech System.Management System.IO.Pipes.AccessControl System.IO.Pipelines System.IO.Ports runtime.win-x86.Microsoft.NETCore.DotNetHostResolver runtime.win-x86.Microsoft.NETCore.ILAsm runtime.win-x86.Microsoft.NETCore.ILDAsm runtime.win-x86.Microsoft.NETCore.TestHost System.CodeDom System.Composition.Hosting System.Collections.Immutable System.DirectoryServices.AccountManagement System.ComponentModel.Composition System.ComponentModel.Composition.Registration System.Composition System.Composition.AttributedModel System.Composition.Convention System.Composition.Runtime assets/symbols/Microsoft.IO.Redist.6.0.0-preview.6.21301.6.symbols.nupkg System.Composition.TypedParts System.Data.Odbc System.Data.OleDb System.Diagnostics.DiagnosticSource System.Diagnostics.EventLog System.Formats.Asn1 System.Formats.Cbor System.IO.FileSystem.AccessControl assets/symbols/Microsoft.Extensions.DependencyInjection.Specification.Tests.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Systemd.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Http.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.WindowsServices.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.linux-musl-x64 Microsoft.NETCore.App.Runtime.linux-x64 Microsoft.NETCore.App.Runtime.Mono.android-arm64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86 runtime.win-x86.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Host.win-arm64 runtime.win-x64.Microsoft.NETCore.TestHost runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Private.CoreFx.OOB.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvos-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg System.Memory.Data assets/symbols/Microsoft.NET.HostModel.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Net.HostModel.PGO.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.ILVerification.6.0.0-preview.6.21301.6.symbols.nupkg System.Reflection.Context System.Security.Cryptography.ProtectedData System.Reflection.Metadata System.Numerics.Tensors System.Runtime.Caching System.Reflection.MetadataLoadContext System.Resources.Extensions System.Runtime.CompilerServices.Unsafe System.Security.Permissions System.Security.Cryptography.Pkcs System.Security.AccessControl System.Text.Json System.Windows.Extensions System.Text.Encoding.CodePages System.Text.Encodings.Web System.Threading.AccessControl System.Threading.Tasks.Dataflow System.Threading.Channels System.Diagnostics.PerformanceCounter System.DirectoryServices System.DirectoryServices.Protocols System.Drawing.Common System.IO.Packaging System.Configuration.ConfigurationManager assets/symbols/Microsoft.Extensions.Configuration.Xml.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyModel.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Composite.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Physical.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileSystemGlobbing.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.HostFactoryResolver.Sources.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Json.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Configuration.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Console.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Debug.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventLog.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventSource.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.TraceSource.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.ConfigurationExtensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.DataAnnotations.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Primitives.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Ini.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.UserSecrets.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.EnvironmentVariables.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Bcl.AsyncInterfaces.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Memory.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/dotnet-pgo.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Diagnostics.Tracing.EventSource.Redist.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Text.Json.6.0.0-preview.6.21301.6.symbols.nupkg runtime.linux-musl-arm64.Microsoft.NETCore.TestHost runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-x64.Microsoft.NETCore.ILAsm runtime.osx-arm64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.DotNetAppHost runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm runtime.linux-x64.Microsoft.NETCore.DotNetHost runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-x64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.ILDAsm Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64 runtime.linux-x64.Microsoft.NETCore.TestHost runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-x64.runtime.native.System.IO.Ports runtime.native.System.IO.Ports Microsoft.NETCore.App.Runtime.Mono.linux-arm64 Microsoft.NETCore.App.Runtime.Mono.linux-arm runtime.osx-arm64.Microsoft.NETCore.DotNetHost runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.TestHost Microsoft.Extensions.Logging Microsoft.Extensions.Logging.Abstractions Microsoft.Extensions.Logging.Configuration Microsoft.Extensions.Logging.Console Microsoft.ILVerification Microsoft.NET.Runtime.Android.Sample.Mono Microsoft.IO.Redist Microsoft.NET.Runtime.wasm.Sample.Mono Microsoft.NET.Runtime.iOS.Sample.Mono Microsoft.NETCore.App.Crossgen2.linux-musl-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64 Microsoft.NETCore.App.Runtime.linux-arm64 Microsoft.NETCore.App.Runtime.linux-musl-arm64 Microsoft.NETCore.App.Runtime.Mono.android-arm Microsoft.NETCore.App.Runtime.Mono.android-x64 Microsoft.NETCore.App.Runtime.Mono.ios-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/ILCompiler.Reflection.ReadyToRun.Experimental.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Speech.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Text.Encoding.CodePages.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.ServiceProcess.ServiceController.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.TypedParts.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg runtime.linux-arm.Microsoft.NETCore.ILDAsm runtime.linux-arm.Microsoft.NETCore.ILAsm runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-arm.Microsoft.NETCore.TestHost runtime.linux-arm.runtime.native.System.IO.Ports runtime.linux-arm64.Microsoft.NETCore.DotNetHost runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-arm64.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.Mono.tvos-arm64 Microsoft.NETCore.App.Runtime.osx-arm64 Microsoft.NETCore.App.Runtime.Mono.win-x64 runtime.linux-musl-arm.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Runtime.win-arm Microsoft.NETCore.App.Runtime.win-arm64 Microsoft.NETCore.App.Runtime.win-x64 Microsoft.NETCore.App.Runtime.win-x86 Microsoft.NETCore.App.Runtime.Mono.win-x86 Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.DotNetHost Microsoft.NETCore.DotNetHostPolicy Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Composite Microsoft.Extensions.Logging.Debug Microsoft.Extensions.Logging.EventLog Microsoft.Extensions.Logging.EventSource Microsoft.Extensions.Logging.TraceSource Microsoft.Extensions.Options Microsoft.Extensions.Options.ConfigurationExtensions Microsoft.Extensions.Options.DataAnnotations Microsoft.Extensions.Primitives Microsoft.Extensions.Http Microsoft.NETCore.App.Crossgen2.linux-arm Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86 Microsoft.NETCore.App.Runtime.linux-arm Microsoft.NETCore.App.Runtime.Mono.android-x86 Microsoft.NETCore.App.Runtime.Mono.browser-wasm Microsoft.NETCore.App.Runtime.Mono.ios-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86 Microsoft.NETCore.App.Crossgen2.linux-x64 Microsoft.NETCore.App.Crossgen2.win-arm64 Microsoft.NETCore.App.Crossgen2.win-x86 Microsoft.NETCore.App.Host.linux-musl-arm64 Microsoft.NETCore.App.Host.linux-musl-x64 Microsoft.NETCore.App.Host.linux-x64 Microsoft.NETCore.App.Host.osx-x64 Microsoft.NETCore.App.Host.win-x64 Microsoft.NETCore.App.Ref Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86 assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Sdk.IL.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg System.Net.Http.WinHttpHandler assets/symbols/Microsoft.Extensions.Configuration.FileExtensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.CommandLine.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.AspNetCore.Internal.Transport.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Binder.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/dotnet-ilverify.6.0.0-preview.6.21301.6.symbols.nupkg - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/239) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/161) - Git fetch failed with exit code 128, back off 9.146 seconds before retry. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/178) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/206) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/278) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Signing Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/68) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/131) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Source Code Validation - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/49) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/74) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/103) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/120) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Prep Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/36) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. ### Changes
1.0
Build failed: Validate-DotNet/main #runtime-92382-.NET6 - Build [#runtime-92382-.NET6](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_build/results?buildId=1166416) failed ## :x: : internal / Validate-DotNet failed ### Summary **Finished** - Wed, 02 Jun 2021 03:57:16 GMT **Duration** - 291 minutes **Requested for** - DotNet Bot **Reason** - manual ### Details #### Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/164) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 1 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.PGO.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Missing symbols for 5 modules in the package D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21301.6.symbols.nupkg - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - (NETCORE_ENGINEERING_TELEMETRY=CheckSymbols) Symbols missing for 4 packages - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/282) - PowerShell exited with code '1'. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Crossgen2.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/288) - (NETCORE_ENGINEERING_TELEMETRY=SourceLink) D:\workspace\_work\1\a\signed\shipping\assets\symbols\Microsoft.NETCore.App.Runtime.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg has broken SourceLink links. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/251) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/271) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - ValidateSymbols: Entry found in generated contract does not match ValidateSymbols. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - ValidateSourcelink: Entry found in generated contract does not match ValidateSourcelink. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - Steps were not validated for contract. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - Contract was not validated. - :x: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/304) - PowerShell exited with code '1'. #### Required Validation Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/151) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/227) - Number of checksums and assets don't match. Checksums: 182. Assets: 794. Assets with no corresponding checksum are: assets/symbols/System.Security.Principal.Windows.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Permissions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Cryptography.Xml.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.DirectoryServices.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.DirectoryServices.AccountManagement.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.DirectoryServices.Protocols.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Drawing.Common.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Formats.Asn1.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Formats.Cbor.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.FileSystem.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Packaging.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Pipelines.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Pipes.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Data.OleDb.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Memory.Data.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Net.Http.Json.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Net.Http.WinHttpHandler.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Numerics.Tensors.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Reflection.Context.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Reflection.Metadata.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Reflection.MetadataLoadContext.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Cryptography.ProtectedData.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Management.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Data.Odbc.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Configuration.ConfigurationManager.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.CodeDom.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Collections.Immutable.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.ComponentModel.Composition.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.ComponentModel.Composition.Registration.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.AttributedModel.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.Convention.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.Hosting.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.Runtime.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg Runtime/6.0.0-preview.6.21301.6/runtime-productVersion.txt assets/symbols/runtime.linux-arm64.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy assets/symbols/runtime.linux-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.Win32.Registry.AccessControl Microsoft.Win32.SystemEvents Microsoft.Windows.Compatibility Microsoft.XmlSerializer.Generator runtime.linux-arm.Microsoft.NETCore.DotNetAppHost runtime.linux-arm.Microsoft.NETCore.DotNetHost runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver assets/symbols/System.ServiceModel.Syndication.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg Runtime/6.0.0-preview.6.21301.6/productVersion.txt runtime.linux-arm64.Microsoft.NETCore.ILDAsm runtime.linux-arm64.Microsoft.NETCore.TestHost runtime.linux-arm64.runtime.native.System.IO.Ports runtime.linux-musl-arm.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64 Microsoft.NETCore.Platforms Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64 Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64 Microsoft.NETCore.App.Runtime.Mono.osx-arm64 Microsoft.NETCore.App.Runtime.osx-x64 Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm runtime.linux-musl-arm.Microsoft.NETCore.TestHost runtime.osx-x64.Microsoft.NETCore.DotNetHost runtime.osx-x64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.ILDAsm runtime.win-arm64.Microsoft.NETCore.DotNetHost runtime.win-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.win-x64.Microsoft.NETCore.DotNetAppHost runtime.win-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.ILAsm assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-x64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Diagnostics.DiagnosticSource.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Diagnostics.EventLog.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Diagnostics.PerformanceCounter.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Resources.Extensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Runtime.Caching.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Runtime.CompilerServices.Unsafe.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Security.Cryptography.Pkcs.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Runtime.Mono.linux-x64 assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Crossgen2.linux-arm64 Microsoft.Extensions.Hosting.WindowsServices dotnet-ilverify Microsoft.Extensions.Hosting.Abstractions Microsoft.Diagnostics.Tracing.EventSource.Redist Microsoft.Bcl.AsyncInterfaces Microsoft.Extensions.Caching.Abstractions Microsoft.Extensions.Caching.Memory Microsoft.NETCore.App.Crossgen2.osx-arm64 Microsoft.Extensions.Configuration.UserSecrets Microsoft.Extensions.Configuration.Xml Microsoft.Extensions.DependencyInjection Microsoft.Extensions.DependencyInjection.Abstractions Microsoft.Extensions.DependencyInjection.Specification.Tests Microsoft.Extensions.Hosting Microsoft.Extensions.Configuration.Ini Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64 assets/symbols/Microsoft.NETCore.App.Host.win-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.Android.Sample.Mono.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.iOS.Sample.Mono.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.MonoAOTCompiler.Task.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.RuntimeConfigParser.Task.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.wasm.Sample.Mono.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Runtime.WebAssembly.Sdk.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NET.Runtime.WebAssembly.Sdk Microsoft.NET.Runtime.MonoAOTCompiler.Task Microsoft.NET.Runtime.RuntimeConfigParser.Task Microsoft.NET.Sdk.IL Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100 Microsoft.NETCore.App.Crossgen2.linux-musl-arm Microsoft.NETCore.App.Crossgen2.linux-musl-x64 Microsoft.Extensions.Configuration Microsoft.Extensions.Configuration.Binder Microsoft.Extensions.Configuration.Abstractions Microsoft.Extensions.Configuration.CommandLine Microsoft.Extensions.Configuration.EnvironmentVariables Microsoft.Extensions.Hosting.Systemd Microsoft.Extensions.Configuration.FileExtensions Microsoft.Extensions.Configuration.Json Microsoft.Extensions.DependencyModel Microsoft.Extensions.FileProviders.Abstractions Microsoft.Extensions.FileProviders.Physical Microsoft.Extensions.FileProviders.Composite Microsoft.Extensions.FileSystemGlobbing Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64 assets/symbols/runtime.linux-arm.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64 Microsoft.NETCore.App.Runtime.linux-musl-arm Microsoft.NETCore.App.Crossgen2.osx-x64 Microsoft.NETCore.App.Crossgen2.win-x64 Microsoft.NETCore.App.Crossgen2.win-arm Microsoft.NETCore.App.Host.linux-arm Microsoft.NETCore.App.Host.linux-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm Microsoft.NETCore.App.Host.linux-musl-arm Microsoft.NETCore.App.Host.osx-arm64 Microsoft.NETCore.App.Host.win-arm Microsoft.NETCore.App.Host.win-x86 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64 assets/symbols/Microsoft.NETCore.App.PGO.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Ref.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Composite.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.BrowserDebugHost.Transport.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Text.Encodings.Web.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Threading.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Threading.Channels.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Threading.Tasks.Dataflow.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Windows.Extensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.runtime.native.System.IO.Ports.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-x64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x86.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.Win32.Registry Microsoft.NETCore.TestHost Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64 Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64 Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64 Microsoft.NETCore.App.Runtime.Mono.osx-x64 runtime.osx-x64.Microsoft.NETCore.DotNetHostResolver runtime.win-arm.Microsoft.NETCore.DotNetAppHost runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy runtime.osx-x64.Microsoft.NETCore.ILAsm runtime.osx-x64.Microsoft.NETCore.ILDAsm runtime.osx-x64.Microsoft.NETCore.TestHost runtime.osx-x64.runtime.native.System.IO.Ports runtime.win-arm.Microsoft.NETCore.DotNetHost runtime.win-arm.Microsoft.NETCore.DotNetHostPolicy runtime.win-arm64.Microsoft.NETCore.DotNetAppHost runtime.win-arm.Microsoft.NETCore.DotNetHostResolver runtime.win-arm64.Microsoft.NETCore.ILDAsm runtime.win-arm.Microsoft.NETCore.ILAsm runtime.osx-arm64.Microsoft.NETCore.TestHost runtime.win-arm64.Microsoft.NETCore.ILAsm runtime.win-arm64.Microsoft.NETCore.TestHost runtime.win-x64.Microsoft.NETCore.DotNetHost runtime.win-x64.Microsoft.NETCore.DotNetHostPolicy runtime.win-x64.Microsoft.NETCore.ILAsm runtime.win-x64.Microsoft.NETCore.ILDAsm runtime.win-x64.Microsoft.NETCore.DotNetHostResolver runtime.win-arm.Microsoft.NETCore.TestHost runtime.linux-musl-arm64.Microsoft.NETCore.DotNetAppHost runtime.osx-arm64.Microsoft.NETCore.ILDAsm runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHost runtime.linux-musl-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-x64.Microsoft.NETCore.DotNetAppHost runtime.linux-musl-arm64.Microsoft.NETCore.ILDAsm assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvos-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg runtime.win-x86.Microsoft.NETCore.DotNetHost assets/symbols/Microsoft.NETCore.App.Runtime.win-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.AccessControl.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Win32.SystemEvents.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Windows.Compatibility.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.XmlSerializer.Generator.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.CrossOsDiag.Private.CoreCLR.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.maccatalyst-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg System.Net.Http.Json System.Security.Principal.Windows System.Security.Cryptography.Xml System.ServiceProcess.ServiceController System.ServiceModel.Syndication System.Speech System.Management System.IO.Pipes.AccessControl System.IO.Pipelines System.IO.Ports runtime.win-x86.Microsoft.NETCore.DotNetHostResolver runtime.win-x86.Microsoft.NETCore.ILAsm runtime.win-x86.Microsoft.NETCore.ILDAsm runtime.win-x86.Microsoft.NETCore.TestHost System.CodeDom System.Composition.Hosting System.Collections.Immutable System.DirectoryServices.AccountManagement System.ComponentModel.Composition System.ComponentModel.Composition.Registration System.Composition System.Composition.AttributedModel System.Composition.Convention System.Composition.Runtime assets/symbols/Microsoft.IO.Redist.6.0.0-preview.6.21301.6.symbols.nupkg System.Composition.TypedParts System.Data.Odbc System.Data.OleDb System.Diagnostics.DiagnosticSource System.Diagnostics.EventLog System.Formats.Asn1 System.Formats.Cbor System.IO.FileSystem.AccessControl assets/symbols/Microsoft.Extensions.DependencyInjection.Specification.Tests.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Systemd.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Http.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.WindowsServices.6.0.0-preview.6.21301.6.symbols.nupkg Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.linux-musl-x64 Microsoft.NETCore.App.Runtime.linux-x64 Microsoft.NETCore.App.Runtime.Mono.android-arm64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64 Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86 runtime.win-x86.Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.App.Host.win-arm64 runtime.win-x64.Microsoft.NETCore.TestHost runtime.win-x86.Microsoft.NETCore.DotNetHostPolicy assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.win-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Host.osx-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Private.CoreFx.OOB.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Win32.Registry.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.tvos-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg System.Memory.Data assets/symbols/Microsoft.NET.HostModel.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Net.HostModel.PGO.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.ILVerification.6.0.0-preview.6.21301.6.symbols.nupkg System.Reflection.Context System.Security.Cryptography.ProtectedData System.Reflection.Metadata System.Numerics.Tensors System.Runtime.Caching System.Reflection.MetadataLoadContext System.Resources.Extensions System.Runtime.CompilerServices.Unsafe System.Security.Permissions System.Security.Cryptography.Pkcs System.Security.AccessControl System.Text.Json System.Windows.Extensions System.Text.Encoding.CodePages System.Text.Encodings.Web System.Threading.AccessControl System.Threading.Tasks.Dataflow System.Threading.Channels System.Diagnostics.PerformanceCounter System.DirectoryServices System.DirectoryServices.Protocols System.Drawing.Common System.IO.Packaging System.Configuration.ConfigurationManager assets/symbols/Microsoft.Extensions.Configuration.Xml.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyInjection.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.DependencyModel.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Composite.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileProviders.Physical.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.FileSystemGlobbing.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.HostFactoryResolver.Sources.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Hosting.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Json.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Configuration.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Console.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.Debug.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventLog.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.EventSource.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Logging.TraceSource.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.ConfigurationExtensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Options.DataAnnotations.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Primitives.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Ini.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.UserSecrets.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.EnvironmentVariables.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Bcl.AsyncInterfaces.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Memory.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/dotnet-pgo.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Diagnostics.Tracing.EventSource.Redist.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Text.Json.6.0.0-preview.6.21301.6.symbols.nupkg runtime.linux-musl-arm64.Microsoft.NETCore.TestHost runtime.linux-x64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-x64.Microsoft.NETCore.DotNetHost runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.DotNetHostResolver runtime.linux-musl-x64.Microsoft.NETCore.ILAsm runtime.osx-arm64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.DotNetAppHost runtime.linux-musl-x64.Microsoft.NETCore.ILDAsm runtime.linux-x64.Microsoft.NETCore.DotNetHost runtime.linux-x64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-x64.Microsoft.NETCore.ILAsm runtime.linux-x64.Microsoft.NETCore.ILDAsm Microsoft.NETCore.App.Runtime.Mono.linux-musl-x64 runtime.linux-x64.Microsoft.NETCore.TestHost runtime.osx-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-x64.runtime.native.System.IO.Ports runtime.native.System.IO.Ports Microsoft.NETCore.App.Runtime.Mono.linux-arm64 Microsoft.NETCore.App.Runtime.Mono.linux-arm runtime.osx-arm64.Microsoft.NETCore.DotNetHost runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-x64.Microsoft.NETCore.TestHost Microsoft.Extensions.Logging Microsoft.Extensions.Logging.Abstractions Microsoft.Extensions.Logging.Configuration Microsoft.Extensions.Logging.Console Microsoft.ILVerification Microsoft.NET.Runtime.Android.Sample.Mono Microsoft.IO.Redist Microsoft.NET.Runtime.wasm.Sample.Mono Microsoft.NET.Runtime.iOS.Sample.Mono Microsoft.NETCore.App.Crossgen2.linux-musl-arm64 Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-arm64 Microsoft.NETCore.App.Runtime.linux-arm64 Microsoft.NETCore.App.Runtime.linux-musl-arm64 Microsoft.NETCore.App.Runtime.Mono.android-arm Microsoft.NETCore.App.Runtime.Mono.android-x64 Microsoft.NETCore.App.Runtime.Mono.ios-arm Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.ios-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.maccatalyst-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.tvossimulator-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-musl-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.win-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-musl-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.win-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/ILCompiler.Reflection.ReadyToRun.Experimental.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Speech.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Text.Encoding.CodePages.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.ServiceProcess.ServiceController.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-arm64.Microsoft.NETCore.TestHost.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.osx-x64.Microsoft.NETCore.DotNetHostPolicy.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-musl-arm.Microsoft.NETCore.ILDAsm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/System.Composition.TypedParts.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.win-x64.Microsoft.NETCore.DotNetHostResolver.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost.6.0.0-preview.6.21301.6.symbols.nupkg runtime.linux-arm.Microsoft.NETCore.ILDAsm runtime.linux-arm.Microsoft.NETCore.ILAsm runtime.linux-arm64.Microsoft.NETCore.DotNetAppHost runtime.linux-arm.Microsoft.NETCore.TestHost runtime.linux-arm.runtime.native.System.IO.Ports runtime.linux-arm64.Microsoft.NETCore.DotNetHost runtime.linux-arm64.Microsoft.NETCore.DotNetHostResolver runtime.linux-arm64.Microsoft.NETCore.DotNetHostPolicy runtime.linux-arm64.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.linux-x64 runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostPolicy runtime.linux-musl-arm.Microsoft.NETCore.DotNetHost runtime.linux-musl-arm.Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.App.Runtime.Mono.maccatalyst-x64 Microsoft.NETCore.App.Runtime.Mono.tvossimulator-arm64 Microsoft.NETCore.App.Runtime.Mono.tvos-arm64 Microsoft.NETCore.App.Runtime.osx-arm64 Microsoft.NETCore.App.Runtime.Mono.win-x64 runtime.linux-musl-arm.Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Runtime.win-arm Microsoft.NETCore.App.Runtime.win-arm64 Microsoft.NETCore.App.Runtime.win-x64 Microsoft.NETCore.App.Runtime.win-x86 Microsoft.NETCore.App.Runtime.Mono.win-x86 Microsoft.NETCore.DotNetAppHost Microsoft.NETCore.DotNetHost Microsoft.NETCore.DotNetHostPolicy Microsoft.NETCore.DotNetHostResolver Microsoft.NETCore.ILAsm Microsoft.NETCore.App.Composite Microsoft.Extensions.Logging.Debug Microsoft.Extensions.Logging.EventLog Microsoft.Extensions.Logging.EventSource Microsoft.Extensions.Logging.TraceSource Microsoft.Extensions.Options Microsoft.Extensions.Options.ConfigurationExtensions Microsoft.Extensions.Options.DataAnnotations Microsoft.Extensions.Primitives Microsoft.Extensions.Http Microsoft.NETCore.App.Crossgen2.linux-arm Microsoft.NETCore.App.Runtime.AOT.win-x64.Cross.android-x86 Microsoft.NETCore.App.Runtime.linux-arm Microsoft.NETCore.App.Runtime.Mono.android-x86 Microsoft.NETCore.App.Runtime.Mono.browser-wasm Microsoft.NETCore.App.Runtime.Mono.ios-arm64 Microsoft.NETCore.App.Runtime.Mono.iossimulator-x86 Microsoft.NETCore.App.Crossgen2.linux-x64 Microsoft.NETCore.App.Crossgen2.win-arm64 Microsoft.NETCore.App.Crossgen2.win-x86 Microsoft.NETCore.App.Host.linux-musl-arm64 Microsoft.NETCore.App.Host.linux-musl-x64 Microsoft.NETCore.App.Host.linux-x64 Microsoft.NETCore.App.Host.osx-x64 Microsoft.NETCore.App.Host.win-x64 Microsoft.NETCore.App.Ref Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-x86 assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.android-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.linux-x64.Cross.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.android-x86.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.AOT.osx-x64.Cross.iossimulator-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Crossgen2.linux-arm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Sdk.IL.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NET.Workload.Mono.ToolChain.Manifest-6.0.100.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.ios-arm64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.browser-wasm.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.AOT.osx-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.linux-x64.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.NETCore.App.Runtime.Mono.LLVM.linux-arm64.6.0.0-preview.6.21301.6.symbols.nupkg System.Net.Http.WinHttpHandler assets/symbols/Microsoft.Extensions.Configuration.FileExtensions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.CommandLine.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.AspNetCore.Internal.Transport.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Configuration.Binder.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/Microsoft.Extensions.Caching.Abstractions.6.0.0-preview.6.21301.6.symbols.nupkg assets/symbols/dotnet-ilverify.6.0.0-preview.6.21301.6.symbols.nupkg - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/239) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/161) - Git fetch failed with exit code 128, back off 9.146 seconds before retry. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/178) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/206) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/278) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Signing Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/68) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/131) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Source Code Validation - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/49) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/74) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/103) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/120) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. #### Prep Ring - :warning: - [[Log]](https://dev.azure.com/dnceng/7ea9116e-9fac-403d-b258-b31fcf1bb293/_apis/build/builds/1166416/logs/36) - Component Governance detected 1 security related alerts at or above 'High' severity. Microsoft’s Open Source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components. Vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency. ### Changes
infrastructure
build failed validate dotnet main runtime build failed x internal validate dotnet failed summary finished wed jun gmt duration minutes requested for dotnet bot reason manual details validation ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app linux preview symbols nupkg x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app linux arm preview symbols nupkg x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app pgo preview symbols nupkg x netcore engineering telemetry checksymbols missing symbols for modules in the package d workspace work a signed shipping assets symbols microsoft netcore app runtime mono ios arm preview symbols nupkg x netcore engineering telemetry checksymbols symbols missing for packages x powershell exited with code x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app linux arm preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app linux preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app linux musl arm preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app linux musl preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app linux musl preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app linux preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app osx preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app osx preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app runtime linux arm preview symbols nupkg has broken sourcelink links x netcore engineering telemetry sourcelink d workspace work a signed shipping assets symbols microsoft netcore app runtime linux preview symbols nupkg has broken sourcelink links warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency x validatesymbols entry found in generated contract does not match validatesymbols x validatesourcelink entry found in generated contract does not match validatesourcelink x steps were not validated for contract x contract was not validated x powershell exited with code required validation ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning number of checksums and assets don t match checksums assets assets with no corresponding checksum are assets symbols system security principal windows preview symbols nupkg assets symbols system security permissions preview symbols nupkg assets symbols system security cryptography xml preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux microsoft netcore testhost preview symbols nupkg assets symbols runtime linux runtime native system io ports preview symbols nupkg assets symbols runtime native system io ports preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore testhost preview symbols nupkg assets symbols runtime win arm microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux musl microsoft crossosdiag private coreclr preview symbols nupkg assets symbols system directoryservices preview symbols nupkg assets symbols system directoryservices accountmanagement preview symbols nupkg assets symbols system directoryservices protocols preview symbols nupkg assets symbols system drawing common preview symbols nupkg assets symbols system formats preview symbols nupkg assets symbols system formats cbor preview symbols nupkg assets symbols system io filesystem accesscontrol preview symbols nupkg assets symbols system io packaging preview symbols nupkg assets symbols system io pipelines preview symbols nupkg assets symbols system io pipes accesscontrol preview symbols nupkg assets symbols system data oledb preview symbols nupkg assets symbols system io ports preview symbols nupkg assets symbols system memory data preview symbols nupkg assets symbols system net http json preview symbols nupkg assets symbols system net http winhttphandler preview symbols nupkg assets symbols system numerics tensors preview symbols nupkg assets symbols system reflection context preview symbols nupkg assets symbols system reflection metadata preview symbols nupkg assets symbols system reflection metadataloadcontext preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux musl microsoft netcore testhost preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux microsoft netcore testhost preview symbols nupkg assets symbols runtime linux runtime native system io ports preview symbols nupkg assets symbols runtime linux musl arm microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore testhost preview symbols nupkg assets symbols runtime linux musl microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win microsoft netcore dotnetapphost preview symbols nupkg assets symbols system security cryptography protecteddata preview symbols nupkg assets symbols system management preview symbols nupkg assets symbols system data odbc preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win microsoft netcore ildasm preview symbols nupkg assets symbols runtime win microsoft netcore testhost preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime win microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win microsoft netcore ilasm preview symbols nupkg assets symbols runtime win microsoft netcore ildasm preview symbols nupkg assets symbols runtime win microsoft netcore testhost preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win microsoft netcore dotnethost preview symbols nupkg assets symbols system configuration configurationmanager preview symbols nupkg assets symbols runtime win microsoft netcore ildasm preview symbols nupkg assets symbols runtime win microsoft netcore ilasm preview symbols nupkg assets symbols runtime win microsoft netcore testhost preview symbols nupkg assets symbols system codedom preview symbols nupkg assets symbols system collections immutable preview symbols nupkg assets symbols system componentmodel composition preview symbols nupkg assets symbols system componentmodel composition registration preview symbols nupkg assets symbols system composition preview symbols nupkg assets symbols system composition attributedmodel preview symbols nupkg assets symbols system composition convention preview symbols nupkg assets symbols system composition hosting preview symbols nupkg assets symbols system composition runtime preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostpolicy preview symbols nupkg runtime preview runtime productversion txt assets symbols runtime linux microsoft crossosdiag private coreclr preview symbols nupkg runtime linux arm microsoft netcore dotnethostpolicy assets symbols runtime linux arm microsoft netcore testhost preview symbols nupkg microsoft registry accesscontrol microsoft systemevents microsoft windows compatibility microsoft xmlserializer generator runtime linux arm microsoft netcore dotnetapphost runtime linux arm microsoft netcore dotnethost runtime linux arm microsoft netcore dotnethostresolver assets symbols system servicemodel syndication preview symbols nupkg assets symbols runtime osx microsoft netcore dotnetapphost preview symbols nupkg runtime preview productversion txt runtime linux microsoft netcore ildasm runtime linux microsoft netcore testhost runtime linux runtime native system io ports runtime linux musl arm microsoft netcore dotnetapphost microsoft netcore app runtime mono llvm aot linux microsoft netcore platforms microsoft netcore app runtime mono llvm linux microsoft netcore app runtime mono llvm osx microsoft netcore app runtime mono osx microsoft netcore app runtime osx microsoft netcore ildasm runtime linux musl arm microsoft netcore ildasm runtime linux musl arm microsoft netcore testhost runtime osx microsoft netcore dotnethost runtime osx microsoft netcore dotnetapphost runtime win arm microsoft netcore ildasm runtime win microsoft netcore dotnethost runtime win microsoft netcore dotnethostpolicy runtime win microsoft netcore dotnetapphost runtime win microsoft netcore dotnethostresolver runtime linux musl microsoft netcore ilasm assets symbols runtime osx microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux musl microsoft netcore ildasm preview symbols nupkg assets symbols runtime linux musl microsoft netcore ilasm preview symbols nupkg assets symbols runtime win arm microsoft netcore testhost preview symbols nupkg assets symbols runtime win microsoft netcore dotnethost preview symbols nupkg assets symbols system diagnostics diagnosticsource preview symbols nupkg assets symbols system diagnostics eventlog preview symbols nupkg assets symbols system diagnostics performancecounter preview symbols nupkg assets symbols system resources extensions preview symbols nupkg assets symbols system runtime caching preview symbols nupkg assets symbols system runtime compilerservices unsafe preview symbols nupkg assets symbols system security accesscontrol preview symbols nupkg assets symbols system security cryptography pkcs preview symbols nupkg microsoft netcore app runtime mono linux assets symbols runtime linux microsoft netcore dotnethost preview symbols nupkg microsoft netcore app linux microsoft extensions hosting windowsservices dotnet ilverify microsoft extensions hosting abstractions microsoft diagnostics tracing eventsource redist microsoft bcl asyncinterfaces microsoft extensions caching abstractions microsoft extensions caching memory microsoft netcore app osx microsoft extensions configuration usersecrets microsoft extensions configuration xml microsoft extensions dependencyinjection microsoft extensions dependencyinjection abstractions microsoft extensions dependencyinjection specification tests microsoft extensions hosting microsoft extensions configuration ini microsoft netcore app runtime aot osx cross maccatalyst microsoft netcore app runtime aot osx cross tvos microsoft netcore app runtime aot osx cross tvossimulator microsoft netcore app runtime aot win cross android arm microsoft netcore app runtime aot win cross android assets symbols microsoft netcore app host win preview symbols nupkg assets symbols microsoft net runtime android sample mono preview symbols nupkg assets symbols microsoft net runtime ios sample mono preview symbols nupkg assets symbols microsoft net runtime monoaotcompiler task preview symbols nupkg assets symbols microsoft net runtime runtimeconfigparser task preview symbols nupkg assets symbols microsoft net runtime wasm sample mono preview symbols nupkg assets symbols microsoft net runtime webassembly sdk preview symbols nupkg assets symbols microsoft netcore app win preview symbols nupkg assets symbols microsoft netcore app runtime osx preview symbols nupkg assets symbols microsoft netcore app runtime win preview symbols nupkg assets symbols microsoft netcore dotnetapphost preview symbols nupkg microsoft net runtime webassembly sdk microsoft net runtime monoaotcompiler task microsoft net runtime runtimeconfigparser task microsoft net sdk il microsoft net workload mono toolchain manifest microsoft netcore app linux musl arm microsoft netcore app linux musl microsoft extensions configuration microsoft extensions configuration binder microsoft extensions configuration abstractions microsoft extensions configuration commandline microsoft extensions configuration environmentvariables microsoft extensions hosting systemd microsoft extensions configuration fileextensions microsoft extensions configuration json microsoft extensions dependencymodel microsoft extensions fileproviders abstractions microsoft extensions fileproviders physical microsoft extensions fileproviders composite microsoft extensions filesystemglobbing microsoft netcore app runtime aot osx cross iossimulator assets symbols runtime linux arm runtime native system io ports preview symbols nupkg microsoft netcore app runtime aot osx cross iossimulator microsoft netcore app runtime aot osx cross maccatalyst microsoft netcore app runtime aot osx cross tvossimulator microsoft netcore app runtime aot win cross android microsoft netcore app runtime mono iossimulator microsoft netcore app runtime mono iossimulator microsoft netcore app runtime aot osx cross ios microsoft netcore app runtime linux musl arm microsoft netcore app osx microsoft netcore app win microsoft netcore app win arm microsoft netcore app host linux arm microsoft netcore app host linux microsoft netcore app runtime aot osx cross ios arm microsoft netcore app host linux musl arm microsoft netcore app host osx microsoft netcore app host win arm microsoft netcore app host win microsoft netcore app runtime aot linux cross android arm microsoft netcore app runtime aot linux cross android microsoft netcore app runtime aot osx cross android arm microsoft netcore app runtime aot osx cross android assets symbols microsoft netcore app pgo preview symbols nupkg assets symbols microsoft netcore app host win preview symbols nupkg assets symbols microsoft netcore app ref preview symbols nupkg assets symbols microsoft netcore app runtime aot linux cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross tvossimulator preview symbols nupkg assets symbols microsoft netcore app composite preview symbols nupkg assets symbols microsoft netcore app linux musl arm preview symbols nupkg assets symbols microsoft netcore browserdebughost transport preview symbols nupkg assets symbols microsoft netcore app runtime linux musl preview symbols nupkg assets symbols microsoft netcore app runtime mono android arm preview symbols nupkg assets symbols microsoft netcore app runtime mono iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm aot linux preview symbols nupkg assets symbols runtime linux microsoft netcore ilasm preview symbols nupkg assets symbols system text encodings web preview symbols nupkg assets symbols system threading accesscontrol preview symbols nupkg assets symbols system threading channels preview symbols nupkg assets symbols system threading tasks dataflow preview symbols nupkg assets symbols system windows extensions preview symbols nupkg assets symbols runtime linux microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime osx microsoft netcore ildasm preview symbols nupkg assets symbols runtime osx microsoft netcore testhost preview symbols nupkg assets symbols runtime osx runtime native system io ports preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnethost preview symbols nupkg assets symbols runtime win arm microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win arm microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux musl microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime win microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime win microsoft netcore ilasm preview symbols nupkg microsoft registry microsoft netcore testhost microsoft netcore app runtime mono llvm aot osx microsoft netcore app runtime mono llvm linux microsoft netcore app runtime mono maccatalyst microsoft netcore app runtime mono tvossimulator microsoft netcore app runtime mono osx runtime osx microsoft netcore dotnethostresolver runtime win arm microsoft netcore dotnetapphost runtime osx microsoft netcore dotnethostpolicy runtime osx microsoft netcore ilasm runtime osx microsoft netcore ildasm runtime osx microsoft netcore testhost runtime osx runtime native system io ports runtime win arm microsoft netcore dotnethost runtime win arm microsoft netcore dotnethostpolicy runtime win microsoft netcore dotnetapphost runtime win arm microsoft netcore dotnethostresolver runtime win microsoft netcore ildasm runtime win arm microsoft netcore ilasm runtime osx microsoft netcore testhost runtime win microsoft netcore ilasm runtime win microsoft netcore testhost runtime win microsoft netcore dotnethost runtime win microsoft netcore dotnethostpolicy runtime win microsoft netcore ilasm runtime win microsoft netcore ildasm runtime win microsoft netcore dotnethostresolver runtime win arm microsoft netcore testhost runtime linux musl microsoft netcore dotnetapphost runtime osx microsoft netcore ildasm runtime osx microsoft netcore dotnethostresolver runtime linux musl microsoft netcore dotnethostpolicy runtime linux musl microsoft netcore dotnethost runtime linux musl microsoft netcore dotnethostresolver runtime linux musl microsoft netcore dotnetapphost runtime linux musl microsoft netcore ildasm assets symbols microsoft netcore app runtime aot linux cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android arm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross ios preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross tvos preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android arm preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android preview symbols nupkg assets symbols microsoft netcore app linux preview symbols nupkg assets symbols microsoft netcore app osx preview symbols nupkg assets symbols microsoft netcore app linux preview symbols nupkg runtime win microsoft netcore dotnethost assets symbols microsoft netcore app runtime win arm preview symbols nupkg assets symbols microsoft netcore app runtime mono tvossimulator preview symbols nupkg assets symbols microsoft registry accesscontrol preview symbols nupkg assets symbols microsoft systemevents preview symbols nupkg assets symbols microsoft windows compatibility preview symbols nupkg assets symbols microsoft xmlserializer generator preview symbols nupkg assets symbols runtime linux arm microsoft crossosdiag private coreclr preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnethost preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux arm microsoft netcore ilasm preview symbols nupkg assets symbols microsoft netcore app runtime mono win preview symbols nupkg assets symbols runtime linux arm microsoft netcore ildasm preview symbols nupkg assets symbols microsoft netcore app runtime mono win preview symbols nupkg assets symbols microsoft netcore app runtime linux preview symbols nupkg assets symbols microsoft netcore app runtime mono android preview symbols nupkg assets symbols microsoft netcore app runtime mono ios arm preview symbols nupkg assets symbols microsoft netcore app runtime mono iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono linux arm preview symbols nupkg assets symbols microsoft netcore app runtime mono linux musl preview symbols nupkg assets symbols microsoft netcore app runtime mono maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime mono maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime mono osx preview symbols nupkg assets symbols microsoft netcore app runtime mono osx preview symbols nupkg system net http json system security principal windows system security cryptography xml system serviceprocess servicecontroller system servicemodel syndication system speech system management system io pipes accesscontrol system io pipelines system io ports runtime win microsoft netcore dotnethostresolver runtime win microsoft netcore ilasm runtime win microsoft netcore ildasm runtime win microsoft netcore testhost system codedom system composition hosting system collections immutable system directoryservices accountmanagement system componentmodel composition system componentmodel composition registration system composition system composition attributedmodel system composition convention system composition runtime assets symbols microsoft io redist preview symbols nupkg system composition typedparts system data odbc system data oledb system diagnostics diagnosticsource system diagnostics eventlog system formats system formats cbor system io filesystem accesscontrol assets symbols microsoft extensions dependencyinjection specification tests preview symbols nupkg assets symbols microsoft extensions hosting systemd preview symbols nupkg assets symbols microsoft extensions http preview symbols nupkg assets symbols microsoft extensions logging preview symbols nupkg assets symbols microsoft extensions logging abstractions preview symbols nupkg assets symbols microsoft extensions options preview symbols nupkg assets symbols microsoft extensions hosting windowsservices preview symbols nupkg microsoft netcore app runtime aot win cross browser wasm microsoft netcore app runtime linux musl microsoft netcore app runtime linux microsoft netcore app runtime mono android microsoft netcore app runtime aot linux cross android microsoft netcore app runtime aot osx cross android microsoft netcore app runtime aot linux cross browser wasm microsoft netcore app runtime aot osx cross android runtime win microsoft netcore dotnetapphost microsoft netcore app host win runtime win microsoft netcore testhost runtime win microsoft netcore dotnethostpolicy assets symbols microsoft netcore app runtime aot osx cross iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross android preview symbols nupkg assets symbols microsoft netcore app host win preview symbols nupkg assets symbols microsoft netcore app host win arm preview symbols nupkg assets symbols microsoft netcore app host osx preview symbols nupkg assets symbols microsoft netcore app linux musl preview symbols nupkg assets symbols microsoft netcore app win preview symbols nupkg assets symbols microsoft netcore app runtime linux arm preview symbols nupkg assets symbols microsoft netcore app runtime win preview symbols nupkg assets symbols microsoft netcore app runtime mono tvossimulator preview symbols nupkg assets symbols microsoft netcore app osx preview symbols nupkg assets symbols microsoft netcore app win preview symbols nupkg assets symbols microsoft netcore app host linux arm preview symbols nupkg assets symbols microsoft netcore app host linux preview symbols nupkg assets symbols microsoft netcore app host linux musl arm preview symbols nupkg assets symbols microsoft netcore app host linux musl preview symbols nupkg assets symbols microsoft netcore app host linux musl preview symbols nupkg assets symbols microsoft netcore app host linux preview symbols nupkg assets symbols microsoft netcore app host osx preview symbols nupkg assets symbols microsoft netcore app runtime osx preview symbols nupkg assets symbols runtime linux arm microsoft netcore dotnetapphost preview symbols nupkg assets symbols microsoft netcore dotnethost preview symbols nupkg assets symbols microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols microsoft netcore dotnethostresolver preview symbols nupkg assets symbols microsoft netcore ilasm preview symbols nupkg assets symbols microsoft netcore ildasm preview symbols nupkg assets symbols microsoft netcore testhost preview symbols nupkg assets symbols microsoft private corefx oob preview symbols nupkg assets symbols microsoft registry preview symbols nupkg assets symbols microsoft netcore app runtime linux musl preview symbols nupkg assets symbols microsoft netcore app runtime mono android preview symbols nupkg assets symbols microsoft netcore app runtime mono android preview symbols nupkg assets symbols microsoft netcore app runtime mono iossimulator preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm aot linux preview symbols nupkg assets symbols microsoft netcore app runtime mono tvos preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm osx preview symbols nupkg assets symbols microsoft netcore app runtime mono linux preview symbols nupkg system memory data assets symbols microsoft net hostmodel preview symbols nupkg assets symbols microsoft net hostmodel pgo preview symbols nupkg assets symbols microsoft ilverification preview symbols nupkg system reflection context system security cryptography protecteddata system reflection metadata system numerics tensors system runtime caching system reflection metadataloadcontext system resources extensions system runtime compilerservices unsafe system security permissions system security cryptography pkcs system security accesscontrol system text json system windows extensions system text encoding codepages system text encodings web system threading accesscontrol system threading tasks dataflow system threading channels system diagnostics performancecounter system directoryservices system directoryservices protocols system drawing common system io packaging system configuration configurationmanager assets symbols microsoft extensions configuration xml preview symbols nupkg assets symbols microsoft extensions dependencyinjection preview symbols nupkg assets symbols microsoft extensions dependencyinjection abstractions preview symbols nupkg assets symbols microsoft extensions dependencymodel preview symbols nupkg assets symbols microsoft extensions fileproviders abstractions preview symbols nupkg assets symbols microsoft extensions fileproviders composite preview symbols nupkg assets symbols microsoft extensions fileproviders physical preview symbols nupkg assets symbols microsoft extensions filesystemglobbing preview symbols nupkg assets symbols microsoft extensions hostfactoryresolver sources preview symbols nupkg assets symbols microsoft extensions hosting preview symbols nupkg assets symbols microsoft extensions hosting abstractions preview symbols nupkg assets symbols microsoft extensions configuration json preview symbols nupkg assets symbols microsoft extensions logging configuration preview symbols nupkg assets symbols microsoft extensions logging console preview symbols nupkg assets symbols microsoft extensions logging debug preview symbols nupkg assets symbols microsoft extensions logging eventlog preview symbols nupkg assets symbols microsoft extensions logging eventsource preview symbols nupkg assets symbols microsoft extensions logging tracesource preview symbols nupkg assets symbols microsoft extensions options configurationextensions preview symbols nupkg assets symbols microsoft extensions options dataannotations preview symbols nupkg assets symbols microsoft extensions primitives preview symbols nupkg assets symbols microsoft extensions configuration ini preview symbols nupkg assets symbols microsoft extensions configuration usersecrets preview symbols nupkg assets symbols microsoft extensions configuration environmentvariables preview symbols nupkg assets symbols microsoft extensions configuration abstractions preview symbols nupkg assets symbols microsoft bcl asyncinterfaces preview symbols nupkg assets symbols microsoft extensions caching memory preview symbols nupkg assets symbols dotnet pgo preview symbols nupkg assets symbols microsoft extensions configuration preview symbols nupkg assets symbols microsoft diagnostics tracing eventsource redist preview symbols nupkg assets symbols system text json preview symbols nupkg runtime linux musl microsoft netcore testhost runtime linux microsoft netcore dotnethostresolver runtime linux musl microsoft netcore dotnethost runtime linux musl microsoft netcore dotnethostpolicy runtime linux musl microsoft netcore dotnethostresolver runtime linux musl microsoft netcore ilasm runtime osx microsoft netcore ilasm runtime linux microsoft netcore dotnetapphost runtime linux musl microsoft netcore ildasm runtime linux microsoft netcore dotnethost runtime linux microsoft netcore dotnethostpolicy runtime linux microsoft netcore ilasm runtime linux microsoft netcore ildasm microsoft netcore app runtime mono linux musl runtime linux microsoft netcore testhost runtime osx microsoft netcore dotnetapphost runtime linux runtime native system io ports runtime native system io ports microsoft netcore app runtime mono linux microsoft netcore app runtime mono linux arm runtime osx microsoft netcore dotnethost runtime osx microsoft netcore dotnethostpolicy runtime linux musl microsoft netcore testhost microsoft extensions logging microsoft extensions logging abstractions microsoft extensions logging configuration microsoft extensions logging console microsoft ilverification microsoft net runtime android sample mono microsoft io redist microsoft net runtime wasm sample mono microsoft net runtime ios sample mono microsoft netcore app linux musl microsoft netcore app runtime aot osx cross iossimulator microsoft netcore app runtime linux microsoft netcore app runtime linux musl microsoft netcore app runtime mono android arm microsoft netcore app runtime mono android microsoft netcore app runtime mono ios arm microsoft netcore app runtime aot osx cross browser wasm assets symbols microsoft netcore app runtime aot linux cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross ios arm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross maccatalyst preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross tvossimulator preview symbols nupkg assets symbols microsoft netcore app linux musl preview symbols nupkg assets symbols microsoft netcore app runtime aot win cross browser wasm preview symbols nupkg assets symbols microsoft netcore app win arm preview symbols nupkg assets symbols microsoft netcore app runtime linux musl arm preview symbols nupkg assets symbols microsoft netcore app runtime win preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm linux preview symbols nupkg assets symbols ilcompiler reflection readytorun experimental preview symbols nupkg assets symbols system speech preview symbols nupkg assets symbols system text encoding codepages preview symbols nupkg assets symbols system serviceprocess servicecontroller preview symbols nupkg assets symbols runtime osx microsoft netcore dotnetapphost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime osx microsoft netcore ilasm preview symbols nupkg assets symbols runtime osx microsoft netcore ildasm preview symbols nupkg assets symbols runtime osx microsoft netcore testhost preview symbols nupkg assets symbols runtime osx microsoft netcore dotnethostpolicy preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore ilasm preview symbols nupkg assets symbols runtime linux musl arm microsoft netcore ildasm preview symbols nupkg assets symbols system composition typedparts preview symbols nupkg assets symbols runtime win microsoft netcore dotnethostresolver preview symbols nupkg assets symbols runtime linux microsoft netcore dotnetapphost preview symbols nupkg runtime linux arm microsoft netcore ildasm runtime linux arm microsoft netcore ilasm runtime linux microsoft netcore dotnetapphost runtime linux arm microsoft netcore testhost runtime linux arm runtime native system io ports runtime linux microsoft netcore dotnethost runtime linux microsoft netcore dotnethostresolver runtime linux microsoft netcore dotnethostpolicy runtime linux microsoft netcore ilasm microsoft netcore app runtime mono llvm aot linux runtime linux musl arm microsoft netcore dotnethostpolicy runtime linux musl arm microsoft netcore dotnethost runtime linux musl arm microsoft netcore dotnethostresolver microsoft netcore app runtime mono maccatalyst microsoft netcore app runtime mono tvossimulator microsoft netcore app runtime mono tvos microsoft netcore app runtime osx microsoft netcore app runtime mono win runtime linux musl arm microsoft netcore ilasm microsoft netcore app runtime win arm microsoft netcore app runtime win microsoft netcore app runtime win microsoft netcore app runtime win microsoft netcore app runtime mono win microsoft netcore dotnetapphost microsoft netcore dotnethost microsoft netcore dotnethostpolicy microsoft netcore dotnethostresolver microsoft netcore ilasm microsoft netcore app composite microsoft extensions logging debug microsoft extensions logging eventlog microsoft extensions logging eventsource microsoft extensions logging tracesource microsoft extensions options microsoft extensions options configurationextensions microsoft extensions options dataannotations microsoft extensions primitives microsoft extensions http microsoft netcore app linux arm microsoft netcore app runtime aot win cross android microsoft netcore app runtime linux arm microsoft netcore app runtime mono android microsoft netcore app runtime mono browser wasm microsoft netcore app runtime mono ios microsoft netcore app runtime mono iossimulator microsoft netcore app linux microsoft netcore app win microsoft netcore app win microsoft netcore app host linux musl microsoft netcore app host linux musl microsoft netcore app host linux microsoft netcore app host osx microsoft netcore app host win microsoft netcore app ref microsoft netcore app runtime aot linux cross android assets symbols microsoft netcore app runtime aot linux cross android arm preview symbols nupkg assets symbols microsoft netcore app runtime aot linux cross browser wasm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross android preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross browser wasm preview symbols nupkg assets symbols microsoft netcore app runtime aot osx cross iossimulator preview symbols nupkg assets symbols microsoft netcore app linux arm preview symbols nupkg assets symbols microsoft net sdk il preview symbols nupkg assets symbols microsoft net workload mono toolchain manifest preview symbols nupkg assets symbols microsoft netcore app runtime linux preview symbols nupkg assets symbols microsoft netcore app runtime mono ios preview symbols nupkg assets symbols microsoft netcore app runtime mono browser wasm preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm aot osx preview symbols nupkg assets symbols microsoft netcore app runtime mono linux preview symbols nupkg assets symbols microsoft netcore app runtime mono llvm linux preview symbols nupkg system net http winhttphandler assets symbols microsoft extensions configuration fileextensions preview symbols nupkg assets symbols microsoft extensions configuration commandline preview symbols nupkg assets symbols microsoft aspnetcore internal transport preview symbols nupkg assets symbols microsoft extensions configuration binder preview symbols nupkg assets symbols microsoft extensions caching abstractions preview symbols nupkg assets symbols dotnet ilverify preview symbols nupkg warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning git fetch failed with exit code back off seconds before retry warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency signing ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency source code validation warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency prep ring warning component governance detected security related alerts at or above high severity microsoft’s open source policy requires that all high and critical security vulnerabilities found by this task be addressed by upgrading vulnerable components vulnerabilities in indirect dependencies should be addressed by upgrading the root dependency changes
1
30,704
25,007,803,884
IssuesEvent
2022-11-03 13:14:18
Stellarium/stellarium
https://api.github.com/repos/Stellarium/stellarium
closed
Use smaller source distribution archive
enhancement infrastructure
Currently, Stellarium release assets include source code archives, one prepared by the release engineers and another being automatically generated tarball by GitHub. They both are `.tar.gz` files of roughly the same size. As the project had grown in recent years, I think it would make sense to use more efficient compression for hand-generated source distfile, because duplicating essentially the same tarball provided by GitHub looks redundant. Consider the following numbers: 318M stellarium-1.1.1.tar.lz (lzip -9) 369M stellarium-1.1.1.tar.bz2 (bzip2 -9) 395M stellarium-1.1.1.tar.gz (original)
1.0
Use smaller source distribution archive - Currently, Stellarium release assets include source code archives, one prepared by the release engineers and another being automatically generated tarball by GitHub. They both are `.tar.gz` files of roughly the same size. As the project had grown in recent years, I think it would make sense to use more efficient compression for hand-generated source distfile, because duplicating essentially the same tarball provided by GitHub looks redundant. Consider the following numbers: 318M stellarium-1.1.1.tar.lz (lzip -9) 369M stellarium-1.1.1.tar.bz2 (bzip2 -9) 395M stellarium-1.1.1.tar.gz (original)
infrastructure
use smaller source distribution archive currently stellarium release assets include source code archives one prepared by the release engineers and another being automatically generated tarball by github they both are tar gz files of roughly the same size as the project had grown in recent years i think it would make sense to use more efficient compression for hand generated source distfile because duplicating essentially the same tarball provided by github looks redundant consider the following numbers stellarium tar lz lzip stellarium tar stellarium tar gz original
1
101,559
31,238,020,281
IssuesEvent
2023-08-20 14:12:10
llvm/llvm-project
https://api.github.com/repos/llvm/llvm-project
closed
Compilation failure of latest main due to spelling error in llvm/lib/Target/X86/ImmutableGraph.h, fix included.
invalid backend:X86 build-problem
``` --- - 2023-08-20 13:37:48.986031881 +0200 +++ llvm/lib/Target/X86/ImmutableGraph.h 2023-08-20 13:27:04.625134423 +0200 @@ -224,7 +224,7 @@ /// Return the size of the set's domain size_type size() const { return V.size(); } /// Set union - EdgeSet &operator|=(con3t EdgeSet &RHS) { + EdgeSet &operator|=(const EdgeSet &RHS) { assert(&this->G == &RHS.G); V |= RHS.V; return *this; ```` EDIT: Can't get the code tags to work, but oh well.
1.0
Compilation failure of latest main due to spelling error in llvm/lib/Target/X86/ImmutableGraph.h, fix included. - ``` --- - 2023-08-20 13:37:48.986031881 +0200 +++ llvm/lib/Target/X86/ImmutableGraph.h 2023-08-20 13:27:04.625134423 +0200 @@ -224,7 +224,7 @@ /// Return the size of the set's domain size_type size() const { return V.size(); } /// Set union - EdgeSet &operator|=(con3t EdgeSet &RHS) { + EdgeSet &operator|=(const EdgeSet &RHS) { assert(&this->G == &RHS.G); V |= RHS.V; return *this; ```` EDIT: Can't get the code tags to work, but oh well.
non_infrastructure
compilation failure of latest main due to spelling error in llvm lib target immutablegraph h fix included llvm lib target immutablegraph h return the size of the set s domain size type size const return v size set union edgeset operator edgeset rhs edgeset operator const edgeset rhs assert this g rhs g v rhs v return this edit can t get the code tags to work but oh well
0
7,117
2,878,525,424
IssuesEvent
2015-06-10 01:51:57
ddurdle/XBMC-gdrive
https://api.github.com/repos/ddurdle/XBMC-gdrive
closed
Play from here in videos causes endless "opening stream" + error
bug in-testing
in unstable 0.6.5, Play here is not functional under video.
1.0
Play from here in videos causes endless "opening stream" + error - in unstable 0.6.5, Play here is not functional under video.
non_infrastructure
play from here in videos causes endless opening stream error in unstable play here is not functional under video
0
293,465
8,990,935,320
IssuesEvent
2019-02-01 07:31:34
webcompat/web-bugs
https://api.github.com/repos/webcompat/web-bugs
closed
eatcells.com - see bug description
browser-firefox priority-normal
<!-- @browser: Firefox 64.0 --> <!-- @ua_header: Mozilla/5.0 (X11; Linux x86_64; rv:64.0) Gecko/20100101 Firefox/64.0 --> <!-- @reported_with: desktop-reporter --> **URL**: https://eatcells.com/landing/ **Browser / Version**: Firefox 64.0 **Operating System**: Linux **Tested Another Browser**: No **Problem type**: Something else **Description**: annoying as fuck **Steps to Reproduce**: stop it rn [![Screenshot Description](https://webcompat.com/uploads/2019/1/42a51807-0da2-4239-8100-923ce3223b34-thumb.jpeg)](https://webcompat.com/uploads/2019/1/42a51807-0da2-4239-8100-923ce3223b34.jpeg) <details> <summary>Browser Configuration</summary> <ul> <li>mixed active content blocked: false</li><li>image.mem.shared: true</li><li>buildID: 20190108160530</li><li>tracking content blocked: false</li><li>gfx.webrender.blob-images: true</li><li>hasTouchScreen: false</li><li>mixed passive content blocked: false</li><li>gfx.webrender.enabled: false</li><li>gfx.webrender.all: false</li><li>channel: default</li> </ul> <p>Console Messages:</p> <pre> [u'[console.log(rb-ext-meta:INFO:, loading meta script) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2270]', u'[console.log(rb-ext-meta:INFO:, meta script loaded) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2270]', u'[console.log(rb-ext-meta:DEBUG:, MetaManager.handleRequest: recieved: {"event":"giveMetaId","data":{"metaId":"9-0","tabId":9,"frameId":0}}) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2104]', u'[console.log(rb-ext-meta-9-0:DEBUG:, MetaManager.handleRequest: prefix set) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2104]', u'[console.log(rb-ext-meta-9-0:DEBUG:, MetaManager.handleRequest: recieved: {"event":"getOgTags"}) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2104]'] </pre> </details> _From [webcompat.com](https://webcompat.com/) with ❤️_
1.0
eatcells.com - see bug description - <!-- @browser: Firefox 64.0 --> <!-- @ua_header: Mozilla/5.0 (X11; Linux x86_64; rv:64.0) Gecko/20100101 Firefox/64.0 --> <!-- @reported_with: desktop-reporter --> **URL**: https://eatcells.com/landing/ **Browser / Version**: Firefox 64.0 **Operating System**: Linux **Tested Another Browser**: No **Problem type**: Something else **Description**: annoying as fuck **Steps to Reproduce**: stop it rn [![Screenshot Description](https://webcompat.com/uploads/2019/1/42a51807-0da2-4239-8100-923ce3223b34-thumb.jpeg)](https://webcompat.com/uploads/2019/1/42a51807-0da2-4239-8100-923ce3223b34.jpeg) <details> <summary>Browser Configuration</summary> <ul> <li>mixed active content blocked: false</li><li>image.mem.shared: true</li><li>buildID: 20190108160530</li><li>tracking content blocked: false</li><li>gfx.webrender.blob-images: true</li><li>hasTouchScreen: false</li><li>mixed passive content blocked: false</li><li>gfx.webrender.enabled: false</li><li>gfx.webrender.all: false</li><li>channel: default</li> </ul> <p>Console Messages:</p> <pre> [u'[console.log(rb-ext-meta:INFO:, loading meta script) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2270]', u'[console.log(rb-ext-meta:INFO:, meta script loaded) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2270]', u'[console.log(rb-ext-meta:DEBUG:, MetaManager.handleRequest: recieved: {"event":"giveMetaId","data":{"metaId":"9-0","tabId":9,"frameId":0}}) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2104]', u'[console.log(rb-ext-meta-9-0:DEBUG:, MetaManager.handleRequest: prefix set) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2104]', u'[console.log(rb-ext-meta-9-0:DEBUG:, MetaManager.handleRequest: recieved: {"event":"getOgTags"}) moz-extension://81dde78a-ca4d-4d4e-9e48-7243a1354959/meta/meta.js:1:2104]'] </pre> </details> _From [webcompat.com](https://webcompat.com/) with ❤️_
non_infrastructure
eatcells com see bug description url browser version firefox operating system linux tested another browser no problem type something else description annoying as fuck steps to reproduce stop it rn browser configuration mixed active content blocked false image mem shared true buildid tracking content blocked false gfx webrender blob images true hastouchscreen false mixed passive content blocked false gfx webrender enabled false gfx webrender all false channel default console messages u u u u from with ❤️
0
830
2,944,565,780
IssuesEvent
2015-07-03 05:55:12
Starcounter/Starcounter
https://api.github.com/repos/Starcounter/Starcounter
closed
Database size warning on TeamCity server
Follow-up Infrastructure
I've got the following warning when opened a project settings page: >The server currently uses the internal database whose size has grown over the warning level and is already 259.56 MB. To achieve better performance and reliability, switching to a standalone database is strongly recommended.
1.0
Database size warning on TeamCity server - I've got the following warning when opened a project settings page: >The server currently uses the internal database whose size has grown over the warning level and is already 259.56 MB. To achieve better performance and reliability, switching to a standalone database is strongly recommended.
infrastructure
database size warning on teamcity server i ve got the following warning when opened a project settings page the server currently uses the internal database whose size has grown over the warning level and is already mb to achieve better performance and reliability switching to a standalone database is strongly recommended
1
2,104
3,511,726,066
IssuesEvent
2016-01-10 14:20:52
asciidoctor/asciidoctor.js
https://api.github.com/repos/asciidoctor/asciidoctor.js
closed
Publish dist files to a tag only
infrastructure
The dist files should only be published to the git repository under a tag. Other option is to push the dist files to a dedicated git repository like asciidoctor.js-dist (though, I'm leading more towards tags). Otherwise, we are constantly checking in the build output, which is unnecessary overhead. What might help to kick off this task is a link to an article about how to manage published artifacts generated by grunt so that bower / npm can still consume them.
1.0
Publish dist files to a tag only - The dist files should only be published to the git repository under a tag. Other option is to push the dist files to a dedicated git repository like asciidoctor.js-dist (though, I'm leading more towards tags). Otherwise, we are constantly checking in the build output, which is unnecessary overhead. What might help to kick off this task is a link to an article about how to manage published artifacts generated by grunt so that bower / npm can still consume them.
infrastructure
publish dist files to a tag only the dist files should only be published to the git repository under a tag other option is to push the dist files to a dedicated git repository like asciidoctor js dist though i m leading more towards tags otherwise we are constantly checking in the build output which is unnecessary overhead what might help to kick off this task is a link to an article about how to manage published artifacts generated by grunt so that bower npm can still consume them
1
153,550
13,509,431,059
IssuesEvent
2020-09-14 09:11:43
apt-sim/AdePT
https://api.github.com/repos/apt-sim/AdePT
closed
Add contribution guide
documentation
We should add a contribution guide for the project that explains how to help (and that covers everything, from just raising an issue, to fixing documentation all the way to writing super-charged GPU code). There are a few examples of ones that were done for recent HSF projects: - prmon: <https://github.com/HSF/prmon/blob/master/doc/CONTRIBUTING.md> - acts: <https://github.com/acts-project/acts/blob/master/CONTRIBUTING.md> - phoenix: <https://github.com/HSF/phoenix/blob/master/CONTRIBUTING.md>
1.0
Add contribution guide - We should add a contribution guide for the project that explains how to help (and that covers everything, from just raising an issue, to fixing documentation all the way to writing super-charged GPU code). There are a few examples of ones that were done for recent HSF projects: - prmon: <https://github.com/HSF/prmon/blob/master/doc/CONTRIBUTING.md> - acts: <https://github.com/acts-project/acts/blob/master/CONTRIBUTING.md> - phoenix: <https://github.com/HSF/phoenix/blob/master/CONTRIBUTING.md>
non_infrastructure
add contribution guide we should add a contribution guide for the project that explains how to help and that covers everything from just raising an issue to fixing documentation all the way to writing super charged gpu code there are a few examples of ones that were done for recent hsf projects prmon acts phoenix
0
35,538
31,804,229,943
IssuesEvent
2023-09-13 13:03:37
dart-lang/sdk
https://api.github.com/repos/dart-lang/sdk
closed
Track AOT snapshot size of Flutter apps in Golem
area-infrastructure customer-flutter customer-vm
We need to track size of code (instructions) and size of AOT snapshot of Flutter applications for every Dart SDK revision, in order to catch regressions like https://github.com/dart-lang/sdk/issues/32458 and https://github.com/dart-lang/sdk/issues/32718 early, before changes are rolled into Flutter. Flutter dashboard tracks these metrics for basic_material_app, complex_layout and flutter_gallery. /cc @sortie @athomas @mkustermann @mraleph
1.0
Track AOT snapshot size of Flutter apps in Golem - We need to track size of code (instructions) and size of AOT snapshot of Flutter applications for every Dart SDK revision, in order to catch regressions like https://github.com/dart-lang/sdk/issues/32458 and https://github.com/dart-lang/sdk/issues/32718 early, before changes are rolled into Flutter. Flutter dashboard tracks these metrics for basic_material_app, complex_layout and flutter_gallery. /cc @sortie @athomas @mkustermann @mraleph
infrastructure
track aot snapshot size of flutter apps in golem we need to track size of code instructions and size of aot snapshot of flutter applications for every dart sdk revision in order to catch regressions like and early before changes are rolled into flutter flutter dashboard tracks these metrics for basic material app complex layout and flutter gallery cc sortie athomas mkustermann mraleph
1
258,777
22,346,257,632
IssuesEvent
2022-06-15 08:05:37
mozilla-mobile/fenix
https://api.github.com/repos/mozilla-mobile/fenix
closed
Intermittent UI test failure - < PwaTest. telephoneLinkPWATest >
eng:intermittent-test eng:ui-test
### Firebase Test Run: [Firebase link](https://console.firebase.google.com/u/0/project/moz-fenix/testlab/histories/bh.66b7091e15d53d45/matrices/7657678413751016716/executions/bs.d8aa1119afe452bf/testcases/1/test-cases) ### Stacktrace: androidx.test.uiautomator.UiObjectNotFoundException: UiSelector[CONTAINS_TEXT=Telephone link] at androidx.test.uiautomator.UiObject.click(UiObject.java:416) at org.mozilla.fenix.ui.robots.BrowserRobot.clickLinkMatchingText(BrowserRobot.kt:318) at org.mozilla.fenix.ui.PwaTest$telephoneLinkPWATest$5.invoke(PwaTest.kt:82) at org.mozilla.fenix.ui.PwaTest$telephoneLinkPWATest$5.invoke(PwaTest.kt:81) at org.mozilla.fenix.ui.robots.AddToHomeScreenRobot$Transition.openHomeScreenShortcut(AddToHomeScreenRobot.kt:73) at org.mozilla.fenix.ui.PwaTest.telephoneLinkPWATest(PwaTest.kt:81) ### Build: 5/3 ┆Issue is synchronized with this [Jira Task](https://mozilla-hub.atlassian.net/browse/FNXV2-20352)
2.0
Intermittent UI test failure - < PwaTest. telephoneLinkPWATest > - ### Firebase Test Run: [Firebase link](https://console.firebase.google.com/u/0/project/moz-fenix/testlab/histories/bh.66b7091e15d53d45/matrices/7657678413751016716/executions/bs.d8aa1119afe452bf/testcases/1/test-cases) ### Stacktrace: androidx.test.uiautomator.UiObjectNotFoundException: UiSelector[CONTAINS_TEXT=Telephone link] at androidx.test.uiautomator.UiObject.click(UiObject.java:416) at org.mozilla.fenix.ui.robots.BrowserRobot.clickLinkMatchingText(BrowserRobot.kt:318) at org.mozilla.fenix.ui.PwaTest$telephoneLinkPWATest$5.invoke(PwaTest.kt:82) at org.mozilla.fenix.ui.PwaTest$telephoneLinkPWATest$5.invoke(PwaTest.kt:81) at org.mozilla.fenix.ui.robots.AddToHomeScreenRobot$Transition.openHomeScreenShortcut(AddToHomeScreenRobot.kt:73) at org.mozilla.fenix.ui.PwaTest.telephoneLinkPWATest(PwaTest.kt:81) ### Build: 5/3 ┆Issue is synchronized with this [Jira Task](https://mozilla-hub.atlassian.net/browse/FNXV2-20352)
non_infrastructure
intermittent ui test failure firebase test run stacktrace androidx test uiautomator uiobjectnotfoundexception uiselector at androidx test uiautomator uiobject click uiobject java at org mozilla fenix ui robots browserrobot clicklinkmatchingtext browserrobot kt at org mozilla fenix ui pwatest telephonelinkpwatest invoke pwatest kt at org mozilla fenix ui pwatest telephonelinkpwatest invoke pwatest kt at org mozilla fenix ui robots addtohomescreenrobot transition openhomescreenshortcut addtohomescreenrobot kt at org mozilla fenix ui pwatest telephonelinkpwatest pwatest kt build ┆issue is synchronized with this
0
23,534
16,383,557,082
IssuesEvent
2021-05-17 07:36:45
konstellation-io/kdl-server
https://api.github.com/repos/konstellation-io/kdl-server
closed
Create admin user in the database
infrastructure
Right now, the admin user is created only in Gitea. In order to work with this user properly, we should create this user in the mongodb database.
1.0
Create admin user in the database - Right now, the admin user is created only in Gitea. In order to work with this user properly, we should create this user in the mongodb database.
infrastructure
create admin user in the database right now the admin user is created only in gitea in order to work with this user properly we should create this user in the mongodb database
1
320,498
9,781,706,847
IssuesEvent
2019-06-07 20:37:09
forseti-security/forseti-security
https://api.github.com/repos/forseti-security/forseti-security
closed
Better home for run_forseti.sh
issue-review: future-milestone module: installer priority: p2 triaged: yes
This is not doing any setup, but is currently installed under the `setup` folder on the server VM. So, it would be awesome to move it to a better location. ``` /home/ubuntu/forseti-security/setup/gcp/scripts/run_forseti.sh ```
1.0
Better home for run_forseti.sh - This is not doing any setup, but is currently installed under the `setup` folder on the server VM. So, it would be awesome to move it to a better location. ``` /home/ubuntu/forseti-security/setup/gcp/scripts/run_forseti.sh ```
non_infrastructure
better home for run forseti sh this is not doing any setup but is currently installed under the setup folder on the server vm so it would be awesome to move it to a better location home ubuntu forseti security setup gcp scripts run forseti sh
0
33,718
27,749,636,001
IssuesEvent
2023-03-15 19:39:01
subconsciousnetwork/noosphere
https://api.github.com/repos/subconsciousnetwork/noosphere
opened
Distributable artifacts in package managers
Topic: Infrastructure Topic: Discussion
Based on [discussion from November on end-user packaging in the Discord](https://discord.com/channels/1003419732516552724/1038047662030721096), and [packaging Rust for package managers](https://lwn.net/Articles/912202/), we should evaluate what it'd look like to vend to e.g. aptitude/homebrew. We have a few [platform dependencies](https://github.com/subconsciousnetwork/noosphere/tree/main/rust#platform-packages), TBD on the challenges of hooking into different package managers for these as opposed to bringing out own static libs in the mean time.
1.0
Distributable artifacts in package managers - Based on [discussion from November on end-user packaging in the Discord](https://discord.com/channels/1003419732516552724/1038047662030721096), and [packaging Rust for package managers](https://lwn.net/Articles/912202/), we should evaluate what it'd look like to vend to e.g. aptitude/homebrew. We have a few [platform dependencies](https://github.com/subconsciousnetwork/noosphere/tree/main/rust#platform-packages), TBD on the challenges of hooking into different package managers for these as opposed to bringing out own static libs in the mean time.
infrastructure
distributable artifacts in package managers based on and we should evaluate what it d look like to vend to e g aptitude homebrew we have a few tbd on the challenges of hooking into different package managers for these as opposed to bringing out own static libs in the mean time
1
108,755
4,350,024,567
IssuesEvent
2016-07-31 00:07:26
peq/WurstScript
https://api.github.com/repos/peq/WurstScript
closed
Idea: Add Standardlib to Eclipseplugin
enhancement Priority: normal unclear/discussion
It's kind of a hassle to download the Wurstpack separately and it is one of the last barriers to make WurstScript independent from the Editor. One idea would be to have an automatically imported project when entering the Wurst Nature. Not sure to what extent this is possible @peq so discuss!
1.0
Idea: Add Standardlib to Eclipseplugin - It's kind of a hassle to download the Wurstpack separately and it is one of the last barriers to make WurstScript independent from the Editor. One idea would be to have an automatically imported project when entering the Wurst Nature. Not sure to what extent this is possible @peq so discuss!
non_infrastructure
idea add standardlib to eclipseplugin it s kind of a hassle to download the wurstpack separately and it is one of the last barriers to make wurstscript independent from the editor one idea would be to have an automatically imported project when entering the wurst nature not sure to what extent this is possible peq so discuss
0
176,005
21,365,653,143
IssuesEvent
2022-04-20 01:06:13
tidharm/ksa
https://api.github.com/repos/tidharm/ksa
closed
CVE-2021-44907 (High) detected in qs-0.4.2.tgz - autoclosed
security vulnerability
## CVE-2021-44907 - High Severity Vulnerability <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>qs-0.4.2.tgz</b></p></summary> <p>querystring parser</p> <p>Library home page: <a href="https://registry.npmjs.org/qs/-/qs-0.4.2.tgz">https://registry.npmjs.org/qs/-/qs-0.4.2.tgz</a></p> <p>Path to dependency file: /ksa-web-root/ksa-web/src/main/webapp/rs/bootstrap/package.json</p> <p>Path to vulnerable library: /ksa-web-root/ksa-web/src/main/webapp/rs/bootstrap/node_modules/qs/package.json</p> <p> Dependency Hierarchy: - connect-2.1.3.tgz (Root Library) - :x: **qs-0.4.2.tgz** (Vulnerable Library) <p>Found in base branch: <b>master</b></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> Vulnerability Details</summary> <p> A Denial of Service vulnerability exists in qs up to 6.8.0 due to insufficient sanitization of property in the gs.parse function. The merge() function allows the assignment of properties on an array in the query. For any property being assigned, a value in the array is converted to an object containing these properties. Essentially, this means that the property whose expected type is Array always has to be checked with Array.isArray() by the user. This may not be obvious to the user and can cause unexpected behavior. <p>Publish Date: 2022-03-17 <p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-44907>CVE-2021-44907</a></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>7.5</b>)</summary> <p> Base Score Metrics: - Exploitability Metrics: - Attack Vector: Network - Attack Complexity: Low - Privileges Required: None - User Interaction: None - Scope: Unchanged - Impact Metrics: - Confidentiality Impact: None - Integrity Impact: None - Availability Impact: High </p> For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>. </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary> <p> <p>Type: Upgrade version</p> <p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-44907">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-44907</a></p> <p>Release Date: 2022-03-17</p> <p>Fix Resolution (qs): 6.8.1</p> <p>Direct dependency fix Resolution (connect): 3.0.0-rc.1</p> </p> </details> <p></p> *** :rescue_worker_helmet: Automatic Remediation is available for this issue <!-- <REMEDIATE>{"isOpenPROnVulnerability":true,"isPackageBased":true,"isDefaultBranch":true,"packages":[{"packageType":"javascript/Node.js","packageName":"connect","packageVersion":"2.1.3","packageFilePaths":["/ksa-web-root/ksa-web/src/main/webapp/rs/bootstrap/package.json"],"isTransitiveDependency":false,"dependencyTree":"connect:2.1.3","isMinimumFixVersionAvailable":true,"minimumFixVersion":"3.0.0-rc.1","isBinary":false}],"baseBranches":["master"],"vulnerabilityIdentifier":"CVE-2021-44907","vulnerabilityDetails":"A Denial of Service vulnerability exists in qs up to 6.8.0 due to insufficient sanitization of property in the gs.parse function. The merge() function allows the assignment of properties on an array in the query. For any property being assigned, a value in the array is converted to an object containing these properties. Essentially, this means that the property whose expected type is Array always has to be checked with Array.isArray() by the user. This may not be obvious to the user and can cause unexpected behavior.","vulnerabilityUrl":"https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-44907","cvss3Severity":"high","cvss3Score":"7.5","cvss3Metrics":{"A":"High","AC":"Low","PR":"None","S":"Unchanged","C":"None","UI":"None","AV":"Network","I":"None"},"extraData":{}}</REMEDIATE> -->
True
CVE-2021-44907 (High) detected in qs-0.4.2.tgz - autoclosed - ## CVE-2021-44907 - High Severity Vulnerability <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/vulnerability_details.png' width=19 height=20> Vulnerable Library - <b>qs-0.4.2.tgz</b></p></summary> <p>querystring parser</p> <p>Library home page: <a href="https://registry.npmjs.org/qs/-/qs-0.4.2.tgz">https://registry.npmjs.org/qs/-/qs-0.4.2.tgz</a></p> <p>Path to dependency file: /ksa-web-root/ksa-web/src/main/webapp/rs/bootstrap/package.json</p> <p>Path to vulnerable library: /ksa-web-root/ksa-web/src/main/webapp/rs/bootstrap/node_modules/qs/package.json</p> <p> Dependency Hierarchy: - connect-2.1.3.tgz (Root Library) - :x: **qs-0.4.2.tgz** (Vulnerable Library) <p>Found in base branch: <b>master</b></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/high_vul.png' width=19 height=20> Vulnerability Details</summary> <p> A Denial of Service vulnerability exists in qs up to 6.8.0 due to insufficient sanitization of property in the gs.parse function. The merge() function allows the assignment of properties on an array in the query. For any property being assigned, a value in the array is converted to an object containing these properties. Essentially, this means that the property whose expected type is Array always has to be checked with Array.isArray() by the user. This may not be obvious to the user and can cause unexpected behavior. <p>Publish Date: 2022-03-17 <p>URL: <a href=https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-44907>CVE-2021-44907</a></p> </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/cvss3.png' width=19 height=20> CVSS 3 Score Details (<b>7.5</b>)</summary> <p> Base Score Metrics: - Exploitability Metrics: - Attack Vector: Network - Attack Complexity: Low - Privileges Required: None - User Interaction: None - Scope: Unchanged - Impact Metrics: - Confidentiality Impact: None - Integrity Impact: None - Availability Impact: High </p> For more information on CVSS3 Scores, click <a href="https://www.first.org/cvss/calculator/3.0">here</a>. </p> </details> <p></p> <details><summary><img src='https://whitesource-resources.whitesourcesoftware.com/suggested_fix.png' width=19 height=20> Suggested Fix</summary> <p> <p>Type: Upgrade version</p> <p>Origin: <a href="https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-44907">https://cve.mitre.org/cgi-bin/cvename.cgi?name=CVE-2021-44907</a></p> <p>Release Date: 2022-03-17</p> <p>Fix Resolution (qs): 6.8.1</p> <p>Direct dependency fix Resolution (connect): 3.0.0-rc.1</p> </p> </details> <p></p> *** :rescue_worker_helmet: Automatic Remediation is available for this issue <!-- <REMEDIATE>{"isOpenPROnVulnerability":true,"isPackageBased":true,"isDefaultBranch":true,"packages":[{"packageType":"javascript/Node.js","packageName":"connect","packageVersion":"2.1.3","packageFilePaths":["/ksa-web-root/ksa-web/src/main/webapp/rs/bootstrap/package.json"],"isTransitiveDependency":false,"dependencyTree":"connect:2.1.3","isMinimumFixVersionAvailable":true,"minimumFixVersion":"3.0.0-rc.1","isBinary":false}],"baseBranches":["master"],"vulnerabilityIdentifier":"CVE-2021-44907","vulnerabilityDetails":"A Denial of Service vulnerability exists in qs up to 6.8.0 due to insufficient sanitization of property in the gs.parse function. The merge() function allows the assignment of properties on an array in the query. For any property being assigned, a value in the array is converted to an object containing these properties. Essentially, this means that the property whose expected type is Array always has to be checked with Array.isArray() by the user. This may not be obvious to the user and can cause unexpected behavior.","vulnerabilityUrl":"https://vuln.whitesourcesoftware.com/vulnerability/CVE-2021-44907","cvss3Severity":"high","cvss3Score":"7.5","cvss3Metrics":{"A":"High","AC":"Low","PR":"None","S":"Unchanged","C":"None","UI":"None","AV":"Network","I":"None"},"extraData":{}}</REMEDIATE> -->
non_infrastructure
cve high detected in qs tgz autoclosed cve high severity vulnerability vulnerable library qs tgz querystring parser library home page a href path to dependency file ksa web root ksa web src main webapp rs bootstrap package json path to vulnerable library ksa web root ksa web src main webapp rs bootstrap node modules qs package json dependency hierarchy connect tgz root library x qs tgz vulnerable library found in base branch master vulnerability details a denial of service vulnerability exists in qs up to due to insufficient sanitization of property in the gs parse function the merge function allows the assignment of properties on an array in the query for any property being assigned a value in the array is converted to an object containing these properties essentially this means that the property whose expected type is array always has to be checked with array isarray by the user this may not be obvious to the user and can cause unexpected behavior publish date url a href cvss score details base score metrics exploitability metrics attack vector network attack complexity low privileges required none user interaction none scope unchanged impact metrics confidentiality impact none integrity impact none availability impact high for more information on scores click a href suggested fix type upgrade version origin a href release date fix resolution qs direct dependency fix resolution connect rc rescue worker helmet automatic remediation is available for this issue isopenpronvulnerability true ispackagebased true isdefaultbranch true packages istransitivedependency false dependencytree connect isminimumfixversionavailable true minimumfixversion rc isbinary false basebranches vulnerabilityidentifier cve vulnerabilitydetails a denial of service vulnerability exists in qs up to due to insufficient sanitization of property in the gs parse function the merge function allows the assignment of properties on an array in the query for any property being assigned a value in the array is converted to an object containing these properties essentially this means that the property whose expected type is array always has to be checked with array isarray by the user this may not be obvious to the user and can cause unexpected behavior vulnerabilityurl
0
30,294
24,739,193,523
IssuesEvent
2022-10-21 02:31:59
neulab/explainaboard_web
https://api.github.com/repos/neulab/explainaboard_web
closed
privacy concerns associated with user emails
high-priority ui infrastructure
The new user management system is *awesome*, thank you @lyuyangh! One concern is that showing the full email as a display name for public submissions is probably a privacy problem. Maybe we should require people to have a display name too?
1.0
privacy concerns associated with user emails - The new user management system is *awesome*, thank you @lyuyangh! One concern is that showing the full email as a display name for public submissions is probably a privacy problem. Maybe we should require people to have a display name too?
infrastructure
privacy concerns associated with user emails the new user management system is awesome thank you lyuyangh one concern is that showing the full email as a display name for public submissions is probably a privacy problem maybe we should require people to have a display name too
1
23,082
15,806,440,643
IssuesEvent
2021-04-04 05:15:27
infinyon/fluvio
https://api.github.com/repos/infinyon/fluvio
opened
Run benchmark tests every hour
CI Performance Test Infrastructure enhancement good first issue
With #879 complete, we should be able to run some form of benchmark tests in CI, so we can begin to collect basic information about the performance of Fluvio. We can start with running `producer_stress` with a local and k8 cluster.
1.0
Run benchmark tests every hour - With #879 complete, we should be able to run some form of benchmark tests in CI, so we can begin to collect basic information about the performance of Fluvio. We can start with running `producer_stress` with a local and k8 cluster.
infrastructure
run benchmark tests every hour with complete we should be able to run some form of benchmark tests in ci so we can begin to collect basic information about the performance of fluvio we can start with running producer stress with a local and cluster
1