Instruction
stringlengths
45
106
input_code
stringlengths
1
13.7k
output_code
stringlengths
1
13.7k
Keep all operations the same but rewrite the snippet in C++.
package main import ( "fmt" "math" "rcu" "time" ) var count []int func primeCounter(limit int) { count = make([]int, limit) for i := 0; i < limit; i++ { count[i] = 1 } if limit > 0 { count[0] = 0 } if limit > 1 { count[1] = 0 } for i := 4; i < limit; i += 2 { count[i] = 0 } for p, sq := 3, 9; sq < limit; p += 2 { if count[p] != 0 { for q := sq; q < limit; q += p << 1 { count[q] = 0 } } sq += (p + 1) << 2 } sum := 0 for i := 0; i < limit; i++ { sum += count[i] count[i] = sum } } func primeCount(n int) int { if n < 1 { return 0 } return count[n] } func ramanujanMax(n int) int { fn := float64(n) return int(math.Ceil(4 * fn * math.Log(4*fn))) } func ramanujanPrime(n int) int { if n == 1 { return 2 } for i := ramanujanMax(n); i >= 2*n; i-- { if i%2 == 1 { continue } if primeCount(i)-primeCount(i/2) < n { return i + 1 } } return 0 } func main() { start := time.Now() primeCounter(1 + ramanujanMax(1e6)) fmt.Println("The first 100 Ramanujan primes are:") rams := make([]int, 100) for n := 0; n < 100; n++ { rams[n] = ramanujanPrime(n + 1) } for i, r := range rams { fmt.Printf("%5s ", rcu.Commatize(r)) if (i+1)%10 == 0 { fmt.Println() } } fmt.Printf("\nThe 1,000th Ramanujan prime is %6s\n", rcu.Commatize(ramanujanPrime(1000))) fmt.Printf("\nThe 10,000th Ramanujan prime is %7s\n", rcu.Commatize(ramanujanPrime(10000))) fmt.Printf("\nThe 100,000th Ramanujan prime is %6s\n", rcu.Commatize(ramanujanPrime(100000))) fmt.Printf("\nThe 1,000,000th Ramanujan prime is %7s\n", rcu.Commatize(ramanujanPrime(1000000))) fmt.Println("\nTook", time.Since(start)) }
#include <chrono> #include <cmath> #include <iomanip> #include <iostream> #include <numeric> #include <vector> class prime_counter { public: explicit prime_counter(int limit); int prime_count(int n) const { return n < 1 ? 0 : count_.at(n); } private: std::vector<int> count_; }; prime_counter::prime_counter(int limit) : count_(limit, 1) { if (limit > 0) count_[0] = 0; if (limit > 1) count_[1] = 0; for (int i = 4; i < limit; i += 2) count_[i] = 0; for (int p = 3, sq = 9; sq < limit; p += 2) { if (count_[p]) { for (int q = sq; q < limit; q += p << 1) count_[q] = 0; } sq += (p + 1) << 2; } std::partial_sum(count_.begin(), count_.end(), count_.begin()); } int ramanujan_max(int n) { return static_cast<int>(std::ceil(4 * n * std::log(4 * n))); } int ramanujan_prime(const prime_counter& pc, int n) { int max = ramanujan_max(n); for (int i = max; i >= 0; --i) { if (pc.prime_count(i) - pc.prime_count(i / 2) < n) return i + 1; } return 0; } int main() { std::cout.imbue(std::locale("")); auto start = std::chrono::high_resolution_clock::now(); prime_counter pc(1 + ramanujan_max(100000)); for (int i = 1; i <= 100; ++i) { std::cout << std::setw(5) << ramanujan_prime(pc, i) << (i % 10 == 0 ? '\n' : ' '); } std::cout << '\n'; for (int n = 1000; n <= 100000; n *= 10) { std::cout << "The " << n << "th Ramanujan prime is " << ramanujan_prime(pc, n) << ".\n"; } auto end = std::chrono::high_resolution_clock::now(); std::cout << "\nElapsed time: " << std::chrono::duration<double>(end - start).count() * 1000 << " milliseconds\n"; }
Write a version of this Go function in C++ with identical behavior.
package main import ( "fmt" "math" "rcu" "time" ) var count []int func primeCounter(limit int) { count = make([]int, limit) for i := 0; i < limit; i++ { count[i] = 1 } if limit > 0 { count[0] = 0 } if limit > 1 { count[1] = 0 } for i := 4; i < limit; i += 2 { count[i] = 0 } for p, sq := 3, 9; sq < limit; p += 2 { if count[p] != 0 { for q := sq; q < limit; q += p << 1 { count[q] = 0 } } sq += (p + 1) << 2 } sum := 0 for i := 0; i < limit; i++ { sum += count[i] count[i] = sum } } func primeCount(n int) int { if n < 1 { return 0 } return count[n] } func ramanujanMax(n int) int { fn := float64(n) return int(math.Ceil(4 * fn * math.Log(4*fn))) } func ramanujanPrime(n int) int { if n == 1 { return 2 } for i := ramanujanMax(n); i >= 2*n; i-- { if i%2 == 1 { continue } if primeCount(i)-primeCount(i/2) < n { return i + 1 } } return 0 } func main() { start := time.Now() primeCounter(1 + ramanujanMax(1e6)) fmt.Println("The first 100 Ramanujan primes are:") rams := make([]int, 100) for n := 0; n < 100; n++ { rams[n] = ramanujanPrime(n + 1) } for i, r := range rams { fmt.Printf("%5s ", rcu.Commatize(r)) if (i+1)%10 == 0 { fmt.Println() } } fmt.Printf("\nThe 1,000th Ramanujan prime is %6s\n", rcu.Commatize(ramanujanPrime(1000))) fmt.Printf("\nThe 10,000th Ramanujan prime is %7s\n", rcu.Commatize(ramanujanPrime(10000))) fmt.Printf("\nThe 100,000th Ramanujan prime is %6s\n", rcu.Commatize(ramanujanPrime(100000))) fmt.Printf("\nThe 1,000,000th Ramanujan prime is %7s\n", rcu.Commatize(ramanujanPrime(1000000))) fmt.Println("\nTook", time.Since(start)) }
#include <chrono> #include <cmath> #include <iomanip> #include <iostream> #include <numeric> #include <vector> class prime_counter { public: explicit prime_counter(int limit); int prime_count(int n) const { return n < 1 ? 0 : count_.at(n); } private: std::vector<int> count_; }; prime_counter::prime_counter(int limit) : count_(limit, 1) { if (limit > 0) count_[0] = 0; if (limit > 1) count_[1] = 0; for (int i = 4; i < limit; i += 2) count_[i] = 0; for (int p = 3, sq = 9; sq < limit; p += 2) { if (count_[p]) { for (int q = sq; q < limit; q += p << 1) count_[q] = 0; } sq += (p + 1) << 2; } std::partial_sum(count_.begin(), count_.end(), count_.begin()); } int ramanujan_max(int n) { return static_cast<int>(std::ceil(4 * n * std::log(4 * n))); } int ramanujan_prime(const prime_counter& pc, int n) { int max = ramanujan_max(n); for (int i = max; i >= 0; --i) { if (pc.prime_count(i) - pc.prime_count(i / 2) < n) return i + 1; } return 0; } int main() { std::cout.imbue(std::locale("")); auto start = std::chrono::high_resolution_clock::now(); prime_counter pc(1 + ramanujan_max(100000)); for (int i = 1; i <= 100; ++i) { std::cout << std::setw(5) << ramanujan_prime(pc, i) << (i % 10 == 0 ? '\n' : ' '); } std::cout << '\n'; for (int n = 1000; n <= 100000; n *= 10) { std::cout << "The " << n << "th Ramanujan prime is " << ramanujan_prime(pc, n) << ".\n"; } auto end = std::chrono::high_resolution_clock::now(); std::cout << "\nElapsed time: " << std::chrono::duration<double>(end - start).count() * 1000 << " milliseconds\n"; }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "fmt" "math" "rcu" "time" ) var count []int func primeCounter(limit int) { count = make([]int, limit) for i := 0; i < limit; i++ { count[i] = 1 } if limit > 0 { count[0] = 0 } if limit > 1 { count[1] = 0 } for i := 4; i < limit; i += 2 { count[i] = 0 } for p, sq := 3, 9; sq < limit; p += 2 { if count[p] != 0 { for q := sq; q < limit; q += p << 1 { count[q] = 0 } } sq += (p + 1) << 2 } sum := 0 for i := 0; i < limit; i++ { sum += count[i] count[i] = sum } } func primeCount(n int) int { if n < 1 { return 0 } return count[n] } func ramanujanMax(n int) int { fn := float64(n) return int(math.Ceil(4 * fn * math.Log(4*fn))) } func ramanujanPrime(n int) int { if n == 1 { return 2 } for i := ramanujanMax(n); i >= 2*n; i-- { if i%2 == 1 { continue } if primeCount(i)-primeCount(i/2) < n { return i + 1 } } return 0 } func main() { start := time.Now() primeCounter(1 + ramanujanMax(1e6)) fmt.Println("The first 100 Ramanujan primes are:") rams := make([]int, 100) for n := 0; n < 100; n++ { rams[n] = ramanujanPrime(n + 1) } for i, r := range rams { fmt.Printf("%5s ", rcu.Commatize(r)) if (i+1)%10 == 0 { fmt.Println() } } fmt.Printf("\nThe 1,000th Ramanujan prime is %6s\n", rcu.Commatize(ramanujanPrime(1000))) fmt.Printf("\nThe 10,000th Ramanujan prime is %7s\n", rcu.Commatize(ramanujanPrime(10000))) fmt.Printf("\nThe 100,000th Ramanujan prime is %6s\n", rcu.Commatize(ramanujanPrime(100000))) fmt.Printf("\nThe 1,000,000th Ramanujan prime is %7s\n", rcu.Commatize(ramanujanPrime(1000000))) fmt.Println("\nTook", time.Since(start)) }
#include <chrono> #include <cmath> #include <iomanip> #include <iostream> #include <numeric> #include <vector> class prime_counter { public: explicit prime_counter(int limit); int prime_count(int n) const { return n < 1 ? 0 : count_.at(n); } private: std::vector<int> count_; }; prime_counter::prime_counter(int limit) : count_(limit, 1) { if (limit > 0) count_[0] = 0; if (limit > 1) count_[1] = 0; for (int i = 4; i < limit; i += 2) count_[i] = 0; for (int p = 3, sq = 9; sq < limit; p += 2) { if (count_[p]) { for (int q = sq; q < limit; q += p << 1) count_[q] = 0; } sq += (p + 1) << 2; } std::partial_sum(count_.begin(), count_.end(), count_.begin()); } int ramanujan_max(int n) { return static_cast<int>(std::ceil(4 * n * std::log(4 * n))); } int ramanujan_prime(const prime_counter& pc, int n) { int max = ramanujan_max(n); for (int i = max; i >= 0; --i) { if (pc.prime_count(i) - pc.prime_count(i / 2) < n) return i + 1; } return 0; } int main() { std::cout.imbue(std::locale("")); auto start = std::chrono::high_resolution_clock::now(); prime_counter pc(1 + ramanujan_max(100000)); for (int i = 1; i <= 100; ++i) { std::cout << std::setw(5) << ramanujan_prime(pc, i) << (i % 10 == 0 ? '\n' : ' '); } std::cout << '\n'; for (int n = 1000; n <= 100000; n *= 10) { std::cout << "The " << n << "th Ramanujan prime is " << ramanujan_prime(pc, n) << ".\n"; } auto end = std::chrono::high_resolution_clock::now(); std::cout << "\nElapsed time: " << std::chrono::duration<double>(end - start).count() * 1000 << " milliseconds\n"; }
Produce a language-to-language conversion: from Go to C++, same semantics.
package main import ( "fmt" "math" "sort" ) func totient(n int) int { tot := n i := 2 for i*i <= n { if n%i == 0 { for n%i == 0 { n /= i } tot -= tot / i } if i == 2 { i = 1 } i += 2 } if n > 1 { tot -= tot / n } return tot } var pps = make(map[int]bool) func getPerfectPowers(maxExp int) { upper := math.Pow(10, float64(maxExp)) for i := 2; i <= int(math.Sqrt(upper)); i++ { fi := float64(i) p := fi for { p *= fi if p >= upper { break } pps[int(p)] = true } } } func getAchilles(minExp, maxExp int) map[int]bool { lower := math.Pow(10, float64(minExp)) upper := math.Pow(10, float64(maxExp)) achilles := make(map[int]bool) for b := 1; b <= int(math.Cbrt(upper)); b++ { b3 := b * b * b for a := 1; a <= int(math.Sqrt(upper)); a++ { p := b3 * a * a if p >= int(upper) { break } if p >= int(lower) { if _, ok := pps[p]; !ok { achilles[p] = true } } } } return achilles } func main() { maxDigits := 15 getPerfectPowers(maxDigits) achillesSet := getAchilles(1, 5) achilles := make([]int, len(achillesSet)) i := 0 for k := range achillesSet { achilles[i] = k i++ } sort.Ints(achilles) fmt.Println("First 50 Achilles numbers:") for i = 0; i < 50; i++ { fmt.Printf("%4d ", achilles[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Println("\nFirst 30 strong Achilles numbers:") var strongAchilles []int count := 0 for n := 0; count < 30; n++ { tot := totient(achilles[n]) if _, ok := achillesSet[tot]; ok { strongAchilles = append(strongAchilles, achilles[n]) count++ } } for i = 0; i < 30; i++ { fmt.Printf("%5d ", strongAchilles[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Println("\nNumber of Achilles numbers with:") for d := 2; d <= maxDigits; d++ { ac := len(getAchilles(d-1, d)) fmt.Printf("%2d digits: %d\n", d, ac) } }
#include <algorithm> #include <chrono> #include <cmath> #include <cstdint> #include <iomanip> #include <iostream> #include <vector> #include <boost/multiprecision/cpp_int.hpp> using boost::multiprecision::uint128_t; template <typename T> void unique_sort(std::vector<T>& vector) { std::sort(vector.begin(), vector.end()); vector.erase(std::unique(vector.begin(), vector.end()), vector.end()); } auto perfect_powers(uint128_t n) { std::vector<uint128_t> result; for (uint128_t i = 2, s = sqrt(n); i <= s; ++i) for (uint128_t p = i * i; p < n; p *= i) result.push_back(p); unique_sort(result); return result; } auto achilles(uint128_t from, uint128_t to, const std::vector<uint128_t>& pps) { std::vector<uint128_t> result; auto c = static_cast<uint128_t>(std::cbrt(static_cast<double>(to / 4))); auto s = sqrt(to / 8); for (uint128_t b = 2; b <= c; ++b) { uint128_t b3 = b * b * b; for (uint128_t a = 2; a <= s; ++a) { uint128_t p = b3 * a * a; if (p >= to) break; if (p >= from && !binary_search(pps.begin(), pps.end(), p)) result.push_back(p); } } unique_sort(result); return result; } uint128_t totient(uint128_t n) { uint128_t tot = n; if ((n & 1) == 0) { while ((n & 1) == 0) n >>= 1; tot -= tot >> 1; } for (uint128_t p = 3; p * p <= n; p += 2) { if (n % p == 0) { while (n % p == 0) n /= p; tot -= tot / p; } } if (n > 1) tot -= tot / n; return tot; } int main() { auto start = std::chrono::high_resolution_clock::now(); const uint128_t limit = 1000000000000000; auto pps = perfect_powers(limit); auto ach = achilles(1, 1000000, pps); std::cout << "First 50 Achilles numbers:\n"; for (size_t i = 0; i < 50 && i < ach.size(); ++i) std::cout << std::setw(4) << ach[i] << ((i + 1) % 10 == 0 ? '\n' : ' '); std::cout << "\nFirst 50 strong Achilles numbers:\n"; for (size_t i = 0, count = 0; count < 50 && i < ach.size(); ++i) if (binary_search(ach.begin(), ach.end(), totient(ach[i]))) std::cout << std::setw(6) << ach[i] << (++count % 10 == 0 ? '\n' : ' '); int digits = 2; std::cout << "\nNumber of Achilles numbers with:\n"; for (uint128_t from = 1, to = 100; to <= limit; to *= 10, ++digits) { size_t count = achilles(from, to, pps).size(); std::cout << std::setw(2) << digits << " digits: " << count << '\n'; from = to; } auto end = std::chrono::high_resolution_clock::now(); std::chrono::duration<double> duration(end - start); std::cout << "\nElapsed time: " << duration.count() << " seconds\n"; }
Change the following Go code into C++ without altering its purpose.
package main import ( "fmt" "math" "sort" ) func totient(n int) int { tot := n i := 2 for i*i <= n { if n%i == 0 { for n%i == 0 { n /= i } tot -= tot / i } if i == 2 { i = 1 } i += 2 } if n > 1 { tot -= tot / n } return tot } var pps = make(map[int]bool) func getPerfectPowers(maxExp int) { upper := math.Pow(10, float64(maxExp)) for i := 2; i <= int(math.Sqrt(upper)); i++ { fi := float64(i) p := fi for { p *= fi if p >= upper { break } pps[int(p)] = true } } } func getAchilles(minExp, maxExp int) map[int]bool { lower := math.Pow(10, float64(minExp)) upper := math.Pow(10, float64(maxExp)) achilles := make(map[int]bool) for b := 1; b <= int(math.Cbrt(upper)); b++ { b3 := b * b * b for a := 1; a <= int(math.Sqrt(upper)); a++ { p := b3 * a * a if p >= int(upper) { break } if p >= int(lower) { if _, ok := pps[p]; !ok { achilles[p] = true } } } } return achilles } func main() { maxDigits := 15 getPerfectPowers(maxDigits) achillesSet := getAchilles(1, 5) achilles := make([]int, len(achillesSet)) i := 0 for k := range achillesSet { achilles[i] = k i++ } sort.Ints(achilles) fmt.Println("First 50 Achilles numbers:") for i = 0; i < 50; i++ { fmt.Printf("%4d ", achilles[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Println("\nFirst 30 strong Achilles numbers:") var strongAchilles []int count := 0 for n := 0; count < 30; n++ { tot := totient(achilles[n]) if _, ok := achillesSet[tot]; ok { strongAchilles = append(strongAchilles, achilles[n]) count++ } } for i = 0; i < 30; i++ { fmt.Printf("%5d ", strongAchilles[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Println("\nNumber of Achilles numbers with:") for d := 2; d <= maxDigits; d++ { ac := len(getAchilles(d-1, d)) fmt.Printf("%2d digits: %d\n", d, ac) } }
#include <algorithm> #include <chrono> #include <cmath> #include <cstdint> #include <iomanip> #include <iostream> #include <vector> #include <boost/multiprecision/cpp_int.hpp> using boost::multiprecision::uint128_t; template <typename T> void unique_sort(std::vector<T>& vector) { std::sort(vector.begin(), vector.end()); vector.erase(std::unique(vector.begin(), vector.end()), vector.end()); } auto perfect_powers(uint128_t n) { std::vector<uint128_t> result; for (uint128_t i = 2, s = sqrt(n); i <= s; ++i) for (uint128_t p = i * i; p < n; p *= i) result.push_back(p); unique_sort(result); return result; } auto achilles(uint128_t from, uint128_t to, const std::vector<uint128_t>& pps) { std::vector<uint128_t> result; auto c = static_cast<uint128_t>(std::cbrt(static_cast<double>(to / 4))); auto s = sqrt(to / 8); for (uint128_t b = 2; b <= c; ++b) { uint128_t b3 = b * b * b; for (uint128_t a = 2; a <= s; ++a) { uint128_t p = b3 * a * a; if (p >= to) break; if (p >= from && !binary_search(pps.begin(), pps.end(), p)) result.push_back(p); } } unique_sort(result); return result; } uint128_t totient(uint128_t n) { uint128_t tot = n; if ((n & 1) == 0) { while ((n & 1) == 0) n >>= 1; tot -= tot >> 1; } for (uint128_t p = 3; p * p <= n; p += 2) { if (n % p == 0) { while (n % p == 0) n /= p; tot -= tot / p; } } if (n > 1) tot -= tot / n; return tot; } int main() { auto start = std::chrono::high_resolution_clock::now(); const uint128_t limit = 1000000000000000; auto pps = perfect_powers(limit); auto ach = achilles(1, 1000000, pps); std::cout << "First 50 Achilles numbers:\n"; for (size_t i = 0; i < 50 && i < ach.size(); ++i) std::cout << std::setw(4) << ach[i] << ((i + 1) % 10 == 0 ? '\n' : ' '); std::cout << "\nFirst 50 strong Achilles numbers:\n"; for (size_t i = 0, count = 0; count < 50 && i < ach.size(); ++i) if (binary_search(ach.begin(), ach.end(), totient(ach[i]))) std::cout << std::setw(6) << ach[i] << (++count % 10 == 0 ? '\n' : ' '); int digits = 2; std::cout << "\nNumber of Achilles numbers with:\n"; for (uint128_t from = 1, to = 100; to <= limit; to *= 10, ++digits) { size_t count = achilles(from, to, pps).size(); std::cout << std::setw(2) << digits << " digits: " << count << '\n'; from = to; } auto end = std::chrono::high_resolution_clock::now(); std::chrono::duration<double> duration(end - start); std::cout << "\nElapsed time: " << duration.count() << " seconds\n"; }
Please provide an equivalent version of this Go code in C++.
package main import ( "fmt" "rcu" "sort" ) func main() { primes := rcu.Primes(333) var oss []int for i := 1; i < len(primes)-1; i++ { for j := i + 1; j < len(primes); j++ { n := primes[i] * primes[j] if n >= 1000 { break } oss = append(oss, n) } } sort.Ints(oss) fmt.Println("Odd squarefree semiprimes under 1,000:") for i, n := range oss { fmt.Printf("%3d ", n) if (i+1)%10 == 0 { fmt.Println() } } fmt.Printf("\n\n%d such numbers found.\n", len(oss)) }
#include <iomanip> #include <iostream> bool odd_square_free_semiprime(int n) { if ((n & 1) == 0) return false; int count = 0; for (int i = 3; i * i <= n; i += 2) { for (; n % i == 0; n /= i) { if (++count > 1) return false; } } return count == 1; } int main() { const int n = 1000; std::cout << "Odd square-free semiprimes < " << n << ":\n"; int count = 0; for (int i = 1; i < n; i += 2) { if (odd_square_free_semiprime(i)) { ++count; std::cout << std::setw(4) << i; if (count % 20 == 0) std::cout << '\n'; } } std::cout << "\nCount: " << count << '\n'; return 0; }
Keep all operations the same but rewrite the snippet in C++.
package main import ( "fmt" "rcu" "sort" ) func main() { primes := rcu.Primes(333) var oss []int for i := 1; i < len(primes)-1; i++ { for j := i + 1; j < len(primes); j++ { n := primes[i] * primes[j] if n >= 1000 { break } oss = append(oss, n) } } sort.Ints(oss) fmt.Println("Odd squarefree semiprimes under 1,000:") for i, n := range oss { fmt.Printf("%3d ", n) if (i+1)%10 == 0 { fmt.Println() } } fmt.Printf("\n\n%d such numbers found.\n", len(oss)) }
#include <iomanip> #include <iostream> bool odd_square_free_semiprime(int n) { if ((n & 1) == 0) return false; int count = 0; for (int i = 3; i * i <= n; i += 2) { for (; n % i == 0; n /= i) { if (++count > 1) return false; } } return count == 1; } int main() { const int n = 1000; std::cout << "Odd square-free semiprimes < " << n << ":\n"; int count = 0; for (int i = 1; i < n; i += 2) { if (odd_square_free_semiprime(i)) { ++count; std::cout << std::setw(4) << i; if (count % 20 == 0) std::cout << '\n'; } } std::cout << "\nCount: " << count << '\n'; return 0; }
Ensure the translated C++ code behaves exactly like the original Go snippet.
package main import ( "github.com/fogleman/gg" "math" ) var ( width = 770.0 height = 770.0 dc = gg.NewContext(int(width), int(height)) ) var cx, cy, h float64 func lineTo(newX, newY float64) { dc.LineTo(newX-width/2+h, height-newY+2*h) cx, cy = newX, newY } func lineN() { lineTo(cx, cy-2*h) } func lineS() { lineTo(cx, cy+2*h) } func lineE() { lineTo(cx+2*h, cy) } func lineW() { lineTo(cx-2*h, cy) } func lineNW() { lineTo(cx-h, cy-h) } func lineNE() { lineTo(cx+h, cy-h) } func lineSE() { lineTo(cx+h, cy+h) } func lineSW() { lineTo(cx-h, cy+h) } func sierN(level int) { if level == 1 { lineNE() lineN() lineNW() } else { sierN(level - 1) lineNE() sierE(level - 1) lineN() sierW(level - 1) lineNW() sierN(level - 1) } } func sierE(level int) { if level == 1 { lineSE() lineE() lineNE() } else { sierE(level - 1) lineSE() sierS(level - 1) lineE() sierN(level - 1) lineNE() sierE(level - 1) } } func sierS(level int) { if level == 1 { lineSW() lineS() lineSE() } else { sierS(level - 1) lineSW() sierW(level - 1) lineS() sierE(level - 1) lineSE() sierS(level - 1) } } func sierW(level int) { if level == 1 { lineNW() lineW() lineSW() } else { sierW(level - 1) lineNW() sierN(level - 1) lineW() sierS(level - 1) lineSW() sierW(level - 1) } } func squareCurve(level int) { sierN(level) lineNE() sierE(level) lineSE() sierS(level) lineSW() sierW(level) lineNW() lineNE() } func main() { dc.SetRGB(0, 0, 1) dc.Clear() level := 5 cx, cy = width/2, height h = cx / math.Pow(2, float64(level+1)) squareCurve(level) dc.SetRGB255(255, 255, 0) dc.SetLineWidth(2) dc.Stroke() dc.SavePNG("sierpinski_curve.png") }
#include <cmath> #include <fstream> #include <iostream> #include <string> class sierpinski_curve { public: void write(std::ostream& out, int size, int length, int order); private: static std::string rewrite(const std::string& s); void line(std::ostream& out); void execute(std::ostream& out, const std::string& s); double x_; double y_; int angle_; int length_; }; void sierpinski_curve::write(std::ostream& out, int size, int length, int order) { length_ = length; x_ = length/std::sqrt(2.0); y_ = 2 * x_; angle_ = 45; out << "<svg xmlns='http: << size << "' height='" << size << "'>\n"; out << "<rect width='100%' height='100%' fill='white'/>\n"; out << "<path stroke-width='1' stroke='black' fill='none' d='"; std::string s = "F--XF--F--XF"; for (int i = 0; i < order; ++i) s = rewrite(s); execute(out, s); out << "'/>\n</svg>\n"; } std::string sierpinski_curve::rewrite(const std::string& s) { std::string t; for (char c : s) { if (c == 'X') t += "XF+G+XF--F--XF+G+X"; else t += c; } return t; } void sierpinski_curve::line(std::ostream& out) { double theta = (3.14159265359 * angle_)/180.0; x_ += length_ * std::cos(theta); y_ -= length_ * std::sin(theta); out << " L" << x_ << ',' << y_; } void sierpinski_curve::execute(std::ostream& out, const std::string& s) { out << 'M' << x_ << ',' << y_; for (char c : s) { switch (c) { case 'F': case 'G': line(out); break; case '+': angle_ = (angle_ + 45) % 360; break; case '-': angle_ = (angle_ - 45) % 360; break; } } } int main() { std::ofstream out("sierpinski_curve.svg"); if (!out) { std::cerr << "Cannot open output file\n"; return 1; } sierpinski_curve s; s.write(out, 545, 7, 5); return 0; }
Port the provided Go code into C++ while preserving the original functionality.
package main import ( "github.com/fogleman/gg" "math" ) var ( width = 770.0 height = 770.0 dc = gg.NewContext(int(width), int(height)) ) var cx, cy, h float64 func lineTo(newX, newY float64) { dc.LineTo(newX-width/2+h, height-newY+2*h) cx, cy = newX, newY } func lineN() { lineTo(cx, cy-2*h) } func lineS() { lineTo(cx, cy+2*h) } func lineE() { lineTo(cx+2*h, cy) } func lineW() { lineTo(cx-2*h, cy) } func lineNW() { lineTo(cx-h, cy-h) } func lineNE() { lineTo(cx+h, cy-h) } func lineSE() { lineTo(cx+h, cy+h) } func lineSW() { lineTo(cx-h, cy+h) } func sierN(level int) { if level == 1 { lineNE() lineN() lineNW() } else { sierN(level - 1) lineNE() sierE(level - 1) lineN() sierW(level - 1) lineNW() sierN(level - 1) } } func sierE(level int) { if level == 1 { lineSE() lineE() lineNE() } else { sierE(level - 1) lineSE() sierS(level - 1) lineE() sierN(level - 1) lineNE() sierE(level - 1) } } func sierS(level int) { if level == 1 { lineSW() lineS() lineSE() } else { sierS(level - 1) lineSW() sierW(level - 1) lineS() sierE(level - 1) lineSE() sierS(level - 1) } } func sierW(level int) { if level == 1 { lineNW() lineW() lineSW() } else { sierW(level - 1) lineNW() sierN(level - 1) lineW() sierS(level - 1) lineSW() sierW(level - 1) } } func squareCurve(level int) { sierN(level) lineNE() sierE(level) lineSE() sierS(level) lineSW() sierW(level) lineNW() lineNE() } func main() { dc.SetRGB(0, 0, 1) dc.Clear() level := 5 cx, cy = width/2, height h = cx / math.Pow(2, float64(level+1)) squareCurve(level) dc.SetRGB255(255, 255, 0) dc.SetLineWidth(2) dc.Stroke() dc.SavePNG("sierpinski_curve.png") }
#include <cmath> #include <fstream> #include <iostream> #include <string> class sierpinski_curve { public: void write(std::ostream& out, int size, int length, int order); private: static std::string rewrite(const std::string& s); void line(std::ostream& out); void execute(std::ostream& out, const std::string& s); double x_; double y_; int angle_; int length_; }; void sierpinski_curve::write(std::ostream& out, int size, int length, int order) { length_ = length; x_ = length/std::sqrt(2.0); y_ = 2 * x_; angle_ = 45; out << "<svg xmlns='http: << size << "' height='" << size << "'>\n"; out << "<rect width='100%' height='100%' fill='white'/>\n"; out << "<path stroke-width='1' stroke='black' fill='none' d='"; std::string s = "F--XF--F--XF"; for (int i = 0; i < order; ++i) s = rewrite(s); execute(out, s); out << "'/>\n</svg>\n"; } std::string sierpinski_curve::rewrite(const std::string& s) { std::string t; for (char c : s) { if (c == 'X') t += "XF+G+XF--F--XF+G+X"; else t += c; } return t; } void sierpinski_curve::line(std::ostream& out) { double theta = (3.14159265359 * angle_)/180.0; x_ += length_ * std::cos(theta); y_ -= length_ * std::sin(theta); out << " L" << x_ << ',' << y_; } void sierpinski_curve::execute(std::ostream& out, const std::string& s) { out << 'M' << x_ << ',' << y_; for (char c : s) { switch (c) { case 'F': case 'G': line(out); break; case '+': angle_ = (angle_ + 45) % 360; break; case '-': angle_ = (angle_ - 45) % 360; break; } } } int main() { std::ofstream out("sierpinski_curve.svg"); if (!out) { std::cerr << "Cannot open output file\n"; return 1; } sierpinski_curve s; s.write(out, 545, 7, 5); return 0; }
Preserve the algorithm and functionality while converting the code from Go to C++.
package main import ( "fmt" "sort" ) type cf struct { c rune f int } func reverseStr(s string) string { runes := []rune(s) for i, j := 0, len(runes)-1; i < j; i, j = i+1, j-1 { runes[i], runes[j] = runes[j], runes[i] } return string(runes) } func indexOfCf(cfs []cf, r rune) int { for i, cf := range cfs { if cf.c == r { return i } } return -1 } func minOf(i, j int) int { if i < j { return i } return j } func mostFreqKHashing(input string, k int) string { var cfs []cf for _, r := range input { ix := indexOfCf(cfs, r) if ix >= 0 { cfs[ix].f++ } else { cfs = append(cfs, cf{r, 1}) } } sort.SliceStable(cfs, func(i, j int) bool { return cfs[i].f > cfs[j].f }) acc := "" min := minOf(len(cfs), k) for _, cf := range cfs[:min] { acc += fmt.Sprintf("%c%c", cf.c, cf.f) } return acc } func mostFreqKSimilarity(input1, input2 string) int { similarity := 0 runes1, runes2 := []rune(input1), []rune(input2) for i := 0; i < len(runes1); i += 2 { for j := 0; j < len(runes2); j += 2 { if runes1[i] == runes2[j] { freq1, freq2 := runes1[i+1], runes2[j+1] if freq1 != freq2 { continue } similarity += int(freq1) } } } return similarity } func mostFreqKSDF(input1, input2 string, k, maxDistance int) { fmt.Println("input1 :", input1) fmt.Println("input2 :", input2) s1 := mostFreqKHashing(input1, k) s2 := mostFreqKHashing(input2, k) fmt.Printf("mfkh(input1, %d) = ", k) for i, c := range s1 { if i%2 == 0 { fmt.Printf("%c", c) } else { fmt.Printf("%d", c) } } fmt.Printf("\nmfkh(input2, %d) = ", k) for i, c := range s2 { if i%2 == 0 { fmt.Printf("%c", c) } else { fmt.Printf("%d", c) } } result := maxDistance - mostFreqKSimilarity(s1, s2) fmt.Printf("\nSDF(input1, input2, %d, %d) = %d\n\n", k, maxDistance, result) } func main() { pairs := [][2]string{ {"research", "seeking"}, {"night", "nacht"}, {"my", "a"}, {"research", "research"}, {"aaaaabbbb", "ababababa"}, {"significant", "capabilities"}, } for _, pair := range pairs { mostFreqKSDF(pair[0], pair[1], 2, 10) } s1 := "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV" s2 := "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG" mostFreqKSDF(s1, s2, 2, 100) s1 = "abracadabra12121212121abracadabra12121212121" s2 = reverseStr(s1) mostFreqKSDF(s1, s2, 2, 100) }
#include <string> #include <vector> #include <map> #include <iostream> #include <algorithm> #include <utility> #include <sstream> std::string mostFreqKHashing ( const std::string & input , int k ) { std::ostringstream oss ; std::map<char, int> frequencies ; for ( char c : input ) { frequencies[ c ] = std::count ( input.begin( ) , input.end( ) , c ) ; } std::vector<std::pair<char , int>> letters ( frequencies.begin( ) , frequencies.end( ) ) ; std::sort ( letters.begin( ) , letters.end( ) , [input] ( std::pair<char, int> a , std::pair<char, int> b ) { char fc = std::get<0>( a ) ; char fs = std::get<0>( b ) ; int o = std::get<1>( a ) ; int p = std::get<1>( b ) ; if ( o != p ) { return o > p ; } else { return input.find_first_of( fc ) < input.find_first_of ( fs ) ; } } ) ; for ( int i = 0 ; i < letters.size( ) ; i++ ) { oss << std::get<0>( letters[ i ] ) ; oss << std::get<1>( letters[ i ] ) ; } std::string output ( oss.str( ).substr( 0 , 2 * k ) ) ; if ( letters.size( ) >= k ) { return output ; } else { return output.append( "NULL0" ) ; } } int mostFreqKSimilarity ( const std::string & first , const std::string & second ) { int i = 0 ; while ( i < first.length( ) - 1 ) { auto found = second.find_first_of( first.substr( i , 2 ) ) ; if ( found != std::string::npos ) return std::stoi ( first.substr( i , 2 )) ; else i += 2 ; } return 0 ; } int mostFreqKSDF ( const std::string & firstSeq , const std::string & secondSeq , int num ) { return mostFreqKSimilarity ( mostFreqKHashing( firstSeq , num ) , mostFreqKHashing( secondSeq , num ) ) ; } int main( ) { std::string s1("LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV" ) ; std::string s2( "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG" ) ; std::cout << "MostFreqKHashing( s1 , 2 ) = " << mostFreqKHashing( s1 , 2 ) << '\n' ; std::cout << "MostFreqKHashing( s2 , 2 ) = " << mostFreqKHashing( s2 , 2 ) << '\n' ; return 0 ; }
Generate an equivalent C++ version of this Go code.
package main import ( "fmt" "rcu" ) func reversed(n int) int { rev := 0 for n > 0 { rev = rev*10 + n%10 n /= 10 } return rev } func main() { primes := rcu.Primes(99999) var pals []int for _, p := range primes { if p == reversed(p) { pals = append(pals, p) } } fmt.Println("Palindromic primes under 1,000:") var smallPals, bigPals []int for _, p := range pals { if p < 1000 { smallPals = append(smallPals, p) } else { bigPals = append(bigPals, p) } } rcu.PrintTable(smallPals, 10, 3, false) fmt.Println() fmt.Println(len(smallPals), "such primes found.") fmt.Println("\nAdditional palindromic primes under 100,000:") rcu.PrintTable(bigPals, 10, 6, true) fmt.Println() fmt.Println(len(bigPals), "such primes found,", len(pals), "in all.") }
#include <algorithm> #include <cmath> #include <iomanip> #include <iostream> #include <string> unsigned int reverse(unsigned int base, unsigned int n) { unsigned int rev = 0; for (; n > 0; n /= base) rev = rev * base + (n % base); return rev; } class palindrome_generator { public: explicit palindrome_generator(unsigned int base) : base_(base), upper_(base) {} unsigned int next_palindrome(); private: unsigned int base_; unsigned int lower_ = 1; unsigned int upper_; unsigned int next_ = 0; bool even_ = false; }; unsigned int palindrome_generator::next_palindrome() { ++next_; if (next_ == upper_) { if (even_) { lower_ = upper_; upper_ *= base_; } next_ = lower_; even_ = !even_; } return even_ ? next_ * upper_ + reverse(base_, next_) : next_ * lower_ + reverse(base_, next_ / base_); } bool is_prime(unsigned int n) { if (n < 2) return false; if (n % 2 == 0) return n == 2; if (n % 3 == 0) return n == 3; for (unsigned int p = 5; p * p <= n; p += 4) { if (n % p == 0) return false; p += 2; if (n % p == 0) return false; } return true; } std::string to_string(unsigned int base, unsigned int n) { assert(base <= 36); static constexpr char digits[] = "0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ"; std::string str; for (; n != 0; n /= base) str += digits[n % base]; std::reverse(str.begin(), str.end()); return str; } void print_palindromic_primes(unsigned int base, unsigned int limit) { auto width = static_cast<unsigned int>(std::ceil(std::log(limit) / std::log(base))); unsigned int count = 0; auto columns = 80 / (width + 1); std::cout << "Base " << base << " palindromic primes less than " << limit << ":\n"; palindrome_generator pgen(base); unsigned int palindrome; while ((palindrome = pgen.next_palindrome()) < limit) { if (is_prime(palindrome)) { ++count; std::cout << std::setw(width) << to_string(base, palindrome) << (count % columns == 0 ? '\n' : ' '); } } if (count % columns != 0) std::cout << '\n'; std::cout << "Count: " << count << '\n'; } void count_palindromic_primes(unsigned int base, unsigned int limit) { unsigned int count = 0; palindrome_generator pgen(base); unsigned int palindrome; while ((palindrome = pgen.next_palindrome()) < limit) if (is_prime(palindrome)) ++count; std::cout << "Number of base " << base << " palindromic primes less than " << limit << ": " << count << '\n'; } int main() { print_palindromic_primes(10, 1000); std::cout << '\n'; print_palindromic_primes(10, 100000); std::cout << '\n'; count_palindromic_primes(10, 1000000000); std::cout << '\n'; print_palindromic_primes(16, 500); }
Write the same code in C++ as shown below in Go.
package main import ( "fmt" "rcu" ) func reversed(n int) int { rev := 0 for n > 0 { rev = rev*10 + n%10 n /= 10 } return rev } func main() { primes := rcu.Primes(99999) var pals []int for _, p := range primes { if p == reversed(p) { pals = append(pals, p) } } fmt.Println("Palindromic primes under 1,000:") var smallPals, bigPals []int for _, p := range pals { if p < 1000 { smallPals = append(smallPals, p) } else { bigPals = append(bigPals, p) } } rcu.PrintTable(smallPals, 10, 3, false) fmt.Println() fmt.Println(len(smallPals), "such primes found.") fmt.Println("\nAdditional palindromic primes under 100,000:") rcu.PrintTable(bigPals, 10, 6, true) fmt.Println() fmt.Println(len(bigPals), "such primes found,", len(pals), "in all.") }
#include <algorithm> #include <cmath> #include <iomanip> #include <iostream> #include <string> unsigned int reverse(unsigned int base, unsigned int n) { unsigned int rev = 0; for (; n > 0; n /= base) rev = rev * base + (n % base); return rev; } class palindrome_generator { public: explicit palindrome_generator(unsigned int base) : base_(base), upper_(base) {} unsigned int next_palindrome(); private: unsigned int base_; unsigned int lower_ = 1; unsigned int upper_; unsigned int next_ = 0; bool even_ = false; }; unsigned int palindrome_generator::next_palindrome() { ++next_; if (next_ == upper_) { if (even_) { lower_ = upper_; upper_ *= base_; } next_ = lower_; even_ = !even_; } return even_ ? next_ * upper_ + reverse(base_, next_) : next_ * lower_ + reverse(base_, next_ / base_); } bool is_prime(unsigned int n) { if (n < 2) return false; if (n % 2 == 0) return n == 2; if (n % 3 == 0) return n == 3; for (unsigned int p = 5; p * p <= n; p += 4) { if (n % p == 0) return false; p += 2; if (n % p == 0) return false; } return true; } std::string to_string(unsigned int base, unsigned int n) { assert(base <= 36); static constexpr char digits[] = "0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ"; std::string str; for (; n != 0; n /= base) str += digits[n % base]; std::reverse(str.begin(), str.end()); return str; } void print_palindromic_primes(unsigned int base, unsigned int limit) { auto width = static_cast<unsigned int>(std::ceil(std::log(limit) / std::log(base))); unsigned int count = 0; auto columns = 80 / (width + 1); std::cout << "Base " << base << " palindromic primes less than " << limit << ":\n"; palindrome_generator pgen(base); unsigned int palindrome; while ((palindrome = pgen.next_palindrome()) < limit) { if (is_prime(palindrome)) { ++count; std::cout << std::setw(width) << to_string(base, palindrome) << (count % columns == 0 ? '\n' : ' '); } } if (count % columns != 0) std::cout << '\n'; std::cout << "Count: " << count << '\n'; } void count_palindromic_primes(unsigned int base, unsigned int limit) { unsigned int count = 0; palindrome_generator pgen(base); unsigned int palindrome; while ((palindrome = pgen.next_palindrome()) < limit) if (is_prime(palindrome)) ++count; std::cout << "Number of base " << base << " palindromic primes less than " << limit << ": " << count << '\n'; } int main() { print_palindromic_primes(10, 1000); std::cout << '\n'; print_palindromic_primes(10, 100000); std::cout << '\n'; count_palindromic_primes(10, 1000000000); std::cout << '\n'; print_palindromic_primes(16, 500); }
Port the following code from Go to C++ with equivalent syntax and logic.
package main import ( "bytes" "fmt" "io/ioutil" "log" "unicode/utf8" ) func main() { wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) var words []string for _, bword := range bwords { s := string(bword) if utf8.RuneCountInString(s) > 10 { words = append(words, s) } } count := 0 fmt.Println("Words which contain all 5 vowels once in", wordList, "\b:\n") for _, word := range words { ca, ce, ci, co, cu := 0, 0, 0, 0, 0 for _, r := range word { switch r { case 'a': ca++ case 'e': ce++ case 'i': ci++ case 'o': co++ case 'u': cu++ } } if ca == 1 && ce == 1 && ci == 1 && co == 1 && cu == 1 { count++ fmt.Printf("%2d: %s\n", count, word) } } }
#include <bitset> #include <cctype> #include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> bool contains_all_vowels_once(const std::string& word) { std::bitset<5> vowels; for (char ch : word) { ch = std::tolower(static_cast<unsigned char>(ch)); size_t bit = 0; switch (ch) { case 'a': bit = 0; break; case 'e': bit = 1; break; case 'i': bit = 2; break; case 'o': bit = 3; break; case 'u': bit = 4; break; default: continue; } if (vowels.test(bit)) return false; vowels.set(bit); } return vowels.all(); } int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string word; int n = 0; while (getline(in, word)) { if (word.size() > 10 && contains_all_vowels_once(word)) std::cout << std::setw(2) << ++n << ": " << word << '\n'; } return EXIT_SUCCESS; }
Translate the given Go code snippet into C++ without altering its behavior.
package main import ( "bytes" "fmt" "io/ioutil" "log" ) func levenshtein(s, t string) int { d := make([][]int, len(s)+1) for i := range d { d[i] = make([]int, len(t)+1) } for i := range d { d[i][0] = i } for j := range d[0] { d[0][j] = j } for j := 1; j <= len(t); j++ { for i := 1; i <= len(s); i++ { if s[i-1] == t[j-1] { d[i][j] = d[i-1][j-1] } else { min := d[i-1][j] if d[i][j-1] < min { min = d[i][j-1] } if d[i-1][j-1] < min { min = d[i-1][j-1] } d[i][j] = min + 1 } } } return d[len(s)][len(t)] } func main() { search := "complition" b, err := ioutil.ReadFile("unixdict.txt") if err != nil { log.Fatal("Error reading file") } words := bytes.Fields(b) var lev [4][]string for _, word := range words { s := string(word) ld := levenshtein(search, s) if ld < 4 { lev[ld] = append(lev[ld], s) } } fmt.Printf("Input word: %s\n\n", search) for i := 1; i < 4; i++ { length := float64(len(search)) similarity := (length - float64(i)) * 100 / length fmt.Printf("Words which are %4.1f%% similar:\n", similarity) fmt.Println(lev[i]) fmt.Println() } }
#include <algorithm> #include <fstream> #include <iostream> #include <numeric> #include <string> #include <vector> int levenshtein_distance(const std::string& str1, const std::string& str2) { size_t m = str1.size(), n = str2.size(); std::vector<int> cost(n + 1); std::iota(cost.begin(), cost.end(), 0); for (size_t i = 0; i < m; ++i) { cost[0] = i + 1; int prev = i; for (size_t j = 0; j < n; ++j) { int c = (str1[i] == str2[j]) ? prev : 1 + std::min(std::min(cost[j + 1], cost[j]), prev); prev = cost[j + 1]; cost[j + 1] = c; } } return cost[n]; } template <typename T> void print_vector(const std::vector<T>& vec) { auto i = vec.begin(); if (i == vec.end()) return; std::cout << *i++; for (; i != vec.end(); ++i) std::cout << ", " << *i; } int main(int argc, char** argv) { if (argc != 3) { std::cerr << "usage: " << argv[0] << " dictionary word\n"; return EXIT_FAILURE; } std::ifstream in(argv[1]); if (!in) { std::cerr << "Cannot open file " << argv[1] << '\n'; return EXIT_FAILURE; } std::string word(argv[2]); if (word.empty()) { std::cerr << "Word must not be empty\n"; return EXIT_FAILURE; } constexpr size_t max_dist = 4; std::vector<std::string> matches[max_dist + 1]; std::string match; while (getline(in, match)) { int distance = levenshtein_distance(word, match); if (distance <= max_dist) matches[distance].push_back(match); } for (size_t dist = 0; dist <= max_dist; ++dist) { if (matches[dist].empty()) continue; std::cout << "Words at Levenshtein distance of " << dist << " (" << 100 - (100 * dist)/word.size() << "% similarity) from '" << word << "':\n"; print_vector(matches[dist]); std::cout << "\n\n"; } return EXIT_SUCCESS; }
Rewrite the snippet below in C++ so it works the same as the original Go code.
package main import ( "fmt" "rcu" "sort" ) func main() { const limit = int(1e10) const maxIndex = 9 primes := rcu.Primes(limit) anaprimes := make(map[int][]int) for _, p := range primes { digs := rcu.Digits(p, 10) key := 1 for _, dig := range digs { key *= primes[dig] } if _, ok := anaprimes[key]; ok { anaprimes[key] = append(anaprimes[key], p) } else { anaprimes[key] = []int{p} } } largest := make([]int, maxIndex+1) groups := make([][][]int, maxIndex+1) for key := range anaprimes { v := anaprimes[key] nd := len(rcu.Digits(v[0], 10)) c := len(v) if c > largest[nd-1] { largest[nd-1] = c groups[nd-1] = [][]int{v} } else if c == largest[nd-1] { groups[nd-1] = append(groups[nd-1], v) } } j := 1000 for i := 2; i <= maxIndex; i++ { js := rcu.Commatize(j) ls := rcu.Commatize(largest[i]) fmt.Printf("Largest group(s) of anaprimes before %s: %s members:\n", js, ls) sort.Slice(groups[i], func(k, l int) bool { return groups[i][k][0] < groups[i][l][0] }) for _, g := range groups[i] { fmt.Printf(" First: %s Last: %s\n", rcu.Commatize(g[0]), rcu.Commatize(g[len(g)-1])) } j *= 10 fmt.Println() } }
#include <array> #include <iostream> #include <map> #include <vector> #include <primesieve.hpp> using digit_set = std::array<int, 10>; digit_set get_digits(uint64_t n) { digit_set result = {}; for (; n > 0; n /= 10) ++result[n % 10]; return result; } int main() { std::cout.imbue(std::locale("")); primesieve::iterator pi; using map_type = std::map<digit_set, std::vector<uint64_t>, std::greater<digit_set>>; map_type anaprimes; for (uint64_t limit = 1000; limit <= 10000000000;) { uint64_t prime = pi.next_prime(); if (prime > limit) { size_t max_length = 0; std::vector<map_type::iterator> groups; for (auto i = anaprimes.begin(); i != anaprimes.end(); ++i) { if (i->second.size() > max_length) { groups.clear(); max_length = i->second.size(); } if (max_length == i->second.size()) groups.push_back(i); } std::cout << "Largest group(s) of anaprimes before " << limit << ": " << max_length << " members:\n"; for (auto i : groups) { std::cout << " First: " << i->second.front() << " Last: " << i->second.back() << '\n'; } std::cout << '\n'; anaprimes.clear(); limit *= 10; } anaprimes[get_digits(prime)].push_back(prime); } }
Ensure the translated C++ code behaves exactly like the original Go snippet.
package main import ( "fmt" "log" "math" ) var MinusInf = math.Inf(-1) type MaxTropical struct{ r float64 } func newMaxTropical(r float64) MaxTropical { if math.IsInf(r, 1) || math.IsNaN(r) { log.Fatal("Argument must be a real number or negative infinity.") } return MaxTropical{r} } func (t MaxTropical) eq(other MaxTropical) bool { return t.r == other.r } func (t MaxTropical) add(other MaxTropical) MaxTropical { if t.r == MinusInf { return other } if other.r == MinusInf { return t } return newMaxTropical(math.Max(t.r, other.r)) } func (t MaxTropical) mul(other MaxTropical) MaxTropical { if t.r == 0 { return other } if other.r == 0 { return t } return newMaxTropical(t.r + other.r) } func (t MaxTropical) pow(e int) MaxTropical { if e < 1 { log.Fatal("Exponent must be a positive integer.") } if e == 1 { return t } p := t for i := 2; i <= e; i++ { p = p.mul(t) } return p } func (t MaxTropical) String() string { return fmt.Sprintf("%g", t.r) } func main() { data := [][]float64{ {2, -2, 1}, {-0.001, MinusInf, 0}, {0, MinusInf, 1}, {1.5, -1, 0}, {-0.5, 0, 1}, } for _, d := range data { a := newMaxTropical(d[0]) b := newMaxTropical(d[1]) if d[2] == 0 { fmt.Printf("%s ⊕ %s = %s\n", a, b, a.add(b)) } else { fmt.Printf("%s ⊗ %s = %s\n", a, b, a.mul(b)) } } c := newMaxTropical(5) fmt.Printf("%s ^ 7 = %s\n", c, c.pow(7)) d := newMaxTropical(8) e := newMaxTropical(7) f := c.mul(d.add(e)) g := c.mul(d).add(c.mul(e)) fmt.Printf("%s ⊗ (%s ⊕ %s) = %s\n", c, d, e, f) fmt.Printf("%s ⊗ %s ⊕ %s ⊗ %s = %s\n", c, d, c, e, g) fmt.Printf("%s ⊗ (%s ⊕ %s) == %s ⊗ %s ⊕ %s ⊗ %s is %t\n", c, d, e, c, d, c, e, f.eq(g)) }
#include <iostream> #include <optional> using namespace std; class TropicalAlgebra { optional<double> m_value; public: friend std::ostream& operator<<(std::ostream&, const TropicalAlgebra&); friend TropicalAlgebra pow(const TropicalAlgebra& base, unsigned int exponent) noexcept; TropicalAlgebra() = default; explicit TropicalAlgebra(double value) noexcept : m_value{value} {} TropicalAlgebra& operator+=(const TropicalAlgebra& rhs) noexcept { if(!m_value) { *this = rhs; } else if (!rhs.m_value) { } else { *m_value = max(*rhs.m_value, *m_value); } return *this; } TropicalAlgebra& operator*=(const TropicalAlgebra& rhs) noexcept { if(!m_value) { } else if (!rhs.m_value) { *this = rhs; } else { *m_value += *rhs.m_value; } return *this; } }; inline TropicalAlgebra operator+(TropicalAlgebra lhs, const TropicalAlgebra& rhs) noexcept { lhs += rhs; return lhs; } inline TropicalAlgebra operator*(TropicalAlgebra lhs, const TropicalAlgebra& rhs) noexcept { lhs *= rhs; return lhs; } inline TropicalAlgebra pow(const TropicalAlgebra& base, unsigned int exponent) noexcept { auto result = base; for(unsigned int i = 1; i < exponent; i++) { result *= base; } return result; } ostream& operator<<(ostream& os, const TropicalAlgebra& pt) { if(!pt.m_value) cout << "-Inf\n"; else cout << *pt.m_value << "\n"; return os; } int main(void) { const TropicalAlgebra a(-2); const TropicalAlgebra b(-1); const TropicalAlgebra c(-0.5); const TropicalAlgebra d(-0.001); const TropicalAlgebra e(0); const TropicalAlgebra h(1.5); const TropicalAlgebra i(2); const TropicalAlgebra j(5); const TropicalAlgebra k(7); const TropicalAlgebra l(8); const TropicalAlgebra m; cout << "2 * -2 == " << i * a; cout << "-0.001 + -Inf == " << d + m; cout << "0 * -Inf == " << e * m; cout << "1.5 + -1 == " << h + b; cout << "-0.5 * 0 == " << c * e; cout << "pow(5, 7) == " << pow(j, 7); cout << "5 * (8 + 7)) == " << j * (l + k); cout << "5 * 8 + 5 * 7 == " << j * l + j * k; }
Port the provided Go code into C++ while preserving the original functionality.
package pig import ( "fmt" "math/rand" "time" ) type ( PlayerID int MessageID int StrategyID int PigGameData struct { player PlayerID turnCount int turnRollCount int turnScore int lastRoll int scores [2]int verbose bool } ) const ( gameOver = iota piggedOut rolls pointSpending holds turn gameOverSummary player1 = PlayerID(0) player2 = PlayerID(1) noPlayer = PlayerID(-1) maxScore = 100 scoreChaseStrat = iota rollCountStrat ) func pluralS(n int) string { if n != 1 { return "s" } return "" } func New() *PigGameData { return &PigGameData{0, 0, 0, 0, 0, [2]int{0, 0}, false} } func (pg *PigGameData) statusMessage(id MessageID) string { var msg string switch id { case gameOver: msg = fmt.Sprintf("Game is over after %d turns", pg.turnCount) case piggedOut: msg = fmt.Sprintf(" Pigged out after %d roll%s", pg.turnRollCount, pluralS(pg.turnRollCount)) case rolls: msg = fmt.Sprintf(" Rolls %d", pg.lastRoll) case pointSpending: msg = fmt.Sprintf(" %d point%s pending", pg.turnScore, pluralS(pg.turnScore)) case holds: msg = fmt.Sprintf(" Holds after %d turns, adding %d points for a total of %d", pg.turnRollCount, pg.turnScore, pg.PlayerScore(noPlayer)) case turn: msg = fmt.Sprintf("Player %d's turn:", pg.player+1) case gameOverSummary: msg = fmt.Sprintf("Game over after %d turns\n player 1 %d\n player 2 %d\n", pg.turnCount, pg.PlayerScore(player1), pg.PlayerScore(player2)) } return msg } func (pg *PigGameData) PrintStatus(id MessageID) { if pg.verbose { fmt.Println(pg.statusMessage(id)) } } func (pg *PigGameData) Play(id StrategyID) (keepPlaying bool) { if pg.GameOver() { pg.PrintStatus(gameOver) return false } if pg.turnCount == 0 { pg.player = player2 pg.NextPlayer() } pg.lastRoll = rand.Intn(6) + 1 pg.PrintStatus(rolls) pg.turnRollCount++ if pg.lastRoll == 1 { pg.PrintStatus(piggedOut) pg.NextPlayer() } else { pg.turnScore += pg.lastRoll pg.PrintStatus(pointSpending) success := false switch id { case scoreChaseStrat: success = pg.scoreChaseStrategy() case rollCountStrat: success = pg.rollCountStrategy() } if success { pg.Hold() pg.NextPlayer() } } return true } func (pg *PigGameData) PlayerScore(id PlayerID) int { if id == noPlayer { return pg.scores[pg.player] } return pg.scores[id] } func (pg *PigGameData) GameOver() bool { return pg.scores[player1] >= maxScore || pg.scores[player2] >= maxScore } func (pg *PigGameData) Winner() PlayerID { for index, score := range pg.scores { if score >= maxScore { return PlayerID(index) } } return noPlayer } func (pg *PigGameData) otherPlayer() PlayerID { return 1 - pg.player } func (pg *PigGameData) Hold() { pg.scores[pg.player] += pg.turnScore pg.PrintStatus(holds) pg.turnRollCount, pg.turnScore = 0, 0 } func (pg *PigGameData) NextPlayer() { pg.turnCount++ pg.turnRollCount, pg.turnScore = 0, 0 pg.player = pg.otherPlayer() pg.PrintStatus(turn) } func (pg *PigGameData) rollCountStrategy() bool { return pg.turnRollCount >= 3 } func (pg *PigGameData) scoreChaseStrategy() bool { myScore := pg.PlayerScore(pg.player) otherScore := pg.PlayerScore(pg.otherPlayer()) myPendingScore := pg.turnScore + myScore return myPendingScore >= maxScore || myPendingScore > otherScore || pg.turnRollCount >= 5 } func main() { rand.Seed(time.Now().UnixNano()) pg := New() pg.verbose = true strategies := [2]StrategyID{scoreChaseStrat, rollCountStrat} for !pg.GameOver() { pg.Play(strategies[pg.player]) } pg.PrintStatus(gameOverSummary) }
#include <windows.h> #include <iostream> #include <string> using namespace std; const int PLAYERS = 4, MAX_POINTS = 100; enum Moves { ROLL, HOLD }; class player { public: player() { current_score = round_score = 0; } void addCurrScore() { current_score += round_score; } int getCurrScore() { return current_score; } int getRoundScore() { return round_score; } void addRoundScore( int rs ) { round_score += rs; } void zeroRoundScore() { round_score = 0; } virtual int getMove() = 0; virtual ~player() {} protected: int current_score, round_score; }; class RAND_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; if( rand() % 10 < 5 ) return ROLL; if( round_score > 0 ) return HOLD; return ROLL; } }; class Q2WIN_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; int q = MAX_POINTS - current_score; if( q < 6 ) return ROLL; q /= 4; if( round_score < q ) return ROLL; return HOLD; } }; class AL20_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; if( round_score < 20 ) return ROLL; return HOLD; } }; class AL20T_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; int d = ( 100 * round_score ) / 20; if( round_score < 20 && d < rand() % 100 ) return ROLL; return HOLD; } }; class Auto_pigGame { public: Auto_pigGame() { _players[0] = new RAND_Player(); _players[1] = new Q2WIN_Player(); _players[2] = new AL20_Player(); _players[3] = new AL20T_Player(); } ~Auto_pigGame() { delete _players[0]; delete _players[1]; delete _players[2]; delete _players[3]; } void play() { int die, p = 0; bool endGame = false; while( !endGame ) { switch( _players[p]->getMove() ) { case ROLL: die = rand() % 6 + 1; if( die == 1 ) { cout << "Player " << p + 1 << " rolled " << die << " - current score: " << _players[p]->getCurrScore() << endl << endl; nextTurn( p ); continue; } _players[p]->addRoundScore( die ); cout << "Player " << p + 1 << " rolled " << die << " - round score: " << _players[p]->getRoundScore() << endl; break; case HOLD: _players[p]->addCurrScore(); cout << "Player " << p + 1 << " holds - current score: " << _players[p]->getCurrScore() << endl << endl; if( _players[p]->getCurrScore() >= MAX_POINTS ) endGame = true; else nextTurn( p ); } } showScore(); } private: void nextTurn( int& p ) { _players[p]->zeroRoundScore(); ++p %= PLAYERS; } void showScore() { cout << endl; cout << "Player I (RAND): " << _players[0]->getCurrScore() << endl; cout << "Player II (Q2WIN): " << _players[1]->getCurrScore() << endl; cout << "Player III (AL20): " << _players[2]->getCurrScore() << endl; cout << "Player IV (AL20T): " << _players[3]->getCurrScore() << endl << endl << endl; system( "pause" ); } player* _players[PLAYERS]; }; int main( int argc, char* argv[] ) { srand( GetTickCount() ); Auto_pigGame pg; pg.play(); return 0; }
Write the same algorithm in C++ as shown in this Go implementation.
package pig import ( "fmt" "math/rand" "time" ) type ( PlayerID int MessageID int StrategyID int PigGameData struct { player PlayerID turnCount int turnRollCount int turnScore int lastRoll int scores [2]int verbose bool } ) const ( gameOver = iota piggedOut rolls pointSpending holds turn gameOverSummary player1 = PlayerID(0) player2 = PlayerID(1) noPlayer = PlayerID(-1) maxScore = 100 scoreChaseStrat = iota rollCountStrat ) func pluralS(n int) string { if n != 1 { return "s" } return "" } func New() *PigGameData { return &PigGameData{0, 0, 0, 0, 0, [2]int{0, 0}, false} } func (pg *PigGameData) statusMessage(id MessageID) string { var msg string switch id { case gameOver: msg = fmt.Sprintf("Game is over after %d turns", pg.turnCount) case piggedOut: msg = fmt.Sprintf(" Pigged out after %d roll%s", pg.turnRollCount, pluralS(pg.turnRollCount)) case rolls: msg = fmt.Sprintf(" Rolls %d", pg.lastRoll) case pointSpending: msg = fmt.Sprintf(" %d point%s pending", pg.turnScore, pluralS(pg.turnScore)) case holds: msg = fmt.Sprintf(" Holds after %d turns, adding %d points for a total of %d", pg.turnRollCount, pg.turnScore, pg.PlayerScore(noPlayer)) case turn: msg = fmt.Sprintf("Player %d's turn:", pg.player+1) case gameOverSummary: msg = fmt.Sprintf("Game over after %d turns\n player 1 %d\n player 2 %d\n", pg.turnCount, pg.PlayerScore(player1), pg.PlayerScore(player2)) } return msg } func (pg *PigGameData) PrintStatus(id MessageID) { if pg.verbose { fmt.Println(pg.statusMessage(id)) } } func (pg *PigGameData) Play(id StrategyID) (keepPlaying bool) { if pg.GameOver() { pg.PrintStatus(gameOver) return false } if pg.turnCount == 0 { pg.player = player2 pg.NextPlayer() } pg.lastRoll = rand.Intn(6) + 1 pg.PrintStatus(rolls) pg.turnRollCount++ if pg.lastRoll == 1 { pg.PrintStatus(piggedOut) pg.NextPlayer() } else { pg.turnScore += pg.lastRoll pg.PrintStatus(pointSpending) success := false switch id { case scoreChaseStrat: success = pg.scoreChaseStrategy() case rollCountStrat: success = pg.rollCountStrategy() } if success { pg.Hold() pg.NextPlayer() } } return true } func (pg *PigGameData) PlayerScore(id PlayerID) int { if id == noPlayer { return pg.scores[pg.player] } return pg.scores[id] } func (pg *PigGameData) GameOver() bool { return pg.scores[player1] >= maxScore || pg.scores[player2] >= maxScore } func (pg *PigGameData) Winner() PlayerID { for index, score := range pg.scores { if score >= maxScore { return PlayerID(index) } } return noPlayer } func (pg *PigGameData) otherPlayer() PlayerID { return 1 - pg.player } func (pg *PigGameData) Hold() { pg.scores[pg.player] += pg.turnScore pg.PrintStatus(holds) pg.turnRollCount, pg.turnScore = 0, 0 } func (pg *PigGameData) NextPlayer() { pg.turnCount++ pg.turnRollCount, pg.turnScore = 0, 0 pg.player = pg.otherPlayer() pg.PrintStatus(turn) } func (pg *PigGameData) rollCountStrategy() bool { return pg.turnRollCount >= 3 } func (pg *PigGameData) scoreChaseStrategy() bool { myScore := pg.PlayerScore(pg.player) otherScore := pg.PlayerScore(pg.otherPlayer()) myPendingScore := pg.turnScore + myScore return myPendingScore >= maxScore || myPendingScore > otherScore || pg.turnRollCount >= 5 } func main() { rand.Seed(time.Now().UnixNano()) pg := New() pg.verbose = true strategies := [2]StrategyID{scoreChaseStrat, rollCountStrat} for !pg.GameOver() { pg.Play(strategies[pg.player]) } pg.PrintStatus(gameOverSummary) }
#include <windows.h> #include <iostream> #include <string> using namespace std; const int PLAYERS = 4, MAX_POINTS = 100; enum Moves { ROLL, HOLD }; class player { public: player() { current_score = round_score = 0; } void addCurrScore() { current_score += round_score; } int getCurrScore() { return current_score; } int getRoundScore() { return round_score; } void addRoundScore( int rs ) { round_score += rs; } void zeroRoundScore() { round_score = 0; } virtual int getMove() = 0; virtual ~player() {} protected: int current_score, round_score; }; class RAND_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; if( rand() % 10 < 5 ) return ROLL; if( round_score > 0 ) return HOLD; return ROLL; } }; class Q2WIN_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; int q = MAX_POINTS - current_score; if( q < 6 ) return ROLL; q /= 4; if( round_score < q ) return ROLL; return HOLD; } }; class AL20_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; if( round_score < 20 ) return ROLL; return HOLD; } }; class AL20T_Player : public player { virtual int getMove() { if( round_score + current_score >= MAX_POINTS ) return HOLD; int d = ( 100 * round_score ) / 20; if( round_score < 20 && d < rand() % 100 ) return ROLL; return HOLD; } }; class Auto_pigGame { public: Auto_pigGame() { _players[0] = new RAND_Player(); _players[1] = new Q2WIN_Player(); _players[2] = new AL20_Player(); _players[3] = new AL20T_Player(); } ~Auto_pigGame() { delete _players[0]; delete _players[1]; delete _players[2]; delete _players[3]; } void play() { int die, p = 0; bool endGame = false; while( !endGame ) { switch( _players[p]->getMove() ) { case ROLL: die = rand() % 6 + 1; if( die == 1 ) { cout << "Player " << p + 1 << " rolled " << die << " - current score: " << _players[p]->getCurrScore() << endl << endl; nextTurn( p ); continue; } _players[p]->addRoundScore( die ); cout << "Player " << p + 1 << " rolled " << die << " - round score: " << _players[p]->getRoundScore() << endl; break; case HOLD: _players[p]->addCurrScore(); cout << "Player " << p + 1 << " holds - current score: " << _players[p]->getCurrScore() << endl << endl; if( _players[p]->getCurrScore() >= MAX_POINTS ) endGame = true; else nextTurn( p ); } } showScore(); } private: void nextTurn( int& p ) { _players[p]->zeroRoundScore(); ++p %= PLAYERS; } void showScore() { cout << endl; cout << "Player I (RAND): " << _players[0]->getCurrScore() << endl; cout << "Player II (Q2WIN): " << _players[1]->getCurrScore() << endl; cout << "Player III (AL20): " << _players[2]->getCurrScore() << endl; cout << "Player IV (AL20T): " << _players[3]->getCurrScore() << endl << endl << endl; system( "pause" ); } player* _players[PLAYERS]; }; int main( int argc, char* argv[] ) { srand( GetTickCount() ); Auto_pigGame pg; pg.play(); return 0; }
Write a version of this Go function in C++ with identical behavior.
package cf import "math" type NG8 struct { A12, A1, A2, A int64 B12, B1, B2, B int64 } var ( NG8Add = NG8{0, 1, 1, 0, 0, 0, 0, 1} NG8Sub = NG8{0, 1, -1, 0, 0, 0, 0, 1} NG8Mul = NG8{1, 0, 0, 0, 0, 0, 0, 1} NG8Div = NG8{0, 1, 0, 0, 0, 0, 1, 0} ) func (ng *NG8) needsIngest() bool { if ng.B12 == 0 || ng.B1 == 0 || ng.B2 == 0 || ng.B == 0 { return true } x := ng.A / ng.B return ng.A1/ng.B1 != x || ng.A2/ng.B2 != x && ng.A12/ng.B12 != x } func (ng *NG8) isDone() bool { return ng.B12 == 0 && ng.B1 == 0 && ng.B2 == 0 && ng.B == 0 } func (ng *NG8) ingestWhich() bool { if ng.B == 0 && ng.B2 == 0 { return true } if ng.B == 0 || ng.B2 == 0 { return false } x1 := float64(ng.A1) / float64(ng.B1) x2 := float64(ng.A2) / float64(ng.B2) x := float64(ng.A) / float64(ng.B) return math.Abs(x1-x) > math.Abs(x2-x) } func (ng *NG8) ingest(isN1 bool, t int64) { if isN1 { ng.A12, ng.A1, ng.A2, ng.A, ng.B12, ng.B1, ng.B2, ng.B = ng.A2+ng.A12*t, ng.A+ng.A1*t, ng.A12, ng.A1, ng.B2+ng.B12*t, ng.B+ng.B1*t, ng.B12, ng.B1 } else { ng.A12, ng.A1, ng.A2, ng.A, ng.B12, ng.B1, ng.B2, ng.B = ng.A1+ng.A12*t, ng.A12, ng.A+ng.A2*t, ng.A2, ng.B1+ng.B12*t, ng.B12, ng.B+ng.B2*t, ng.B2 } } func (ng *NG8) ingestInfinite(isN1 bool) { if isN1 { ng.A2, ng.A, ng.B2, ng.B = ng.A12, ng.A1, ng.B12, ng.B1 } else { ng.A1, ng.A, ng.B1, ng.B = ng.A12, ng.A2, ng.B12, ng.B2 } } func (ng *NG8) egest(t int64) { ng.A12, ng.A1, ng.A2, ng.A, ng.B12, ng.B1, ng.B2, ng.B = ng.B12, ng.B1, ng.B2, ng.B, ng.A12-ng.B12*t, ng.A1-ng.B1*t, ng.A2-ng.B2*t, ng.A-ng.B*t } func (ng NG8) ApplyTo(N1, N2 ContinuedFraction, limit int) ContinuedFraction { return func() NextFn { next1, next2 := N1(), N2() done := false sinceEgest := 0 return func() (int64, bool) { if done { return 0, false } for ng.needsIngest() { sinceEgest++ if sinceEgest > limit { done = true return 0, false } isN1 := ng.ingestWhich() next := next2 if isN1 { next = next1 } if t, ok := next(); ok { ng.ingest(isN1, t) } else { ng.ingestInfinite(isN1) } } sinceEgest = 0 t := ng.A / ng.B ng.egest(t) done = ng.isDone() return t, true } } }
class NG_8 : public matrixNG { private: int a12, a1, a2, a, b12, b1, b2, b, t; double ab, a1b1, a2b2, a12b12; const int chooseCFN(){return fabs(a1b1-ab) > fabs(a2b2-ab)? 0 : 1;} const bool needTerm() { if (b1==0 and b==0 and b2==0 and b12==0) return false; if (b==0){cfn = b2==0? 0:1; return true;} else ab = ((double)a)/b; if (b2==0){cfn = 1; return true;} else a2b2 = ((double)a2)/b2; if (b1==0){cfn = 0; return true;} else a1b1 = ((double)a1)/b1; if (b12==0){cfn = chooseCFN(); return true;} else a12b12 = ((double)a12)/b12; thisTerm = (int)ab; if (thisTerm==(int)a1b1 and thisTerm==(int)a2b2 and thisTerm==(int)a12b12){ t=a; a=b; b=t-b*thisTerm; t=a1; a1=b1; b1=t-b1*thisTerm; t=a2; a2=b2; b2=t-b2*thisTerm; t=a12; a12=b12; b12=t-b12*thisTerm; haveTerm = true; return false; } cfn = chooseCFN(); return true; } void consumeTerm(){if(cfn==0){a=a1; a2=a12; b=b1; b2=b12;} else{a=a2; a1=a12; b=b2; b1=b12;}} void consumeTerm(int n){ if(cfn==0){t=a; a=a1; a1=t+a1*n; t=a2; a2=a12; a12=t+a12*n; t=b; b=b1; b1=t+b1*n; t=b2; b2=b12; b12=t+b12*n;} else{t=a; a=a2; a2=t+a2*n; t=a1; a1=a12; a12=t+a12*n; t=b; b=b2; b2=t+b2*n; t=b1; b1=b12; b12=t+b12*n;} } public: NG_8(int a12, int a1, int a2, int a, int b12, int b1, int b2, int b): a12(a12), a1(a1), a2(a2), a(a), b12(b12), b1(b1), b2(b2), b(b){ }};
Convert this Go block to C++, preserving its control flow and logic.
package cf import "math" type NG8 struct { A12, A1, A2, A int64 B12, B1, B2, B int64 } var ( NG8Add = NG8{0, 1, 1, 0, 0, 0, 0, 1} NG8Sub = NG8{0, 1, -1, 0, 0, 0, 0, 1} NG8Mul = NG8{1, 0, 0, 0, 0, 0, 0, 1} NG8Div = NG8{0, 1, 0, 0, 0, 0, 1, 0} ) func (ng *NG8) needsIngest() bool { if ng.B12 == 0 || ng.B1 == 0 || ng.B2 == 0 || ng.B == 0 { return true } x := ng.A / ng.B return ng.A1/ng.B1 != x || ng.A2/ng.B2 != x && ng.A12/ng.B12 != x } func (ng *NG8) isDone() bool { return ng.B12 == 0 && ng.B1 == 0 && ng.B2 == 0 && ng.B == 0 } func (ng *NG8) ingestWhich() bool { if ng.B == 0 && ng.B2 == 0 { return true } if ng.B == 0 || ng.B2 == 0 { return false } x1 := float64(ng.A1) / float64(ng.B1) x2 := float64(ng.A2) / float64(ng.B2) x := float64(ng.A) / float64(ng.B) return math.Abs(x1-x) > math.Abs(x2-x) } func (ng *NG8) ingest(isN1 bool, t int64) { if isN1 { ng.A12, ng.A1, ng.A2, ng.A, ng.B12, ng.B1, ng.B2, ng.B = ng.A2+ng.A12*t, ng.A+ng.A1*t, ng.A12, ng.A1, ng.B2+ng.B12*t, ng.B+ng.B1*t, ng.B12, ng.B1 } else { ng.A12, ng.A1, ng.A2, ng.A, ng.B12, ng.B1, ng.B2, ng.B = ng.A1+ng.A12*t, ng.A12, ng.A+ng.A2*t, ng.A2, ng.B1+ng.B12*t, ng.B12, ng.B+ng.B2*t, ng.B2 } } func (ng *NG8) ingestInfinite(isN1 bool) { if isN1 { ng.A2, ng.A, ng.B2, ng.B = ng.A12, ng.A1, ng.B12, ng.B1 } else { ng.A1, ng.A, ng.B1, ng.B = ng.A12, ng.A2, ng.B12, ng.B2 } } func (ng *NG8) egest(t int64) { ng.A12, ng.A1, ng.A2, ng.A, ng.B12, ng.B1, ng.B2, ng.B = ng.B12, ng.B1, ng.B2, ng.B, ng.A12-ng.B12*t, ng.A1-ng.B1*t, ng.A2-ng.B2*t, ng.A-ng.B*t } func (ng NG8) ApplyTo(N1, N2 ContinuedFraction, limit int) ContinuedFraction { return func() NextFn { next1, next2 := N1(), N2() done := false sinceEgest := 0 return func() (int64, bool) { if done { return 0, false } for ng.needsIngest() { sinceEgest++ if sinceEgest > limit { done = true return 0, false } isN1 := ng.ingestWhich() next := next2 if isN1 { next = next1 } if t, ok := next(); ok { ng.ingest(isN1, t) } else { ng.ingestInfinite(isN1) } } sinceEgest = 0 t := ng.A / ng.B ng.egest(t) done = ng.isDone() return t, true } } }
class NG_8 : public matrixNG { private: int a12, a1, a2, a, b12, b1, b2, b, t; double ab, a1b1, a2b2, a12b12; const int chooseCFN(){return fabs(a1b1-ab) > fabs(a2b2-ab)? 0 : 1;} const bool needTerm() { if (b1==0 and b==0 and b2==0 and b12==0) return false; if (b==0){cfn = b2==0? 0:1; return true;} else ab = ((double)a)/b; if (b2==0){cfn = 1; return true;} else a2b2 = ((double)a2)/b2; if (b1==0){cfn = 0; return true;} else a1b1 = ((double)a1)/b1; if (b12==0){cfn = chooseCFN(); return true;} else a12b12 = ((double)a12)/b12; thisTerm = (int)ab; if (thisTerm==(int)a1b1 and thisTerm==(int)a2b2 and thisTerm==(int)a12b12){ t=a; a=b; b=t-b*thisTerm; t=a1; a1=b1; b1=t-b1*thisTerm; t=a2; a2=b2; b2=t-b2*thisTerm; t=a12; a12=b12; b12=t-b12*thisTerm; haveTerm = true; return false; } cfn = chooseCFN(); return true; } void consumeTerm(){if(cfn==0){a=a1; a2=a12; b=b1; b2=b12;} else{a=a2; a1=a12; b=b2; b1=b12;}} void consumeTerm(int n){ if(cfn==0){t=a; a=a1; a1=t+a1*n; t=a2; a2=a12; a12=t+a12*n; t=b; b=b1; b1=t+b1*n; t=b2; b2=b12; b12=t+b12*n;} else{t=a; a=a2; a2=t+a2*n; t=a1; a1=a12; a12=t+a12*n; t=b; b=b2; b2=t+b2*n; t=b1; b1=b12; b12=t+b12*n;} } public: NG_8(int a12, int a1, int a2, int a, int b12, int b1, int b2, int b): a12(a12), a1(a1), a2(a2), a(a), b12(b12), b1(b1), b2(b2), b(b){ }};
Rewrite the snippet below in C++ so it works the same as the original Go code.
package main import ( "flag" "fmt" "math" "math/big" "os" ) var maxRev = big.NewInt(math.MaxUint64 / 10) var ten = big.NewInt(10) func reverseInt(v *big.Int, result *big.Int) *big.Int { if v.Cmp(maxRev) <= 0 { result.SetUint64(reverseUint64(v.Uint64())) } else { if true { s := reverseString(v.String()) result.SetString(s, 10) } else { v := new(big.Int).Set(v) digit := new(big.Int) result.SetUint64(0) for v.BitLen() > 0 { v.QuoRem(v, ten, digit) result.Mul(result, ten) result.Add(result, digit) } } } return result } func reverseUint64(v uint64) uint64 { var r uint64 for v > 0 { r *= 10 r += v % 10 v /= 10 } return r } func reverseString(s string) string { b := make([]byte, len(s)) for i, j := 0, len(s)-1; j >= 0; i, j = i+1, j-1 { b[i] = s[j] } return string(b) } var known = make(map[string]bool) func Lychrel(n uint64, iter uint) (isLychrel, isSeed bool) { v, r := new(big.Int).SetUint64(n), new(big.Int) reverseInt(v, r) seen := make(map[string]bool) isLychrel = true isSeed = true for i := iter; i > 0; i-- { str := v.String() if seen[str] { isLychrel = true break } if ans, ok := known[str]; ok { isLychrel = ans isSeed = false break } seen[str] = true v = v.Add(v, r) reverseInt(v, r) if v.Cmp(r) == 0 { isLychrel = false isSeed = false break } } for k := range seen { known[k] = isLychrel } return isLychrel, isSeed } func main() { max := flag.Uint64("max", 10000, "search in the range 1..`N` inclusive") iter := flag.Uint("iter", 500, "limit palindrome search to `N` iterations") flag.Parse() if flag.NArg() != 0 { flag.Usage() os.Exit(2) } fmt.Printf("Calculating using n = 1..%v and %v iterations:\n", *max, *iter) var seeds []uint64 var related int var pals []uint64 for i := uint64(1); i <= *max; i++ { if l, s := Lychrel(i, *iter); l { if s { seeds = append(seeds, i) } else { related++ } if i == reverseUint64(i) { pals = append(pals, i) } } } fmt.Println(" Number of Lychrel seeds:", len(seeds)) fmt.Println(" Lychrel seeds:", seeds) fmt.Println(" Number of related:", related) fmt.Println("Number of Lychrel palindromes:", len(pals)) fmt.Println(" Lychrel palindromes:", pals) }
#include <iostream> #include <map> #include <vector> #include <gmpxx.h> using integer = mpz_class; integer reverse(integer n) { integer rev = 0; while (n > 0) { rev = rev * 10 + (n % 10); n /= 10; } return rev; } void print_vector(const std::vector<integer>& vec) { if (vec.empty()) return; auto i = vec.begin(); std::cout << *i++; for (; i != vec.end(); ++i) std::cout << ", " << *i; std::cout << '\n'; } int main() { std::map<integer, std::pair<bool, integer>> cache; std::vector<integer> seeds, related, palindromes; for (integer n = 1; n <= 10000; ++n) { std::pair<bool, integer> p(true, n); std::vector<integer> seen; integer rev = reverse(n); integer sum = n; for (int i = 0; i < 500; ++i) { sum += rev; rev = reverse(sum); if (rev == sum) { p.first = false; p.second = 0; break; } auto iter = cache.find(sum); if (iter != cache.end()) { p = iter->second; break; } seen.push_back(sum); } for (integer s : seen) cache.emplace(s, p); if (!p.first) continue; if (p.second == n) seeds.push_back(n); else related.push_back(n); if (n == reverse(n)) palindromes.push_back(n); } std::cout << "number of seeds: " << seeds.size() << '\n'; std::cout << "seeds: "; print_vector(seeds); std::cout << "number of related: " << related.size() << '\n'; std::cout << "palindromes: "; print_vector(palindromes); return 0; }
Write the same code in C++ as shown below in Go.
package main import ( "flag" "fmt" "math" "math/big" "os" ) var maxRev = big.NewInt(math.MaxUint64 / 10) var ten = big.NewInt(10) func reverseInt(v *big.Int, result *big.Int) *big.Int { if v.Cmp(maxRev) <= 0 { result.SetUint64(reverseUint64(v.Uint64())) } else { if true { s := reverseString(v.String()) result.SetString(s, 10) } else { v := new(big.Int).Set(v) digit := new(big.Int) result.SetUint64(0) for v.BitLen() > 0 { v.QuoRem(v, ten, digit) result.Mul(result, ten) result.Add(result, digit) } } } return result } func reverseUint64(v uint64) uint64 { var r uint64 for v > 0 { r *= 10 r += v % 10 v /= 10 } return r } func reverseString(s string) string { b := make([]byte, len(s)) for i, j := 0, len(s)-1; j >= 0; i, j = i+1, j-1 { b[i] = s[j] } return string(b) } var known = make(map[string]bool) func Lychrel(n uint64, iter uint) (isLychrel, isSeed bool) { v, r := new(big.Int).SetUint64(n), new(big.Int) reverseInt(v, r) seen := make(map[string]bool) isLychrel = true isSeed = true for i := iter; i > 0; i-- { str := v.String() if seen[str] { isLychrel = true break } if ans, ok := known[str]; ok { isLychrel = ans isSeed = false break } seen[str] = true v = v.Add(v, r) reverseInt(v, r) if v.Cmp(r) == 0 { isLychrel = false isSeed = false break } } for k := range seen { known[k] = isLychrel } return isLychrel, isSeed } func main() { max := flag.Uint64("max", 10000, "search in the range 1..`N` inclusive") iter := flag.Uint("iter", 500, "limit palindrome search to `N` iterations") flag.Parse() if flag.NArg() != 0 { flag.Usage() os.Exit(2) } fmt.Printf("Calculating using n = 1..%v and %v iterations:\n", *max, *iter) var seeds []uint64 var related int var pals []uint64 for i := uint64(1); i <= *max; i++ { if l, s := Lychrel(i, *iter); l { if s { seeds = append(seeds, i) } else { related++ } if i == reverseUint64(i) { pals = append(pals, i) } } } fmt.Println(" Number of Lychrel seeds:", len(seeds)) fmt.Println(" Lychrel seeds:", seeds) fmt.Println(" Number of related:", related) fmt.Println("Number of Lychrel palindromes:", len(pals)) fmt.Println(" Lychrel palindromes:", pals) }
#include <iostream> #include <map> #include <vector> #include <gmpxx.h> using integer = mpz_class; integer reverse(integer n) { integer rev = 0; while (n > 0) { rev = rev * 10 + (n % 10); n /= 10; } return rev; } void print_vector(const std::vector<integer>& vec) { if (vec.empty()) return; auto i = vec.begin(); std::cout << *i++; for (; i != vec.end(); ++i) std::cout << ", " << *i; std::cout << '\n'; } int main() { std::map<integer, std::pair<bool, integer>> cache; std::vector<integer> seeds, related, palindromes; for (integer n = 1; n <= 10000; ++n) { std::pair<bool, integer> p(true, n); std::vector<integer> seen; integer rev = reverse(n); integer sum = n; for (int i = 0; i < 500; ++i) { sum += rev; rev = reverse(sum); if (rev == sum) { p.first = false; p.second = 0; break; } auto iter = cache.find(sum); if (iter != cache.end()) { p = iter->second; break; } seen.push_back(sum); } for (integer s : seen) cache.emplace(s, p); if (!p.first) continue; if (p.second == n) seeds.push_back(n); else related.push_back(n); if (n == reverse(n)) palindromes.push_back(n); } std::cout << "number of seeds: " << seeds.size() << '\n'; std::cout << "seeds: "; print_vector(seeds); std::cout << "number of related: " << related.size() << '\n'; std::cout << "palindromes: "; print_vector(palindromes); return 0; }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "fmt" "strconv" "strings" ) func main() { const nondecimal = "abcdef" c := 0 for i := int64(0); i <= 500; i++ { hex := strconv.FormatInt(i, 16) if strings.ContainsAny(nondecimal, hex) { fmt.Printf("%3d ", i) c++ if c%15 == 0 { fmt.Println() } } } fmt.Printf("\n\n%d such numbers found.\n", c) }
#include <iomanip> #include <iostream> bool nondecimal(unsigned int n) { for (; n > 0; n >>= 4) { if ((n & 0xF) > 9) return true; } return false; } int main() { unsigned int count = 0; for (unsigned int n = 0; n < 501; ++n) { if (nondecimal(n)) { ++count; std::cout << std::setw(3) << n << (count % 15 == 0 ? '\n' : ' '); } } std::cout << "\n\n" << count << " such numbers found.\n"; }
Port the following code from Go to C++ with equivalent syntax and logic.
package main import ( "fmt" "strconv" "strings" ) func main() { const nondecimal = "abcdef" c := 0 for i := int64(0); i <= 500; i++ { hex := strconv.FormatInt(i, 16) if strings.ContainsAny(nondecimal, hex) { fmt.Printf("%3d ", i) c++ if c%15 == 0 { fmt.Println() } } } fmt.Printf("\n\n%d such numbers found.\n", c) }
#include <iomanip> #include <iostream> bool nondecimal(unsigned int n) { for (; n > 0; n >>= 4) { if ((n & 0xF) > 9) return true; } return false; } int main() { unsigned int count = 0; for (unsigned int n = 0; n < 501; ++n) { if (nondecimal(n)) { ++count; std::cout << std::setw(3) << n << (count % 15 == 0 ? '\n' : ' '); } } std::cout << "\n\n" << count << " such numbers found.\n"; }
Translate this program into C++ but keep the logic exactly as in Go.
package main import ( "fmt" "math" "rcu" ) var limit = int(math.Log(1e6) * 1e6 * 1.2) var primes = rcu.Primes(limit) var prevCats = make(map[int]int) func cat(p int) int { if v, ok := prevCats[p]; ok { return v } pf := rcu.PrimeFactors(p + 1) all := true for _, f := range pf { if f != 2 && f != 3 { all = false break } } if all { return 1 } if p > 2 { len := len(pf) for i := len - 1; i >= 1; i-- { if pf[i-1] == pf[i] { pf = append(pf[:i], pf[i+1:]...) } } } for c := 2; c <= 11; c++ { all := true for _, f := range pf { if cat(f) >= c { all = false break } } if all { prevCats[p] = c return c } } return 12 } func main() { es := make([][]int, 12) fmt.Println("First 200 primes:\n") for _, p := range primes[0:200] { c := cat(p) es[c-1] = append(es[c-1], p) } for c := 1; c <= 6; c++ { if len(es[c-1]) > 0 { fmt.Println("Category", c, "\b:") fmt.Println(es[c-1]) fmt.Println() } } fmt.Println("First million primes:\n") for _, p := range primes[200:1e6] { c := cat(p) es[c-1] = append(es[c-1], p) } for c := 1; c <= 12; c++ { e := es[c-1] if len(e) > 0 { format := "Category %-2d: First = %7d Last = %8d Count = %6d\n" fmt.Printf(format, c, e[0], e[len(e)-1], len(e)) } } }
#include <algorithm> #include <cassert> #include <iomanip> #include <iostream> #include <map> #include <vector> #include <primesieve.hpp> class erdos_selfridge { public: explicit erdos_selfridge(int limit); uint64_t get_prime(int index) const { return primes_[index].first; } int get_category(int index); private: std::vector<std::pair<uint64_t, int>> primes_; size_t get_index(uint64_t prime) const; }; erdos_selfridge::erdos_selfridge(int limit) { primesieve::iterator iter; for (int i = 0; i < limit; ++i) primes_.emplace_back(iter.next_prime(), 0); } int erdos_selfridge::get_category(int index) { auto& pair = primes_[index]; if (pair.second != 0) return pair.second; int max_category = 0; uint64_t n = pair.first + 1; for (int i = 0; n > 1; ++i) { uint64_t p = primes_[i].first; if (p * p > n) break; int count = 0; for (; n % p == 0; ++count) n /= p; if (count != 0) { int category = (p <= 3) ? 1 : 1 + get_category(i); max_category = std::max(max_category, category); } } if (n > 1) { int category = (n <= 3) ? 1 : 1 + get_category(get_index(n)); max_category = std::max(max_category, category); } pair.second = max_category; return max_category; } size_t erdos_selfridge::get_index(uint64_t prime) const { auto it = std::lower_bound(primes_.begin(), primes_.end(), prime, [](const std::pair<uint64_t, int>& p, uint64_t n) { return p.first < n; }); assert(it != primes_.end()); assert(it->first == prime); return std::distance(primes_.begin(), it); } auto get_primes_by_category(erdos_selfridge& es, int limit) { std::map<int, std::vector<uint64_t>> primes_by_category; for (int i = 0; i < limit; ++i) { uint64_t prime = es.get_prime(i); int category = es.get_category(i); primes_by_category[category].push_back(prime); } return primes_by_category; } int main() { const int limit1 = 200, limit2 = 1000000; erdos_selfridge es(limit2); std::cout << "First 200 primes:\n"; for (const auto& p : get_primes_by_category(es, limit1)) { std::cout << "Category " << p.first << ":\n"; for (size_t i = 0, n = p.second.size(); i != n; ++i) { std::cout << std::setw(4) << p.second[i] << ((i + 1) % 15 == 0 ? '\n' : ' '); } std::cout << "\n\n"; } std::cout << "First 1,000,000 primes:\n"; for (const auto& p : get_primes_by_category(es, limit2)) { const auto& v = p.second; std::cout << "Category " << std::setw(2) << p.first << ": " << "first = " << std::setw(7) << v.front() << " last = " << std::setw(8) << v.back() << " count = " << v.size() << '\n'; } }
Change the programming language of this snippet from Go to C++ without modifying what it does.
package main import ( "fmt" "strings" ) type rng struct{ from, to int } type fn func(rngs *[]rng, n int) func (r rng) String() string { return fmt.Sprintf("%d-%d", r.from, r.to) } func rangesAdd(rngs []rng, n int) []rng { if len(rngs) == 0 { rngs = append(rngs, rng{n, n}) return rngs } for i, r := range rngs { if n < r.from-1 { rngs = append(rngs, rng{}) copy(rngs[i+1:], rngs[i:]) rngs[i] = rng{n, n} return rngs } else if n == r.from-1 { rngs[i] = rng{n, r.to} return rngs } else if n <= r.to { return rngs } else if n == r.to+1 { rngs[i] = rng{r.from, n} if i < len(rngs)-1 && (n == rngs[i+1].from || n+1 == rngs[i+1].from) { rngs[i] = rng{r.from, rngs[i+1].to} copy(rngs[i+1:], rngs[i+2:]) rngs[len(rngs)-1] = rng{} rngs = rngs[:len(rngs)-1] } return rngs } else if i == len(rngs)-1 { rngs = append(rngs, rng{n, n}) return rngs } } return rngs } func rangesRemove(rngs []rng, n int) []rng { if len(rngs) == 0 { return rngs } for i, r := range rngs { if n <= r.from-1 { return rngs } else if n == r.from && n == r.to { copy(rngs[i:], rngs[i+1:]) rngs[len(rngs)-1] = rng{} rngs = rngs[:len(rngs)-1] return rngs } else if n == r.from { rngs[i] = rng{n + 1, r.to} return rngs } else if n < r.to { rngs[i] = rng{r.from, n - 1} rngs = append(rngs, rng{}) copy(rngs[i+2:], rngs[i+1:]) rngs[i+1] = rng{n + 1, r.to} return rngs } else if n == r.to { rngs[i] = rng{r.from, n - 1} return rngs } } return rngs } func standard(rngs []rng) string { if len(rngs) == 0 { return "" } var sb strings.Builder for _, r := range rngs { sb.WriteString(fmt.Sprintf("%s,", r)) } s := sb.String() return s[:len(s)-1] } func main() { const add = 0 const remove = 1 fns := []fn{ func(prngs *[]rng, n int) { *prngs = rangesAdd(*prngs, n) fmt.Printf(" add %2d => %s\n", n, standard(*prngs)) }, func(prngs *[]rng, n int) { *prngs = rangesRemove(*prngs, n) fmt.Printf(" remove %2d => %s\n", n, standard(*prngs)) }, } var rngs []rng ops := [][2]int{{add, 77}, {add, 79}, {add, 78}, {remove, 77}, {remove, 78}, {remove, 79}} fmt.Printf("Start: %q\n", standard(rngs)) for _, op := range ops { fns[op[0]](&rngs, op[1]) } rngs = []rng{{1, 3}, {5, 5}} ops = [][2]int{{add, 1}, {remove, 4}, {add, 7}, {add, 8}, {add, 6}, {remove, 7}} fmt.Printf("\nStart: %q\n", standard(rngs)) for _, op := range ops { fns[op[0]](&rngs, op[1]) } rngs = []rng{{1, 5}, {10, 25}, {27, 30}} ops = [][2]int{{add, 26}, {add, 9}, {add, 7}, {remove, 26}, {remove, 9}, {remove, 7}} fmt.Printf("\nStart: %q\n", standard(rngs)) for _, op := range ops { fns[op[0]](&rngs, op[1]) } }
#include <algorithm> #include <iomanip> #include <iostream> #include <list> struct range { range(int lo, int hi) : low(lo), high(hi) {} int low; int high; }; std::ostream& operator<<(std::ostream& out, const range& r) { return out << r.low << '-' << r.high; } class ranges { public: ranges() {} explicit ranges(std::initializer_list<range> init) : ranges_(init) {} void add(int n); void remove(int n); bool empty() const { return ranges_.empty(); } private: friend std::ostream& operator<<(std::ostream& out, const ranges& r); std::list<range> ranges_; }; void ranges::add(int n) { for (auto i = ranges_.begin(); i != ranges_.end(); ++i) { if (n + 1 < i->low) { ranges_.emplace(i, n, n); return; } if (n > i->high + 1) continue; if (n + 1 == i->low) i->low = n; else if (n == i->high + 1) i->high = n; else return; if (i != ranges_.begin()) { auto prev = std::prev(i); if (prev->high + 1 == i->low) { i->low = prev->low; ranges_.erase(prev); } } auto next = std::next(i); if (next != ranges_.end() && next->low - 1 == i->high) { i->high = next->high; ranges_.erase(next); } return; } ranges_.emplace_back(n, n); } void ranges::remove(int n) { for (auto i = ranges_.begin(); i != ranges_.end(); ++i) { if (n < i->low) return; if (n == i->low) { if (++i->low > i->high) ranges_.erase(i); return; } if (n == i->high) { if (--i->high < i->low) ranges_.erase(i); return; } if (n > i->low & n < i->high) { int low = i->low; i->low = n + 1; ranges_.emplace(i, low, n - 1); return; } } } std::ostream& operator<<(std::ostream& out, const ranges& r) { if (!r.empty()) { auto i = r.ranges_.begin(); out << *i++; for (; i != r.ranges_.end(); ++i) out << ',' << *i; } return out; } void test_add(ranges& r, int n) { r.add(n); std::cout << " add " << std::setw(2) << n << " => " << r << '\n'; } void test_remove(ranges& r, int n) { r.remove(n); std::cout << " remove " << std::setw(2) << n << " => " << r << '\n'; } void test1() { ranges r; std::cout << "Start: \"" << r << "\"\n"; test_add(r, 77); test_add(r, 79); test_add(r, 78); test_remove(r, 77); test_remove(r, 78); test_remove(r, 79); } void test2() { ranges r{{1,3}, {5,5}}; std::cout << "Start: \"" << r << "\"\n"; test_add(r, 1); test_remove(r, 4); test_add(r, 7); test_add(r, 8); test_add(r, 6); test_remove(r, 7); } void test3() { ranges r{{1,5}, {10,25}, {27,30}}; std::cout << "Start: \"" << r << "\"\n"; test_add(r, 26); test_add(r, 9); test_add(r, 7); test_remove(r, 26); test_remove(r, 9); test_remove(r, 7); } int main() { test1(); std::cout << '\n'; test2(); std::cout << '\n'; test3(); return 0; }
Generate a C++ translation of this Go snippet without changing its computational steps.
package main import ( "fmt" "log" big "github.com/ncw/gmp" "rcu" ) var zero = new(big.Int) var one = big.NewInt(1) var two = big.NewInt(2) func juggler(n int64) (int, int, *big.Int, int) { if n < 1 { log.Fatal("Starting value must be a positive integer.") } count := 0 maxCount := 0 a := big.NewInt(n) max := big.NewInt(n) tmp := new(big.Int) for a.Cmp(one) != 0 { if tmp.Rem(a, two).Cmp(zero) == 0 { a.Sqrt(a) } else { tmp.Mul(a, a) tmp.Mul(tmp, a) a.Sqrt(tmp) } count++ if a.Cmp(max) > 0 { max.Set(a) maxCount = count } } return count, maxCount, max, len(max.String()) } func main() { fmt.Println("n l[n] i[n] h[n]") fmt.Println("-----------------------------------") for n := int64(20); n < 40; n++ { count, maxCount, max, _ := juggler(n) cmax := rcu.Commatize(int(max.Int64())) fmt.Printf("%2d %2d %2d %s\n", n, count, maxCount, cmax) } fmt.Println() nums := []int64{ 113, 173, 193, 2183, 11229, 15065, 15845, 30817, 48443, 275485, 1267909, 2264915, 5812827, 7110201, 56261531, 92502777, 172376627, 604398963, } fmt.Println(" n l[n] i[n] d[n]") fmt.Println("-------------------------------------") for _, n := range nums { count, maxCount, _, digits := juggler(n) cn := rcu.Commatize(int(n)) fmt.Printf("%11s %3d %3d %s\n", cn, count, maxCount, rcu.Commatize(digits)) } }
#include <cassert> #include <iomanip> #include <iostream> #include <string> #include <gmpxx.h> using big_int = mpz_class; auto juggler(int n) { assert(n >= 1); int count = 0, max_count = 0; big_int a = n, max = n; while (a != 1) { if (a % 2 == 0) a = sqrt(a); else a = sqrt(big_int(a * a * a)); ++count; if (a > max) { max = a; max_count = count; } } return std::make_tuple(count, max_count, max, max.get_str().size()); } int main() { std::cout.imbue(std::locale("")); std::cout << "n l[n] i[n] h[n]\n"; std::cout << "--------------------------------\n"; for (int n = 20; n < 40; ++n) { auto [count, max_count, max, digits] = juggler(n); std::cout << std::setw(2) << n << " " << std::setw(2) << count << " " << std::setw(2) << max_count << " " << max << '\n'; } std::cout << '\n'; std::cout << " n l[n] i[n] d[n]\n"; std::cout << "----------------------------------------\n"; for (int n : {113, 173, 193, 2183, 11229, 15065, 15845, 30817, 48443, 275485, 1267909, 2264915, 5812827, 7110201, 56261531, 92502777, 172376627, 604398963}) { auto [count, max_count, max, digits] = juggler(n); std::cout << std::setw(11) << n << " " << std::setw(3) << count << " " << std::setw(3) << max_count << " " << digits << '\n'; } }
Please provide an equivalent version of this Go code in C++.
package main import ( "fmt" "log" big "github.com/ncw/gmp" "rcu" ) var zero = new(big.Int) var one = big.NewInt(1) var two = big.NewInt(2) func juggler(n int64) (int, int, *big.Int, int) { if n < 1 { log.Fatal("Starting value must be a positive integer.") } count := 0 maxCount := 0 a := big.NewInt(n) max := big.NewInt(n) tmp := new(big.Int) for a.Cmp(one) != 0 { if tmp.Rem(a, two).Cmp(zero) == 0 { a.Sqrt(a) } else { tmp.Mul(a, a) tmp.Mul(tmp, a) a.Sqrt(tmp) } count++ if a.Cmp(max) > 0 { max.Set(a) maxCount = count } } return count, maxCount, max, len(max.String()) } func main() { fmt.Println("n l[n] i[n] h[n]") fmt.Println("-----------------------------------") for n := int64(20); n < 40; n++ { count, maxCount, max, _ := juggler(n) cmax := rcu.Commatize(int(max.Int64())) fmt.Printf("%2d %2d %2d %s\n", n, count, maxCount, cmax) } fmt.Println() nums := []int64{ 113, 173, 193, 2183, 11229, 15065, 15845, 30817, 48443, 275485, 1267909, 2264915, 5812827, 7110201, 56261531, 92502777, 172376627, 604398963, } fmt.Println(" n l[n] i[n] d[n]") fmt.Println("-------------------------------------") for _, n := range nums { count, maxCount, _, digits := juggler(n) cn := rcu.Commatize(int(n)) fmt.Printf("%11s %3d %3d %s\n", cn, count, maxCount, rcu.Commatize(digits)) } }
#include <cassert> #include <iomanip> #include <iostream> #include <string> #include <gmpxx.h> using big_int = mpz_class; auto juggler(int n) { assert(n >= 1); int count = 0, max_count = 0; big_int a = n, max = n; while (a != 1) { if (a % 2 == 0) a = sqrt(a); else a = sqrt(big_int(a * a * a)); ++count; if (a > max) { max = a; max_count = count; } } return std::make_tuple(count, max_count, max, max.get_str().size()); } int main() { std::cout.imbue(std::locale("")); std::cout << "n l[n] i[n] h[n]\n"; std::cout << "--------------------------------\n"; for (int n = 20; n < 40; ++n) { auto [count, max_count, max, digits] = juggler(n); std::cout << std::setw(2) << n << " " << std::setw(2) << count << " " << std::setw(2) << max_count << " " << max << '\n'; } std::cout << '\n'; std::cout << " n l[n] i[n] d[n]\n"; std::cout << "----------------------------------------\n"; for (int n : {113, 173, 193, 2183, 11229, 15065, 15845, 30817, 48443, 275485, 1267909, 2264915, 5812827, 7110201, 56261531, 92502777, 172376627, 604398963}) { auto [count, max_count, max, digits] = juggler(n); std::cout << std::setw(11) << n << " " << std::setw(3) << count << " " << std::setw(3) << max_count << " " << digits << '\n'; } }
Ensure the translated C++ code behaves exactly like the original Go snippet.
package main import ( "github.com/fogleman/gg" "github.com/trubitsyn/go-lindenmayer" "log" "math" ) const twoPi = 2 * math.Pi var ( width = 770.0 height = 770.0 dc = gg.NewContext(int(width), int(height)) ) var cx, cy, h, theta float64 func main() { dc.SetRGB(0, 0, 1) dc.Clear() cx, cy = 10, height/2+5 h = 6 sys := lindenmayer.Lsystem{ Variables: []rune{'X'}, Constants: []rune{'F', '+', '-'}, Axiom: "F+XF+F+XF", Rules: []lindenmayer.Rule{ {"X", "XF-F+F-XF+F+XF-F+F-X"}, }, Angle: math.Pi / 2, } result := lindenmayer.Iterate(&sys, 5) operations := map[rune]func(){ 'F': func() { newX, newY := cx+h*math.Sin(theta), cy-h*math.Cos(theta) dc.LineTo(newX, newY) cx, cy = newX, newY }, '+': func() { theta = math.Mod(theta+sys.Angle, twoPi) }, '-': func() { theta = math.Mod(theta-sys.Angle, twoPi) }, } if err := lindenmayer.Process(result, operations); err != nil { log.Fatal(err) } operations['+']() operations['F']() dc.SetRGB255(255, 255, 0) dc.SetLineWidth(2) dc.Stroke() dc.SavePNG("sierpinski_square_curve.png") }
#include <cmath> #include <fstream> #include <iostream> #include <string> class sierpinski_square { public: void write(std::ostream& out, int size, int length, int order); private: static std::string rewrite(const std::string& s); void line(std::ostream& out); void execute(std::ostream& out, const std::string& s); double x_; double y_; int angle_; int length_; }; void sierpinski_square::write(std::ostream& out, int size, int length, int order) { length_ = length; x_ = (size - length)/2; y_ = length; angle_ = 0; out << "<svg xmlns='http: << size << "' height='" << size << "'>\n"; out << "<rect width='100%' height='100%' fill='white'/>\n"; out << "<path stroke-width='1' stroke='black' fill='none' d='"; std::string s = "F+XF+F+XF"; for (int i = 0; i < order; ++i) s = rewrite(s); execute(out, s); out << "'/>\n</svg>\n"; } std::string sierpinski_square::rewrite(const std::string& s) { std::string t; for (char c : s) { if (c == 'X') t += "XF-F+F-XF+F+XF-F+F-X"; else t += c; } return t; } void sierpinski_square::line(std::ostream& out) { double theta = (3.14159265359 * angle_)/180.0; x_ += length_ * std::cos(theta); y_ += length_ * std::sin(theta); out << " L" << x_ << ',' << y_; } void sierpinski_square::execute(std::ostream& out, const std::string& s) { out << 'M' << x_ << ',' << y_; for (char c : s) { switch (c) { case 'F': line(out); break; case '+': angle_ = (angle_ + 90) % 360; break; case '-': angle_ = (angle_ - 90) % 360; break; } } } int main() { std::ofstream out("sierpinski_square.svg"); if (!out) { std::cerr << "Cannot open output file\n"; return 1; } sierpinski_square s; s.write(out, 635, 5, 5); return 0; }
Generate a C++ translation of this Go snippet without changing its computational steps.
package main import ( "fmt" "math" "sort" ) const adj = 0.0001 var primes = []uint64{ 2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, 41, 43, 47, 53, 59, 61, 67, 71, 73, 79, 83, 89, 97, } func gcd(x, y uint64) uint64 { for y != 0 { x, y = y, x%y } return x } func isSquareFree(x uint64) bool { for _, p := range primes { p2 := p * p if p2 > x { break } if x%p2 == 0 { return false } } return true } func iroot(x, p uint64) uint64 { return uint64(math.Pow(float64(x), 1.0/float64(p)) + adj) } func ipow(x, p uint64) uint64 { prod := uint64(1) for p > 0 { if p&1 != 0 { prod *= x } p >>= 1 x *= x } return prod } func powerful(n, k uint64) []uint64 { set := make(map[uint64]bool) var f func(m, r uint64) f = func(m, r uint64) { if r < k { set[m] = true return } for v := uint64(1); v <= iroot(n/m, r); v++ { if r > k { if !isSquareFree(v) || gcd(m, v) != 1 { continue } } f(m*ipow(v, r), r-1) } } f(1, (1<<k)-1) list := make([]uint64, 0, len(set)) for key := range set { list = append(list, key) } sort.Slice(list, func(i, j int) bool { return list[i] < list[j] }) return list } func main() { power := uint64(10) for k := uint64(2); k <= 10; k++ { power *= 10 a := powerful(power, k) le := len(a) h, t := a[0:5], a[le-5:] fmt.Printf("%d %2d-powerful numbers <= 10^%-2d: %v ... %v\n", le, k, k, h, t) } fmt.Println() for k := uint64(2); k <= 10; k++ { power := uint64(1) var counts []int for j := uint64(0); j < k+10; j++ { a := powerful(power, k) counts = append(counts, len(a)) power *= 10 } j := k + 10 fmt.Printf("Count of %2d-powerful numbers <= 10^j, j in [0, %d): %v\n", k, j, counts) } }
#include <algorithm> #include <cmath> #include <cstdint> #include <iostream> #include <numeric> #include <vector> bool is_square_free(uint64_t n) { static constexpr uint64_t primes[] { 2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, 41, 43, 47, 53, 59, 61, 67, 71, 73, 79, 83, 89, 97 }; for (auto p : primes) { auto p2 = p * p; if (p2 > n) break; if (n % p2 == 0) return false; } return true; } uint64_t iroot(uint64_t n, uint64_t r) { static constexpr double adj = 1e-6; return static_cast<uint64_t>(std::pow(n, 1.0/r) + adj); } uint64_t ipow(uint64_t n, uint64_t p) { uint64_t prod = 1; for (; p > 0; p >>= 1) { if (p & 1) prod *= n; n *= n; } return prod; } std::vector<uint64_t> powerful(uint64_t n, uint64_t k) { std::vector<uint64_t> result; std::function<void(uint64_t, uint64_t)> f = [&](uint64_t m, uint64_t r) { if (r < k) { result.push_back(m); return; } uint64_t root = iroot(n/m, r); for (uint64_t v = 1; v <= root; ++v) { if (r > k && (!is_square_free(v) || std::gcd(m, v) != 1)) continue; f(m * ipow(v, r), r - 1); } }; f(1, 2*k - 1); std::sort(result.begin(), result.end()); return result; } uint64_t powerful_count(uint64_t n, uint64_t k) { uint64_t count = 0; std::function<void(uint64_t, uint64_t)> f = [&](uint64_t m, uint64_t r) { if (r <= k) { count += iroot(n/m, r); return; } uint64_t root = iroot(n/m, r); for (uint64_t v = 1; v <= root; ++v) { if (is_square_free(v) && std::gcd(m, v) == 1) f(m * ipow(v, r), r - 1); } }; f(1, 2*k - 1); return count; } int main() { const size_t max = 5; for (uint64_t k = 2, p = 100; k <= 10; ++k, p *= 10) { auto result = powerful(p, k); std::cout << result.size() << " " << k << "-powerful numbers <= 10^" << k << ":"; for (size_t i = 0; i < result.size(); ++i) { if (i == max) std::cout << " ..."; else if (i < max || i + max >= result.size()) std::cout << ' ' << result[i]; } std::cout << '\n'; } std::cout << '\n'; for (uint64_t k = 2; k <= 10; ++k) { std::cout << "Count of " << k << "-powerful numbers <= 10^j for 0 <= j < " << k + 10 << ":"; for (uint64_t j = 0, p = 1; j < k + 10; ++j, p *= 10) std::cout << ' ' << powerful_count(p, k); std::cout << '\n'; } }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "fmt" "math" "sort" ) const adj = 0.0001 var primes = []uint64{ 2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, 41, 43, 47, 53, 59, 61, 67, 71, 73, 79, 83, 89, 97, } func gcd(x, y uint64) uint64 { for y != 0 { x, y = y, x%y } return x } func isSquareFree(x uint64) bool { for _, p := range primes { p2 := p * p if p2 > x { break } if x%p2 == 0 { return false } } return true } func iroot(x, p uint64) uint64 { return uint64(math.Pow(float64(x), 1.0/float64(p)) + adj) } func ipow(x, p uint64) uint64 { prod := uint64(1) for p > 0 { if p&1 != 0 { prod *= x } p >>= 1 x *= x } return prod } func powerful(n, k uint64) []uint64 { set := make(map[uint64]bool) var f func(m, r uint64) f = func(m, r uint64) { if r < k { set[m] = true return } for v := uint64(1); v <= iroot(n/m, r); v++ { if r > k { if !isSquareFree(v) || gcd(m, v) != 1 { continue } } f(m*ipow(v, r), r-1) } } f(1, (1<<k)-1) list := make([]uint64, 0, len(set)) for key := range set { list = append(list, key) } sort.Slice(list, func(i, j int) bool { return list[i] < list[j] }) return list } func main() { power := uint64(10) for k := uint64(2); k <= 10; k++ { power *= 10 a := powerful(power, k) le := len(a) h, t := a[0:5], a[le-5:] fmt.Printf("%d %2d-powerful numbers <= 10^%-2d: %v ... %v\n", le, k, k, h, t) } fmt.Println() for k := uint64(2); k <= 10; k++ { power := uint64(1) var counts []int for j := uint64(0); j < k+10; j++ { a := powerful(power, k) counts = append(counts, len(a)) power *= 10 } j := k + 10 fmt.Printf("Count of %2d-powerful numbers <= 10^j, j in [0, %d): %v\n", k, j, counts) } }
#include <algorithm> #include <cmath> #include <cstdint> #include <iostream> #include <numeric> #include <vector> bool is_square_free(uint64_t n) { static constexpr uint64_t primes[] { 2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, 41, 43, 47, 53, 59, 61, 67, 71, 73, 79, 83, 89, 97 }; for (auto p : primes) { auto p2 = p * p; if (p2 > n) break; if (n % p2 == 0) return false; } return true; } uint64_t iroot(uint64_t n, uint64_t r) { static constexpr double adj = 1e-6; return static_cast<uint64_t>(std::pow(n, 1.0/r) + adj); } uint64_t ipow(uint64_t n, uint64_t p) { uint64_t prod = 1; for (; p > 0; p >>= 1) { if (p & 1) prod *= n; n *= n; } return prod; } std::vector<uint64_t> powerful(uint64_t n, uint64_t k) { std::vector<uint64_t> result; std::function<void(uint64_t, uint64_t)> f = [&](uint64_t m, uint64_t r) { if (r < k) { result.push_back(m); return; } uint64_t root = iroot(n/m, r); for (uint64_t v = 1; v <= root; ++v) { if (r > k && (!is_square_free(v) || std::gcd(m, v) != 1)) continue; f(m * ipow(v, r), r - 1); } }; f(1, 2*k - 1); std::sort(result.begin(), result.end()); return result; } uint64_t powerful_count(uint64_t n, uint64_t k) { uint64_t count = 0; std::function<void(uint64_t, uint64_t)> f = [&](uint64_t m, uint64_t r) { if (r <= k) { count += iroot(n/m, r); return; } uint64_t root = iroot(n/m, r); for (uint64_t v = 1; v <= root; ++v) { if (is_square_free(v) && std::gcd(m, v) == 1) f(m * ipow(v, r), r - 1); } }; f(1, 2*k - 1); return count; } int main() { const size_t max = 5; for (uint64_t k = 2, p = 100; k <= 10; ++k, p *= 10) { auto result = powerful(p, k); std::cout << result.size() << " " << k << "-powerful numbers <= 10^" << k << ":"; for (size_t i = 0; i < result.size(); ++i) { if (i == max) std::cout << " ..."; else if (i < max || i + max >= result.size()) std::cout << ' ' << result[i]; } std::cout << '\n'; } std::cout << '\n'; for (uint64_t k = 2; k <= 10; ++k) { std::cout << "Count of " << k << "-powerful numbers <= 10^j for 0 <= j < " << k + 10 << ":"; for (uint64_t j = 0, p = 1; j < k + 10; ++j, p *= 10) std::cout << ' ' << powerful_count(p, k); std::cout << '\n'; } }
Generate an equivalent C++ version of this Go code.
package main import ( "fmt" "log" "os" "os/exec" ) func reverseBytes(bytes []byte) { for i, j := 0, len(bytes)-1; i < j; i, j = i+1, j-1 { bytes[i], bytes[j] = bytes[j], bytes[i] } } func check(err error) { if err != nil { log.Fatal(err) } } func main() { in, err := os.Open("infile.dat") check(err) defer in.Close() out, err := os.Create("outfile.dat") check(err) record := make([]byte, 80) empty := make([]byte, 80) for { n, err := in.Read(record) if err != nil { if n == 0 { break } else { out.Close() log.Fatal(err) } } reverseBytes(record) out.Write(record) copy(record, empty) } out.Close() cmd := exec.Command("dd", "if=outfile.dat", "cbs=80", "conv=unblock") bytes, err := cmd.Output() check(err) fmt.Println(string(bytes)) }
#include <algorithm> #include <cstdlib> #include <fstream> #include <iostream> void reverse(std::istream& in, std::ostream& out) { constexpr size_t record_length = 80; char record[record_length]; while (in.read(record, record_length)) { std::reverse(std::begin(record), std::end(record)); out.write(record, record_length); } out.flush(); } int main(int argc, char** argv) { std::ifstream in("infile.dat", std::ios_base::binary); if (!in) { std::cerr << "Cannot open input file\n"; return EXIT_FAILURE; } std::ofstream out("outfile.dat", std::ios_base::binary); if (!out) { std::cerr << "Cannot open output file\n"; return EXIT_FAILURE; } try { in.exceptions(std::ios_base::badbit); out.exceptions(std::ios_base::badbit); reverse(in, out); } catch (const std::exception& ex) { std::cerr << "I/O error: " << ex.what() << '\n'; return EXIT_FAILURE; } return EXIT_SUCCESS; }
Produce a language-to-language conversion: from Go to C++, same semantics.
package main import ( "bytes" "fmt" "io/ioutil" "log" "unicode/utf8" ) func main() { wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) count := 0 for _, bword := range bwords { s := string(bword) if utf8.RuneCountInString(s) > 5 && (s[0:3] == s[len(s)-3:]) { count++ fmt.Printf("%d: %s\n", count, s) } } }
#include <cstdlib> #include <fstream> #include <iostream> int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string word; int n = 0; while (getline(in, word)) { const size_t len = word.size(); if (len > 5 && word.compare(0, 3, word, len - 3) == 0) std::cout << ++n << ": " << word << '\n'; } return EXIT_SUCCESS; }
Generate a C++ translation of this Go snippet without changing its computational steps.
package main import "fmt" var factors []int var inc = []int{4, 2, 4, 2, 4, 6, 2, 6} func primeFactors(n int) { factors = factors[:0] factors = append(factors, 2) last := 2 n /= 2 for n%3 == 0 { if last == 3 { factors = factors[:0] return } last = 3 factors = append(factors, 3) n /= 3 } for n%5 == 0 { if last == 5 { factors = factors[:0] return } last = 5 factors = append(factors, 5) n /= 5 } for k, i := 7, 0; k*k <= n; { if n%k == 0 { if last == k { factors = factors[:0] return } last = k factors = append(factors, k) n /= k } else { k += inc[i] i = (i + 1) % 8 } } if n > 1 { factors = append(factors, n) } } func main() { const limit = 5 var giuga []int for n := 6; len(giuga) < limit; n += 4 { primeFactors(n) if len(factors) > 2 { isGiuga := true for _, f := range factors { if (n/f-1)%f != 0 { isGiuga = false break } } if isGiuga { giuga = append(giuga, n) } } } fmt.Println("The first", limit, "Giuga numbers are:") fmt.Println(giuga) }
#include <iostream> bool is_giuga(unsigned int n) { unsigned int m = n / 2; auto test_factor = [&m, n](unsigned int p) -> bool { if (m % p != 0) return true; m /= p; return m % p != 0 && (n / p - 1) % p == 0; }; if (!test_factor(3) || !test_factor(5)) return false; static constexpr unsigned int wheel[] = {4, 2, 4, 2, 4, 6, 2, 6}; for (unsigned int p = 7, i = 0; p * p <= m; ++i) { if (!test_factor(p)) return false; p += wheel[i & 7]; } return m == 1 || (n / m - 1) % m == 0; } int main() { std::cout << "First 5 Giuga numbers:\n"; for (unsigned int i = 0, n = 6; i < 5; n += 4) { if (is_giuga(n)) { std::cout << n << '\n'; ++i; } } }
Maintain the same structure and functionality when rewriting this code in C++.
package main import ( "fmt" "math/big" ) func div(dividend, divisor []*big.Rat) (quotient, remainder []*big.Rat) { out := make([]*big.Rat, len(dividend)) for i, c := range dividend { out[i] = new(big.Rat).Set(c) } for i := 0; i < len(dividend)-(len(divisor)-1); i++ { out[i].Quo(out[i], divisor[0]) if coef := out[i]; coef.Sign() != 0 { var a big.Rat for j := 1; j < len(divisor); j++ { out[i+j].Add(out[i+j], a.Mul(a.Neg(divisor[j]), coef)) } } } separator := len(out) - (len(divisor) - 1) return out[:separator], out[separator:] } func main() { N := []*big.Rat{ big.NewRat(1, 1), big.NewRat(-12, 1), big.NewRat(0, 1), big.NewRat(-42, 1)} D := []*big.Rat{big.NewRat(1, 1), big.NewRat(-3, 1)} Q, R := div(N, D) fmt.Printf("%v / %v = %v remainder %v\n", N, D, Q, R) }
#include <iostream> #include <vector> #include <string> #include <cmath> std::string frmtPolynomial(std::vector<int> polynomial, bool remainder = false) { std::string r = ""; if (remainder) { r = " r: " + std::to_string(polynomial.back()); polynomial.pop_back(); } std::string formatted = ""; int degree = polynomial.size() - 1; int d = degree; for (int i : polynomial) { if (d < degree) { if (i >= 0) { formatted += " + "; } else { formatted += " - "; } } formatted += std::to_string(abs(i)); if (d > 1) { formatted += "x^" + std::to_string(d); } else if (d == 1) { formatted += "x"; } d--; } return formatted; } std::vector<int> syntheticDiv(std::vector<int> dividend, std::vector<int> divisor) { std::vector<int> quotient; quotient = dividend; int normalizer = divisor[0]; for (int i = 0; i < dividend.size() - (divisor.size() - 1); i++) { quotient[i] /= normalizer; int coef = quotient[i]; if (coef != 0) { for (int j = 1; j < divisor.size(); j++) { quotient[i + j] += -divisor[j] * coef; } } } return quotient; } int main(int argc, char **argv) { std::vector<int> dividend{ 1, -12, 0, -42}; std::vector<int> divisor{ 1, -3}; std::cout << frmtPolynomial(dividend) << "\n"; std::cout << frmtPolynomial(divisor) << "\n"; std::vector<int> quotient = syntheticDiv(dividend, divisor); std::cout << frmtPolynomial(quotient, true) << "\n"; }
Generate an equivalent C++ version of this Go code.
package main import ( "fmt" "math/big" ) func div(dividend, divisor []*big.Rat) (quotient, remainder []*big.Rat) { out := make([]*big.Rat, len(dividend)) for i, c := range dividend { out[i] = new(big.Rat).Set(c) } for i := 0; i < len(dividend)-(len(divisor)-1); i++ { out[i].Quo(out[i], divisor[0]) if coef := out[i]; coef.Sign() != 0 { var a big.Rat for j := 1; j < len(divisor); j++ { out[i+j].Add(out[i+j], a.Mul(a.Neg(divisor[j]), coef)) } } } separator := len(out) - (len(divisor) - 1) return out[:separator], out[separator:] } func main() { N := []*big.Rat{ big.NewRat(1, 1), big.NewRat(-12, 1), big.NewRat(0, 1), big.NewRat(-42, 1)} D := []*big.Rat{big.NewRat(1, 1), big.NewRat(-3, 1)} Q, R := div(N, D) fmt.Printf("%v / %v = %v remainder %v\n", N, D, Q, R) }
#include <iostream> #include <vector> #include <string> #include <cmath> std::string frmtPolynomial(std::vector<int> polynomial, bool remainder = false) { std::string r = ""; if (remainder) { r = " r: " + std::to_string(polynomial.back()); polynomial.pop_back(); } std::string formatted = ""; int degree = polynomial.size() - 1; int d = degree; for (int i : polynomial) { if (d < degree) { if (i >= 0) { formatted += " + "; } else { formatted += " - "; } } formatted += std::to_string(abs(i)); if (d > 1) { formatted += "x^" + std::to_string(d); } else if (d == 1) { formatted += "x"; } d--; } return formatted; } std::vector<int> syntheticDiv(std::vector<int> dividend, std::vector<int> divisor) { std::vector<int> quotient; quotient = dividend; int normalizer = divisor[0]; for (int i = 0; i < dividend.size() - (divisor.size() - 1); i++) { quotient[i] /= normalizer; int coef = quotient[i]; if (coef != 0) { for (int j = 1; j < divisor.size(); j++) { quotient[i + j] += -divisor[j] * coef; } } } return quotient; } int main(int argc, char **argv) { std::vector<int> dividend{ 1, -12, 0, -42}; std::vector<int> divisor{ 1, -3}; std::cout << frmtPolynomial(dividend) << "\n"; std::cout << frmtPolynomial(divisor) << "\n"; std::vector<int> quotient = syntheticDiv(dividend, divisor); std::cout << frmtPolynomial(quotient, true) << "\n"; }
Please provide an equivalent version of this Go code in C++.
package main import ( "fmt" "rcu" ) func countDivisors(n int) int { count := 0 i := 1 k := 1 if n%2 == 1 { k = 2 } for ; i*i <= n; i += k { if n%i == 0 { count++ j := n / i if j != i { count++ } } } return count } func main() { const limit = 1e5 var results []int for i := 2; i * i < limit; i++ { n := countDivisors(i * i) if n > 2 && rcu.IsPrime(n) { results = append(results, i * i) } } climit := rcu.Commatize(limit) fmt.Printf("Positive integers under %7s whose number of divisors is an odd prime:\n", climit) under1000 := 0 for i, n := range results { fmt.Printf("%7s", rcu.Commatize(n)) if (i+1)%10 == 0 { fmt.Println() } if n < 1000 { under1000++ } } fmt.Printf("\n\nFound %d such integers (%d under 1,000).\n", len(results), under1000) }
#include <cmath> #include <cstdlib> #include <iomanip> #include <iostream> int divisor_count(int n) { int total = 1; for (; (n & 1) == 0; n >>= 1) ++total; for (int p = 3; p * p <= n; p += 2) { int count = 1; for (; n % p == 0; n /= p) ++count; total *= count; } if (n > 1) total *= 2; return total; } bool is_prime(int n) { if (n < 2) return false; if (n % 2 == 0) return n == 2; if (n % 3 == 0) return n == 3; for (int p = 5; p * p <= n; p += 4) { if (n % p == 0) return false; p += 2; if (n % p == 0) return false; } return true; } int main(int argc, char** argv) { int limit = 1000; switch (argc) { case 1: break; case 2: limit = std::strtol(argv[1], nullptr, 10); if (limit <= 0) { std::cerr << "Invalid limit\n"; return EXIT_FAILURE; } break; default: std::cerr << "usage: " << argv[0] << " [limit]\n"; return EXIT_FAILURE; } int width = static_cast<int>(std::ceil(std::log10(limit))); int count = 0; for (int i = 1;; ++i) { int n = i * i; if (n >= limit) break; int divisors = divisor_count(n); if (divisors != 2 && is_prime(divisors)) std::cout << std::setw(width) << n << (++count % 10 == 0 ? '\n' : ' '); } std::cout << "\nCount: " << count << '\n'; return EXIT_SUCCESS; }
Convert this Go block to C++, preserving its control flow and logic.
package main import ( "fmt" "rcu" ) func countDivisors(n int) int { count := 0 i := 1 k := 1 if n%2 == 1 { k = 2 } for ; i*i <= n; i += k { if n%i == 0 { count++ j := n / i if j != i { count++ } } } return count } func main() { const limit = 1e5 var results []int for i := 2; i * i < limit; i++ { n := countDivisors(i * i) if n > 2 && rcu.IsPrime(n) { results = append(results, i * i) } } climit := rcu.Commatize(limit) fmt.Printf("Positive integers under %7s whose number of divisors is an odd prime:\n", climit) under1000 := 0 for i, n := range results { fmt.Printf("%7s", rcu.Commatize(n)) if (i+1)%10 == 0 { fmt.Println() } if n < 1000 { under1000++ } } fmt.Printf("\n\nFound %d such integers (%d under 1,000).\n", len(results), under1000) }
#include <cmath> #include <cstdlib> #include <iomanip> #include <iostream> int divisor_count(int n) { int total = 1; for (; (n & 1) == 0; n >>= 1) ++total; for (int p = 3; p * p <= n; p += 2) { int count = 1; for (; n % p == 0; n /= p) ++count; total *= count; } if (n > 1) total *= 2; return total; } bool is_prime(int n) { if (n < 2) return false; if (n % 2 == 0) return n == 2; if (n % 3 == 0) return n == 3; for (int p = 5; p * p <= n; p += 4) { if (n % p == 0) return false; p += 2; if (n % p == 0) return false; } return true; } int main(int argc, char** argv) { int limit = 1000; switch (argc) { case 1: break; case 2: limit = std::strtol(argv[1], nullptr, 10); if (limit <= 0) { std::cerr << "Invalid limit\n"; return EXIT_FAILURE; } break; default: std::cerr << "usage: " << argv[0] << " [limit]\n"; return EXIT_FAILURE; } int width = static_cast<int>(std::ceil(std::log10(limit))); int count = 0; for (int i = 1;; ++i) { int n = i * i; if (n >= limit) break; int divisors = divisor_count(n); if (divisors != 2 && is_prime(divisors)) std::cout << std::setw(width) << n << (++count % 10 == 0 ? '\n' : ' '); } std::cout << "\nCount: " << count << '\n'; return EXIT_SUCCESS; }
Change the following Go code into C++ without altering its purpose.
package main import ( "bytes" "fmt" "io/ioutil" "log" "sort" "strings" ) func main() { wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) words := make([]string, len(bwords)) for i, bword := range bwords { words[i] = string(bword) } count := 0 fmt.Println("The odd words with length > 4 in", wordList, "are:") for _, word := range words { rword := []rune(word) if len(rword) > 8 { var sb strings.Builder for i := 0; i < len(rword); i += 2 { sb.WriteRune(rword[i]) } s := sb.String() idx := sort.SearchStrings(words, s) if idx < len(words) && words[idx] == s { count = count + 1 fmt.Printf("%2d: %-12s -> %s\n", count, word, s) } } } }
#include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> #include <set> #include <string> #include <utility> #include <vector> using word_list = std::vector<std::pair<std::string, std::string>>; void print_words(std::ostream& out, const word_list& words) { int n = 1; for (const auto& pair : words) { out << std::right << std::setw(2) << n++ << ": " << std::left << std::setw(14) << pair.first << pair.second << '\n'; } } int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } const int min_length = 5; std::string line; std::set<std::string> dictionary; while (getline(in, line)) { if (line.size() >= min_length) dictionary.insert(line); } word_list odd_words, even_words; for (const std::string& word : dictionary) { if (word.size() < min_length + 2*(min_length/2)) continue; std::string odd_word, even_word; for (auto w = word.begin(); w != word.end(); ++w) { odd_word += *w; if (++w == word.end()) break; even_word += *w; } if (dictionary.find(odd_word) != dictionary.end()) odd_words.emplace_back(word, odd_word); if (dictionary.find(even_word) != dictionary.end()) even_words.emplace_back(word, even_word); } std::cout << "Odd words:\n"; print_words(std::cout, odd_words); std::cout << "\nEven words:\n"; print_words(std::cout, even_words); return EXIT_SUCCESS; }
Change the following Go code into C++ without altering its purpose.
package main import ( "fmt" "io" "os" "strings" ) type nNode struct { name string children []nNode } type iNode struct { level int name string } func printNest(n nNode, level int, w io.Writer) { if level == 0 { fmt.Fprintln(w, "\n==Nest form==\n") } fmt.Fprintf(w, "%s%s\n", strings.Repeat(" ", level), n.name) for _, c := range n.children { fmt.Fprintf(w, "%s", strings.Repeat(" ", level+1)) printNest(c, level+1, w) } } func toNest(iNodes []iNode, start, level int, n *nNode) { if level == 0 { n.name = iNodes[0].name } for i := start + 1; i < len(iNodes); i++ { if iNodes[i].level == level+1 { c := nNode{iNodes[i].name, nil} toNest(iNodes, i, level+1, &c) n.children = append(n.children, c) } else if iNodes[i].level <= level { return } } } func printIndent(iNodes []iNode, w io.Writer) { fmt.Fprintln(w, "\n==Indent form==\n") for _, n := range iNodes { fmt.Fprintf(w, "%d %s\n", n.level, n.name) } } func toIndent(n nNode, level int, iNodes *[]iNode) { *iNodes = append(*iNodes, iNode{level, n.name}) for _, c := range n.children { toIndent(c, level+1, iNodes) } } func main() { n1 := nNode{"RosettaCode", nil} n2 := nNode{"rocks", []nNode{{"code", nil}, {"comparison", nil}, {"wiki", nil}}} n3 := nNode{"mocks", []nNode{{"trolling", nil}}} n1.children = append(n1.children, n2, n3) var sb strings.Builder printNest(n1, 0, &sb) s1 := sb.String() fmt.Print(s1) var iNodes []iNode toIndent(n1, 0, &iNodes) printIndent(iNodes, os.Stdout) var n nNode toNest(iNodes, 0, 0, &n) sb.Reset() printNest(n, 0, &sb) s2 := sb.String() fmt.Print(s2) fmt.Println("\nRound trip test satisfied? ", s1 == s2) }
#include <iomanip> #include <iostream> #include <list> #include <string> #include <vector> #include <utility> #include <vector> class nest_tree; bool operator==(const nest_tree&, const nest_tree&); class nest_tree { public: explicit nest_tree(const std::string& name) : name_(name) {} nest_tree& add_child(const std::string& name) { children_.emplace_back(name); return children_.back(); } void print(std::ostream& out) const { print(out, 0); } const std::string& name() const { return name_; } const std::list<nest_tree>& children() const { return children_; } bool equals(const nest_tree& n) const { return name_ == n.name_ && children_ == n.children_; } private: void print(std::ostream& out, int level) const { std::string indent(level * 4, ' '); out << indent << name_ << '\n'; for (const nest_tree& child : children_) child.print(out, level + 1); } std::string name_; std::list<nest_tree> children_; }; bool operator==(const nest_tree& a, const nest_tree& b) { return a.equals(b); } class indent_tree { public: explicit indent_tree(const nest_tree& n) { items_.emplace_back(0, n.name()); from_nest(n, 0); } void print(std::ostream& out) const { for (const auto& item : items_) std::cout << item.first << ' ' << item.second << '\n'; } nest_tree to_nest() const { nest_tree n(items_[0].second); to_nest_(n, 1, 0); return n; } private: void from_nest(const nest_tree& n, int level) { for (const nest_tree& child : n.children()) { items_.emplace_back(level + 1, child.name()); from_nest(child, level + 1); } } size_t to_nest_(nest_tree& n, size_t pos, int level) const { while (pos < items_.size() && items_[pos].first == level + 1) { nest_tree& child = n.add_child(items_[pos].second); pos = to_nest_(child, pos + 1, level + 1); } return pos; } std::vector<std::pair<int, std::string>> items_; }; int main() { nest_tree n("RosettaCode"); auto& child1 = n.add_child("rocks"); auto& child2 = n.add_child("mocks"); child1.add_child("code"); child1.add_child("comparison"); child1.add_child("wiki"); child2.add_child("trolling"); std::cout << "Initial nest format:\n"; n.print(std::cout); indent_tree i(n); std::cout << "\nIndent format:\n"; i.print(std::cout); nest_tree n2(i.to_nest()); std::cout << "\nFinal nest format:\n"; n2.print(std::cout); std::cout << "\nAre initial and final nest formats equal? " << std::boolalpha << n.equals(n2) << '\n'; return 0; }
Write a version of this Go function in C++ with identical behavior.
package main import ( "fmt" "strings" ) func main() { s := "abracadabra" ss := []byte(s) var ixs []int for ix, c := range s { if c == 'a' { ixs = append(ixs, ix) } } repl := "ABaCD" for i := 0; i < 5; i++ { ss[ixs[i]] = repl[i] } s = string(ss) s = strings.Replace(s, "b", "E", 1) s = strings.Replace(s, "r", "F", 2) s = strings.Replace(s, "F", "r", 1) fmt.Println(s) }
#include <map> #include <iostream> #include <string> int main() { std::map<char, std::string> rep = {{'a', "DCaBA"}, {'b', "E"}, {'r', "Fr"}}; std::string magic = "abracadabra"; for(auto it = magic.begin(); it != magic.end(); ++it) { if(auto f = rep.find(*it); f != rep.end() && !f->second.empty()) { *it = f->second.back(); f->second.pop_back(); } } std::cout << magic << "\n"; }
Keep all operations the same but rewrite the snippet in C++.
package main import ( "fmt" "strings" ) func main() { s := "abracadabra" ss := []byte(s) var ixs []int for ix, c := range s { if c == 'a' { ixs = append(ixs, ix) } } repl := "ABaCD" for i := 0; i < 5; i++ { ss[ixs[i]] = repl[i] } s = string(ss) s = strings.Replace(s, "b", "E", 1) s = strings.Replace(s, "r", "F", 2) s = strings.Replace(s, "F", "r", 1) fmt.Println(s) }
#include <map> #include <iostream> #include <string> int main() { std::map<char, std::string> rep = {{'a', "DCaBA"}, {'b', "E"}, {'r', "Fr"}}; std::string magic = "abracadabra"; for(auto it = magic.begin(); it != magic.end(); ++it) { if(auto f = rep.find(*it); f != rep.end() && !f->second.empty()) { *it = f->second.back(); f->second.pop_back(); } } std::cout << magic << "\n"; }
Rewrite the snippet below in C++ so it works the same as the original Go code.
package main import ( "fmt" big "github.com/ncw/gmp" "rcu" "strings" ) func main() { limit := 2700 primes := rcu.Primes(limit) s := new(big.Int) for b := 2; b <= 36; b++ { var rPrimes []int for _, p := range primes { s.SetString(strings.Repeat("1", p), b) if s.ProbablyPrime(15) { rPrimes = append(rPrimes, p) } } fmt.Printf("Base %2d: %v\n", b, rPrimes) } }
#include <future> #include <iomanip> #include <iostream> #include <vector> #include <gmpxx.h> #include <primesieve.hpp> std::vector<uint64_t> repunit_primes(uint32_t base, const std::vector<uint64_t>& primes) { std::vector<uint64_t> result; for (uint64_t prime : primes) { mpz_class repunit(std::string(prime, '1'), base); if (mpz_probab_prime_p(repunit.get_mpz_t(), 25) != 0) result.push_back(prime); } return result; } int main() { std::vector<uint64_t> primes; const uint64_t limit = 2700; primesieve::generate_primes(limit, &primes); std::vector<std::future<std::vector<uint64_t>>> futures; for (uint32_t base = 2; base <= 36; ++base) { futures.push_back(std::async(repunit_primes, base, primes)); } std::cout << "Repunit prime digits (up to " << limit << ") in:\n"; for (uint32_t base = 2, i = 0; base <= 36; ++base, ++i) { std::cout << "Base " << std::setw(2) << base << ':'; for (auto digits : futures[i].get()) std::cout << ' ' << digits; std::cout << '\n'; } }
Convert this Go block to C++, preserving its control flow and logic.
package main import ( "fmt" big "github.com/ncw/gmp" "rcu" "strings" ) func main() { limit := 2700 primes := rcu.Primes(limit) s := new(big.Int) for b := 2; b <= 36; b++ { var rPrimes []int for _, p := range primes { s.SetString(strings.Repeat("1", p), b) if s.ProbablyPrime(15) { rPrimes = append(rPrimes, p) } } fmt.Printf("Base %2d: %v\n", b, rPrimes) } }
#include <future> #include <iomanip> #include <iostream> #include <vector> #include <gmpxx.h> #include <primesieve.hpp> std::vector<uint64_t> repunit_primes(uint32_t base, const std::vector<uint64_t>& primes) { std::vector<uint64_t> result; for (uint64_t prime : primes) { mpz_class repunit(std::string(prime, '1'), base); if (mpz_probab_prime_p(repunit.get_mpz_t(), 25) != 0) result.push_back(prime); } return result; } int main() { std::vector<uint64_t> primes; const uint64_t limit = 2700; primesieve::generate_primes(limit, &primes); std::vector<std::future<std::vector<uint64_t>>> futures; for (uint32_t base = 2; base <= 36; ++base) { futures.push_back(std::async(repunit_primes, base, primes)); } std::cout << "Repunit prime digits (up to " << limit << ") in:\n"; for (uint32_t base = 2, i = 0; base <= 36; ++base, ++i) { std::cout << "Base " << std::setw(2) << base << ':'; for (auto digits : futures[i].get()) std::cout << ' ' << digits; std::cout << '\n'; } }
Convert this Go snippet to C++ and keep its semantics consistent.
package main import ( "fmt" "math/big" ) func main() { zero := big.NewInt(0) one := big.NewInt(1) for k := int64(2); k <= 10; k += 2 { bk := big.NewInt(k) fmt.Println("The first 50 Curzon numbers using a base of", k, ":") count := 0 n := int64(1) pow := big.NewInt(k) z := new(big.Int) var curzon50 []int64 for { z.Add(pow, one) d := k*n + 1 bd := big.NewInt(d) if z.Rem(z, bd).Cmp(zero) == 0 { if count < 50 { curzon50 = append(curzon50, n) } count++ if count == 50 { for i := 0; i < len(curzon50); i++ { fmt.Printf("%4d ", curzon50[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Print("\nOne thousandth: ") } if count == 1000 { fmt.Println(n) break } } n++ pow.Mul(pow, bk) } fmt.Println() } }
#include <cstdint> #include <iomanip> #include <iostream> #include <vector> uint64_t modpow(uint64_t base, uint64_t exp, uint64_t mod) { if (mod == 1) return 0; uint64_t result = 1; base %= mod; for (; exp > 0; exp >>= 1) { if ((exp & 1) == 1) result = (result * base) % mod; base = (base * base) % mod; } return result; } bool is_curzon(uint64_t n, uint64_t k) { const uint64_t r = k * n; return modpow(k, n, r + 1) == r; } int main() { for (uint64_t k = 2; k <= 10; k += 2) { std::cout << "Curzon numbers with base " << k << ":\n"; uint64_t count = 0, n = 1; for (; count < 50; ++n) { if (is_curzon(n, k)) { std::cout << std::setw(4) << n << (++count % 10 == 0 ? '\n' : ' '); } } for (;;) { if (is_curzon(n, k)) ++count; if (count == 1000) break; ++n; } std::cout << "1000th Curzon number with base " << k << ": " << n << "\n\n"; } return 0; }
Port the following code from Go to C++ with equivalent syntax and logic.
package main import ( "fmt" "math/big" ) func main() { zero := big.NewInt(0) one := big.NewInt(1) for k := int64(2); k <= 10; k += 2 { bk := big.NewInt(k) fmt.Println("The first 50 Curzon numbers using a base of", k, ":") count := 0 n := int64(1) pow := big.NewInt(k) z := new(big.Int) var curzon50 []int64 for { z.Add(pow, one) d := k*n + 1 bd := big.NewInt(d) if z.Rem(z, bd).Cmp(zero) == 0 { if count < 50 { curzon50 = append(curzon50, n) } count++ if count == 50 { for i := 0; i < len(curzon50); i++ { fmt.Printf("%4d ", curzon50[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Print("\nOne thousandth: ") } if count == 1000 { fmt.Println(n) break } } n++ pow.Mul(pow, bk) } fmt.Println() } }
#include <cstdint> #include <iomanip> #include <iostream> #include <vector> uint64_t modpow(uint64_t base, uint64_t exp, uint64_t mod) { if (mod == 1) return 0; uint64_t result = 1; base %= mod; for (; exp > 0; exp >>= 1) { if ((exp & 1) == 1) result = (result * base) % mod; base = (base * base) % mod; } return result; } bool is_curzon(uint64_t n, uint64_t k) { const uint64_t r = k * n; return modpow(k, n, r + 1) == r; } int main() { for (uint64_t k = 2; k <= 10; k += 2) { std::cout << "Curzon numbers with base " << k << ":\n"; uint64_t count = 0, n = 1; for (; count < 50; ++n) { if (is_curzon(n, k)) { std::cout << std::setw(4) << n << (++count % 10 == 0 ? '\n' : ' '); } } for (;;) { if (is_curzon(n, k)) ++count; if (count == 1000) break; ++n; } std::cout << "1000th Curzon number with base " << k << ": " << n << "\n\n"; } return 0; }
Write a version of this Go function in C++ with identical behavior.
package main import ( "fmt" "github.com/ALTree/bigfloat" "math/big" ) const ( prec = 256 ps = "3.1415926535897932384626433832795028841971693993751058209749445923078164" ) func q(d int64) *big.Float { pi, _ := new(big.Float).SetPrec(prec).SetString(ps) t := new(big.Float).SetPrec(prec).SetInt64(d) t.Sqrt(t) t.Mul(pi, t) return bigfloat.Exp(t) } func main() { fmt.Println("Ramanujan's constant to 32 decimal places is:") fmt.Printf("%.32f\n", q(163)) heegners := [4][2]int64{ {19, 96}, {43, 960}, {67, 5280}, {163, 640320}, } fmt.Println("\nHeegner numbers yielding 'almost' integers:") t := new(big.Float).SetPrec(prec) for _, h := range heegners { qh := q(h[0]) c := h[1]*h[1]*h[1] + 744 t.SetInt64(c) t.Sub(t, qh) fmt.Printf("%3d: %51.32f ≈ %18d (diff: %.32f)\n", h[0], qh, c, t) } }
#include <iomanip> #include <iostream> #include <boost/math/constants/constants.hpp> #include <boost/multiprecision/cpp_dec_float.hpp> using big_float = boost::multiprecision::cpp_dec_float_100; big_float f(unsigned int n) { big_float pi(boost::math::constants::pi<big_float>()); return exp(sqrt(big_float(n)) * pi); } int main() { std::cout << "Ramanujan's constant using formula f(N) = exp(pi*sqrt(N)):\n" << std::setprecision(80) << f(163) << '\n'; std::cout << "\nResult with last four Heegner numbers:\n"; std::cout << std::setprecision(30); for (unsigned int n : {19, 43, 67, 163}) { auto x = f(n); auto c = ceil(x); auto pc = 100.0 * (x/c); std::cout << "f(" << n << ") = " << x << " = " << pc << "% of " << c << '\n'; } return 0; }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "fmt" "github.com/ALTree/bigfloat" "math/big" ) const ( prec = 256 ps = "3.1415926535897932384626433832795028841971693993751058209749445923078164" ) func q(d int64) *big.Float { pi, _ := new(big.Float).SetPrec(prec).SetString(ps) t := new(big.Float).SetPrec(prec).SetInt64(d) t.Sqrt(t) t.Mul(pi, t) return bigfloat.Exp(t) } func main() { fmt.Println("Ramanujan's constant to 32 decimal places is:") fmt.Printf("%.32f\n", q(163)) heegners := [4][2]int64{ {19, 96}, {43, 960}, {67, 5280}, {163, 640320}, } fmt.Println("\nHeegner numbers yielding 'almost' integers:") t := new(big.Float).SetPrec(prec) for _, h := range heegners { qh := q(h[0]) c := h[1]*h[1]*h[1] + 744 t.SetInt64(c) t.Sub(t, qh) fmt.Printf("%3d: %51.32f ≈ %18d (diff: %.32f)\n", h[0], qh, c, t) } }
#include <iomanip> #include <iostream> #include <boost/math/constants/constants.hpp> #include <boost/multiprecision/cpp_dec_float.hpp> using big_float = boost::multiprecision::cpp_dec_float_100; big_float f(unsigned int n) { big_float pi(boost::math::constants::pi<big_float>()); return exp(sqrt(big_float(n)) * pi); } int main() { std::cout << "Ramanujan's constant using formula f(N) = exp(pi*sqrt(N)):\n" << std::setprecision(80) << f(163) << '\n'; std::cout << "\nResult with last four Heegner numbers:\n"; std::cout << std::setprecision(30); for (unsigned int n : {19, 43, 67, 163}) { auto x = f(n); auto c = ceil(x); auto pc = 100.0 * (x/c); std::cout << "f(" << n << ") = " << x << " = " << pc << "% of " << c << '\n'; } return 0; }
Write the same code in C++ as shown below in Go.
package main import ( "fmt" "github.com/ALTree/bigfloat" "math/big" ) const ( prec = 256 ps = "3.1415926535897932384626433832795028841971693993751058209749445923078164" ) func q(d int64) *big.Float { pi, _ := new(big.Float).SetPrec(prec).SetString(ps) t := new(big.Float).SetPrec(prec).SetInt64(d) t.Sqrt(t) t.Mul(pi, t) return bigfloat.Exp(t) } func main() { fmt.Println("Ramanujan's constant to 32 decimal places is:") fmt.Printf("%.32f\n", q(163)) heegners := [4][2]int64{ {19, 96}, {43, 960}, {67, 5280}, {163, 640320}, } fmt.Println("\nHeegner numbers yielding 'almost' integers:") t := new(big.Float).SetPrec(prec) for _, h := range heegners { qh := q(h[0]) c := h[1]*h[1]*h[1] + 744 t.SetInt64(c) t.Sub(t, qh) fmt.Printf("%3d: %51.32f ≈ %18d (diff: %.32f)\n", h[0], qh, c, t) } }
#include <iomanip> #include <iostream> #include <boost/math/constants/constants.hpp> #include <boost/multiprecision/cpp_dec_float.hpp> using big_float = boost::multiprecision::cpp_dec_float_100; big_float f(unsigned int n) { big_float pi(boost::math::constants::pi<big_float>()); return exp(sqrt(big_float(n)) * pi); } int main() { std::cout << "Ramanujan's constant using formula f(N) = exp(pi*sqrt(N)):\n" << std::setprecision(80) << f(163) << '\n'; std::cout << "\nResult with last four Heegner numbers:\n"; std::cout << std::setprecision(30); for (unsigned int n : {19, 43, 67, 163}) { auto x = f(n); auto c = ceil(x); auto pc = 100.0 * (x/c); std::cout << "f(" << n << ") = " << x << " = " << pc << "% of " << c << '\n'; } return 0; }
Convert this Go block to C++, preserving its control flow and logic.
package main import ( "fmt" "reflect" ) type example struct{} func (example) Foo() int { return 42 } func (e example) CallMethod(n string) int { if m := reflect.ValueOf(e).MethodByName(n); m.IsValid() { return int(m.Call(nil)[0].Int()) } fmt.Println("Unknown method:", n) return 0 } func main() { var e example fmt.Println(e.CallMethod("Foo")) fmt.Println(e.CallMethod("Bar")) }
class animal { public: virtual void bark() { throw "implement me: do not know how to bark"; } }; class elephant : public animal { }; int main() { elephant e; e.bark(); }
Port the provided Go code into C++ while preserving the original functionality.
package main import ( "fmt" "strings" ) type dict map[string]bool func newDict(words ...string) dict { d := dict{} for _, w := range words { d[w] = true } return d } func (d dict) wordBreak(s string) (broken []string, ok bool) { if s == "" { return nil, true } type prefix struct { length int broken []string } bp := []prefix{{0, nil}} for end := 1; end <= len(s); end++ { for i := len(bp) - 1; i >= 0; i-- { w := s[bp[i].length:end] if d[w] { b := append(bp[i].broken, w) if end == len(s) { return b, true } bp = append(bp, prefix{end, b}) break } } } return nil, false } func main() { d := newDict("a", "bc", "abc", "cd", "b") for _, s := range []string{"abcd", "abbc", "abcbcd", "acdbc", "abcdd"} { if b, ok := d.wordBreak(s); ok { fmt.Printf("%s: %s\n", s, strings.Join(b, " ")) } else { fmt.Println("can't break") } } }
#include <algorithm> #include <iostream> #include <optional> #include <set> #include <string> #include <string_view> #include <vector> struct string_comparator { using is_transparent = void; bool operator()(const std::string& lhs, const std::string& rhs) const { return lhs < rhs; } bool operator()(const std::string& lhs, const std::string_view& rhs) const { return lhs < rhs; } bool operator()(const std::string_view& lhs, const std::string& rhs) const { return lhs < rhs; } }; using dictionary = std::set<std::string, string_comparator>; template <typename iterator, typename separator> std::string join(iterator begin, iterator end, separator sep) { std::string result; if (begin != end) { result += *begin++; for (; begin != end; ++begin) { result += sep; result += *begin; } } return result; } auto create_string(const std::string_view& s, const std::vector<std::optional<size_t>>& v) { auto idx = s.size(); std::vector<std::string_view> sv; while (v[idx].has_value()) { size_t prev = v[idx].value(); sv.push_back(s.substr(prev, idx - prev)); idx = prev; } std::reverse(sv.begin(), sv.end()); return join(sv.begin(), sv.end(), ' '); } std::optional<std::string> word_break(const std::string_view& str, const dictionary& dict) { auto size = str.size() + 1; std::vector<std::optional<size_t>> possible(size); auto check_word = [&dict, &str](size_t i, size_t j) -> std::optional<size_t> { if (dict.find(str.substr(i, j - i)) != dict.end()) return i; return std::nullopt; }; for (size_t i = 1; i < size; ++i) { if (!possible[i].has_value()) possible[i] = check_word(0, i); if (possible[i].has_value()) { for (size_t j = i + 1; j < size; ++j) { if (!possible[j].has_value()) possible[j] = check_word(i, j); } if (possible[str.size()].has_value()) return create_string(str, possible); } } return std::nullopt; } int main(int argc, char** argv) { dictionary dict; dict.insert("a"); dict.insert("bc"); dict.insert("abc"); dict.insert("cd"); dict.insert("b"); auto result = word_break("abcd", dict); if (result.has_value()) std::cout << result.value() << '\n'; return 0; }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "fmt" "math" "rcu" "sort" ) var primes = rcu.Primes(1e8 - 1) type res struct { bc interface{} next int } func getBrilliant(digits, limit int, countOnly bool) res { var brilliant []int count := 0 pow := 1 next := math.MaxInt for k := 1; k <= digits; k++ { var s []int for _, p := range primes { if p >= pow*10 { break } if p > pow { s = append(s, p) } } for i := 0; i < len(s); i++ { for j := i; j < len(s); j++ { prod := s[i] * s[j] if prod < limit { if countOnly { count++ } else { brilliant = append(brilliant, prod) } } else { if next > prod { next = prod } break } } } pow *= 10 } if countOnly { return res{count, next} } return res{brilliant, next} } func main() { fmt.Println("First 100 brilliant numbers:") brilliant := getBrilliant(2, 10000, false).bc.([]int) sort.Ints(brilliant) brilliant = brilliant[0:100] for i := 0; i < len(brilliant); i++ { fmt.Printf("%4d ", brilliant[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Println() for k := 1; k <= 13; k++ { limit := int(math.Pow(10, float64(k))) r := getBrilliant(k, limit, true) total := r.bc.(int) next := r.next climit := rcu.Commatize(limit) ctotal := rcu.Commatize(total + 1) cnext := rcu.Commatize(next) fmt.Printf("First >= %18s is %14s in the series: %18s\n", climit, ctotal, cnext) } }
#include <algorithm> #include <chrono> #include <iomanip> #include <iostream> #include <locale> #include <vector> #include <primesieve.hpp> auto get_primes_by_digits(uint64_t limit) { primesieve::iterator pi; std::vector<std::vector<uint64_t>> primes_by_digits; std::vector<uint64_t> primes; for (uint64_t p = 10; p <= limit;) { uint64_t prime = pi.next_prime(); if (prime > p) { primes_by_digits.push_back(std::move(primes)); p *= 10; } primes.push_back(prime); } return primes_by_digits; } int main() { std::cout.imbue(std::locale("")); auto start = std::chrono::high_resolution_clock::now(); auto primes_by_digits = get_primes_by_digits(1000000000); std::cout << "First 100 brilliant numbers:\n"; std::vector<uint64_t> brilliant_numbers; for (const auto& primes : primes_by_digits) { for (auto i = primes.begin(); i != primes.end(); ++i) for (auto j = i; j != primes.end(); ++j) brilliant_numbers.push_back(*i * *j); if (brilliant_numbers.size() >= 100) break; } std::sort(brilliant_numbers.begin(), brilliant_numbers.end()); for (size_t i = 0; i < 100; ++i) { std::cout << std::setw(5) << brilliant_numbers[i] << ((i + 1) % 10 == 0 ? '\n' : ' '); } std::cout << '\n'; uint64_t power = 10; size_t count = 0; for (size_t p = 1; p < 2 * primes_by_digits.size(); ++p) { const auto& primes = primes_by_digits[p / 2]; size_t position = count + 1; uint64_t min_product = 0; for (auto i = primes.begin(); i != primes.end(); ++i) { uint64_t p1 = *i; auto j = std::lower_bound(i, primes.end(), (power + p1 - 1) / p1); if (j != primes.end()) { uint64_t p2 = *j; uint64_t product = p1 * p2; if (min_product == 0 || product < min_product) min_product = product; position += std::distance(i, j); if (p1 >= p2) break; } } std::cout << "First brilliant number >= 10^" << p << " is " << min_product << " at position " << position << '\n'; power *= 10; if (p % 2 == 1) { size_t size = primes.size(); count += size * (size + 1) / 2; } } auto end = std::chrono::high_resolution_clock::now(); std::chrono::duration<double> duration(end - start); std::cout << "\nElapsed time: " << duration.count() << " seconds\n"; }
Generate an equivalent C++ version of this Go code.
package main import ( "fmt" "math" "rcu" "sort" ) var primes = rcu.Primes(1e8 - 1) type res struct { bc interface{} next int } func getBrilliant(digits, limit int, countOnly bool) res { var brilliant []int count := 0 pow := 1 next := math.MaxInt for k := 1; k <= digits; k++ { var s []int for _, p := range primes { if p >= pow*10 { break } if p > pow { s = append(s, p) } } for i := 0; i < len(s); i++ { for j := i; j < len(s); j++ { prod := s[i] * s[j] if prod < limit { if countOnly { count++ } else { brilliant = append(brilliant, prod) } } else { if next > prod { next = prod } break } } } pow *= 10 } if countOnly { return res{count, next} } return res{brilliant, next} } func main() { fmt.Println("First 100 brilliant numbers:") brilliant := getBrilliant(2, 10000, false).bc.([]int) sort.Ints(brilliant) brilliant = brilliant[0:100] for i := 0; i < len(brilliant); i++ { fmt.Printf("%4d ", brilliant[i]) if (i+1)%10 == 0 { fmt.Println() } } fmt.Println() for k := 1; k <= 13; k++ { limit := int(math.Pow(10, float64(k))) r := getBrilliant(k, limit, true) total := r.bc.(int) next := r.next climit := rcu.Commatize(limit) ctotal := rcu.Commatize(total + 1) cnext := rcu.Commatize(next) fmt.Printf("First >= %18s is %14s in the series: %18s\n", climit, ctotal, cnext) } }
#include <algorithm> #include <chrono> #include <iomanip> #include <iostream> #include <locale> #include <vector> #include <primesieve.hpp> auto get_primes_by_digits(uint64_t limit) { primesieve::iterator pi; std::vector<std::vector<uint64_t>> primes_by_digits; std::vector<uint64_t> primes; for (uint64_t p = 10; p <= limit;) { uint64_t prime = pi.next_prime(); if (prime > p) { primes_by_digits.push_back(std::move(primes)); p *= 10; } primes.push_back(prime); } return primes_by_digits; } int main() { std::cout.imbue(std::locale("")); auto start = std::chrono::high_resolution_clock::now(); auto primes_by_digits = get_primes_by_digits(1000000000); std::cout << "First 100 brilliant numbers:\n"; std::vector<uint64_t> brilliant_numbers; for (const auto& primes : primes_by_digits) { for (auto i = primes.begin(); i != primes.end(); ++i) for (auto j = i; j != primes.end(); ++j) brilliant_numbers.push_back(*i * *j); if (brilliant_numbers.size() >= 100) break; } std::sort(brilliant_numbers.begin(), brilliant_numbers.end()); for (size_t i = 0; i < 100; ++i) { std::cout << std::setw(5) << brilliant_numbers[i] << ((i + 1) % 10 == 0 ? '\n' : ' '); } std::cout << '\n'; uint64_t power = 10; size_t count = 0; for (size_t p = 1; p < 2 * primes_by_digits.size(); ++p) { const auto& primes = primes_by_digits[p / 2]; size_t position = count + 1; uint64_t min_product = 0; for (auto i = primes.begin(); i != primes.end(); ++i) { uint64_t p1 = *i; auto j = std::lower_bound(i, primes.end(), (power + p1 - 1) / p1); if (j != primes.end()) { uint64_t p2 = *j; uint64_t product = p1 * p2; if (min_product == 0 || product < min_product) min_product = product; position += std::distance(i, j); if (p1 >= p2) break; } } std::cout << "First brilliant number >= 10^" << p << " is " << min_product << " at position " << position << '\n'; power *= 10; if (p % 2 == 1) { size_t size = primes.size(); count += size * (size + 1) / 2; } } auto end = std::chrono::high_resolution_clock::now(); std::chrono::duration<double> duration(end - start); std::cout << "\nElapsed time: " << duration.count() << " seconds\n"; }
Write the same code in C++ as shown below in Go.
package main import ( "bytes" "fmt" "io/ioutil" "log" "strings" ) func contains(a []string, s string) bool { for _, e := range a { if e == s { return true } } return false } func oneAway(a, b string) bool { sum := 0 for i := 0; i < len(a); i++ { if a[i] != b[i] { sum++ } } return sum == 1 } func wordLadder(words []string, a, b string) { l := len(a) var poss []string for _, word := range words { if len(word) == l { poss = append(poss, word) } } todo := [][]string{{a}} for len(todo) > 0 { curr := todo[0] todo = todo[1:] var next []string for _, word := range poss { if oneAway(word, curr[len(curr)-1]) { next = append(next, word) } } if contains(next, b) { curr = append(curr, b) fmt.Println(strings.Join(curr, " -> ")) return } for i := len(poss) - 1; i >= 0; i-- { if contains(next, poss[i]) { copy(poss[i:], poss[i+1:]) poss[len(poss)-1] = "" poss = poss[:len(poss)-1] } } for _, s := range next { temp := make([]string, len(curr)) copy(temp, curr) temp = append(temp, s) todo = append(todo, temp) } } fmt.Println(a, "into", b, "cannot be done.") } func main() { b, err := ioutil.ReadFile("unixdict.txt") if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) words := make([]string, len(bwords)) for i, bword := range bwords { words[i] = string(bword) } pairs := [][]string{ {"boy", "man"}, {"girl", "lady"}, {"john", "jane"}, {"child", "adult"}, } for _, pair := range pairs { wordLadder(words, pair[0], pair[1]) } }
#include <algorithm> #include <fstream> #include <iostream> #include <map> #include <string> #include <vector> using word_map = std::map<size_t, std::vector<std::string>>; bool one_away(const std::string& s1, const std::string& s2) { if (s1.size() != s2.size()) return false; bool result = false; for (size_t i = 0, n = s1.size(); i != n; ++i) { if (s1[i] != s2[i]) { if (result) return false; result = true; } } return result; } template <typename iterator_type, typename separator_type> std::string join(iterator_type begin, iterator_type end, separator_type separator) { std::string result; if (begin != end) { result += *begin++; for (; begin != end; ++begin) { result += separator; result += *begin; } } return result; } bool word_ladder(const word_map& words, const std::string& from, const std::string& to) { auto w = words.find(from.size()); if (w != words.end()) { auto poss = w->second; std::vector<std::vector<std::string>> queue{{from}}; while (!queue.empty()) { auto curr = queue.front(); queue.erase(queue.begin()); for (auto i = poss.begin(); i != poss.end();) { if (!one_away(*i, curr.back())) { ++i; continue; } if (to == *i) { curr.push_back(to); std::cout << join(curr.begin(), curr.end(), " -> ") << '\n'; return true; } std::vector<std::string> temp(curr); temp.push_back(*i); queue.push_back(std::move(temp)); i = poss.erase(i); } } } std::cout << from << " into " << to << " cannot be done.\n"; return false; } int main() { word_map words; std::ifstream in("unixdict.txt"); if (!in) { std::cerr << "Cannot open file unixdict.txt.\n"; return EXIT_FAILURE; } std::string word; while (getline(in, word)) words[word.size()].push_back(word); word_ladder(words, "boy", "man"); word_ladder(words, "girl", "lady"); word_ladder(words, "john", "jane"); word_ladder(words, "child", "adult"); word_ladder(words, "cat", "dog"); word_ladder(words, "lead", "gold"); word_ladder(words, "white", "black"); word_ladder(words, "bubble", "tickle"); return EXIT_SUCCESS; }
Change the following Go code into C++ without altering its purpose.
package main import ( "fmt" "log" "rcu" "sort" ) func ord(n int) string { if n < 0 { log.Fatal("Argument must be a non-negative integer.") } m := n % 100 if m >= 4 && m <= 20 { return fmt.Sprintf("%sth", rcu.Commatize(n)) } m %= 10 suffix := "th" if m == 1 { suffix = "st" } else if m == 2 { suffix = "nd" } else if m == 3 { suffix = "rd" } return fmt.Sprintf("%s%s", rcu.Commatize(n), suffix) } func main() { limit := int(4 * 1e8) c := rcu.PrimeSieve(limit-1, true) var compSums []int var primeSums []int csum := 0 psum := 0 for i := 2; i < limit; i++ { if c[i] { csum += i compSums = append(compSums, csum) } else { psum += i primeSums = append(primeSums, psum) } } for i := 0; i < len(primeSums); i++ { ix := sort.SearchInts(compSums, primeSums[i]) if ix < len(compSums) && compSums[ix] == primeSums[i] { cps := rcu.Commatize(primeSums[i]) fmt.Printf("%21s - %12s prime sum, %12s composite sum\n", cps, ord(i+1), ord(ix+1)) } } }
#include <primesieve.hpp> #include <chrono> #include <iomanip> #include <iostream> #include <locale> class composite_iterator { public: composite_iterator(); uint64_t next_composite(); private: uint64_t composite; uint64_t prime; primesieve::iterator pi; }; composite_iterator::composite_iterator() { composite = prime = pi.next_prime(); for (; composite == prime; ++composite) prime = pi.next_prime(); } uint64_t composite_iterator::next_composite() { uint64_t result = composite; while (++composite == prime) prime = pi.next_prime(); return result; } int main() { std::cout.imbue(std::locale("")); auto start = std::chrono::high_resolution_clock::now(); composite_iterator ci; primesieve::iterator pi; uint64_t prime_sum = pi.next_prime(); uint64_t composite_sum = ci.next_composite(); uint64_t prime_index = 1, composite_index = 1; std::cout << "Sum | Prime Index | Composite Index\n"; std::cout << "------------------------------------------------------\n"; for (int count = 0; count < 11;) { if (prime_sum == composite_sum) { std::cout << std::right << std::setw(21) << prime_sum << " | " << std::setw(12) << prime_index << " | " << std::setw(15) << composite_index << '\n'; composite_sum += ci.next_composite(); prime_sum += pi.next_prime(); ++prime_index; ++composite_index; ++count; } else if (prime_sum < composite_sum) { prime_sum += pi.next_prime(); ++prime_index; } else { composite_sum += ci.next_composite(); ++composite_index; } } auto end = std::chrono::high_resolution_clock::now(); std::chrono::duration<double> duration(end - start); std::cout << "\nElapsed time: " << duration.count() << " seconds\n"; }
Rewrite this program in C++ while keeping its functionality equivalent to the Go version.
package main import ( "fmt" "github.com/nsf/termbox-go" "github.com/simulatedsimian/joystick" "log" "os" "strconv" "time" ) func printAt(x, y int, s string) { for _, r := range s { termbox.SetCell(x, y, r, termbox.ColorDefault, termbox.ColorDefault) x++ } } func readJoystick(js joystick.Joystick, hidden bool) { jinfo, err := js.Read() check(err) w, h := termbox.Size() tbcd := termbox.ColorDefault termbox.Clear(tbcd, tbcd) printAt(1, h-1, "q - quit") if hidden { printAt(11, h-1, "s - show buttons:") } else { bs := "" printAt(11, h-1, "h - hide buttons:") for button := 0; button < js.ButtonCount(); button++ { if jinfo.Buttons&(1<<uint32(button)) != 0 { bs += fmt.Sprintf(" %X", button+1) } } printAt(28, h-1, bs) } x := int(float64((jinfo.AxisData[0]+32767)*(w-1)) / 65535) y := int(float64((jinfo.AxisData[1]+32767)*(h-2)) / 65535) printAt(x, y, "+") termbox.Flush() } func check(err error) { if err != nil { log.Fatal(err) } } func main() { jsid := 0 if len(os.Args) > 1 { i, err := strconv.Atoi(os.Args[1]) check(err) jsid = i } js, jserr := joystick.Open(jsid) check(jserr) err := termbox.Init() check(err) defer termbox.Close() eventQueue := make(chan termbox.Event) go func() { for { eventQueue <- termbox.PollEvent() } }() ticker := time.NewTicker(time.Millisecond * 40) hidden := false for doQuit := false; !doQuit; { select { case ev := <-eventQueue: if ev.Type == termbox.EventKey { if ev.Ch == 'q' { doQuit = true } else if ev.Ch == 'h' { hidden = true } else if ev.Ch == 's' { hidden = false } } if ev.Type == termbox.EventResize { termbox.Flush() } case <-ticker.C: readJoystick(js, hidden) } } }
#include <stdio.h> #include <stdlib.h> void clear() { for(int n = 0;n < 10; n++) { printf("\r\n\r\n\r\n\r\n\r\n\r\n\r\n\r\r\n\r\n\r\n"); } } #define UP "00^00\r\n00|00\r\n00000\r\n" #define DOWN "00000\r\n00|00\r\n00v00\r\n" #define LEFT "00000\r\n<--00\r\n00000\r\n" #define RIGHT "00000\r\n00-->\r\n00000\r\n" #define HOME "00000\r\n00+00\r\n00000\r\n" int main() { clear(); system("stty raw"); printf(HOME); printf("space to exit; wasd to move\r\n"); char c = 1; while(c) { c = getc(stdin); clear(); switch (c) { case 'a': printf(LEFT); break; case 'd': printf(RIGHT); break; case 'w': printf(UP); break; case 's': printf(DOWN); break; case ' ': c = 0; break; default: printf(HOME); }; printf("space to exit; wasd key to move\r\n"); } system("stty cooked"); system("clear"); return 1; }
Produce a language-to-language conversion: from Go to C++, same semantics.
package main import ( "fmt" "rcu" ) func main() { limit := int(1e9) gapStarts := make(map[int]int) primes := rcu.Primes(limit * 5) for i := 1; i < len(primes); i++ { gap := primes[i] - primes[i-1] if _, ok := gapStarts[gap]; !ok { gapStarts[gap] = primes[i-1] } } pm := 10 gap1 := 2 for { for _, ok := gapStarts[gap1]; !ok; { gap1 += 2 } start1 := gapStarts[gap1] gap2 := gap1 + 2 if _, ok := gapStarts[gap2]; !ok { gap1 = gap2 + 2 continue } start2 := gapStarts[gap2] diff := start2 - start1 if diff < 0 { diff = -diff } if diff > pm { cpm := rcu.Commatize(pm) cst1 := rcu.Commatize(start1) cst2 := rcu.Commatize(start2) cd := rcu.Commatize(diff) fmt.Printf("Earliest difference > %s between adjacent prime gap starting primes:\n", cpm) fmt.Printf("Gap %d starts at %s, gap %d starts at %s, difference is %s.\n\n", gap1, cst1, gap2, cst2, cd) if pm == limit { break } pm *= 10 } else { gap1 = gap2 } } }
#include <iostream> #include <locale> #include <unordered_map> #include <primesieve.hpp> class prime_gaps { public: prime_gaps() { last_prime_ = iterator_.next_prime(); } uint64_t find_gap_start(uint64_t gap); private: primesieve::iterator iterator_; uint64_t last_prime_; std::unordered_map<uint64_t, uint64_t> gap_starts_; }; uint64_t prime_gaps::find_gap_start(uint64_t gap) { auto i = gap_starts_.find(gap); if (i != gap_starts_.end()) return i->second; for (;;) { uint64_t prev = last_prime_; last_prime_ = iterator_.next_prime(); uint64_t diff = last_prime_ - prev; gap_starts_.emplace(diff, prev); if (gap == diff) return prev; } } int main() { std::cout.imbue(std::locale("")); const uint64_t limit = 100000000000; prime_gaps pg; for (uint64_t pm = 10, gap1 = 2;;) { uint64_t start1 = pg.find_gap_start(gap1); uint64_t gap2 = gap1 + 2; uint64_t start2 = pg.find_gap_start(gap2); uint64_t diff = start2 > start1 ? start2 - start1 : start1 - start2; if (diff > pm) { std::cout << "Earliest difference > " << pm << " between adjacent prime gap starting primes:\n" << "Gap " << gap1 << " starts at " << start1 << ", gap " << gap2 << " starts at " << start2 << ", difference is " << diff << ".\n\n"; if (pm == limit) break; pm *= 10; } else { gap1 = gap2; } } }
Port the provided Go code into C++ while preserving the original functionality.
package main import ( "fmt" "sort" ) type matrix [][]int func dList(n, start int) (r matrix) { start-- a := make([]int, n) for i := range a { a[i] = i } a[0], a[start] = start, a[0] sort.Ints(a[1:]) first := a[1] var recurse func(last int) recurse = func(last int) { if last == first { for j, v := range a[1:] { if j+1 == v { return } } b := make([]int, n) copy(b, a) for i := range b { b[i]++ } r = append(r, b) return } for i := last; i >= 1; i-- { a[i], a[last] = a[last], a[i] recurse(last - 1) a[i], a[last] = a[last], a[i] } } recurse(n - 1) return } func reducedLatinSquare(n int, echo bool) uint64 { if n <= 0 { if echo { fmt.Println("[]\n") } return 0 } else if n == 1 { if echo { fmt.Println("[1]\n") } return 1 } rlatin := make(matrix, n) for i := 0; i < n; i++ { rlatin[i] = make([]int, n) } for j := 0; j < n; j++ { rlatin[0][j] = j + 1 } count := uint64(0) var recurse func(i int) recurse = func(i int) { rows := dList(n, i) outer: for r := 0; r < len(rows); r++ { copy(rlatin[i-1], rows[r]) for k := 0; k < i-1; k++ { for j := 1; j < n; j++ { if rlatin[k][j] == rlatin[i-1][j] { if r < len(rows)-1 { continue outer } else if i > 2 { return } } } } if i < n { recurse(i + 1) } else { count++ if echo { printSquare(rlatin, n) } } } return } recurse(2) return count } func printSquare(latin matrix, n int) { for i := 0; i < n; i++ { fmt.Println(latin[i]) } fmt.Println() } func factorial(n uint64) uint64 { if n == 0 { return 1 } prod := uint64(1) for i := uint64(2); i <= n; i++ { prod *= i } return prod } func main() { fmt.Println("The four reduced latin squares of order 4 are:\n") reducedLatinSquare(4, true) fmt.Println("The size of the set of reduced latin squares for the following orders") fmt.Println("and hence the total number of latin squares of these orders are:\n") for n := uint64(1); n <= 6; n++ { size := reducedLatinSquare(int(n), false) f := factorial(n - 1) f *= f * n * size fmt.Printf("Order %d: Size %-4d x %d! x %d! => Total %d\n", n, size, n, n-1, f) } }
#include <algorithm> #include <functional> #include <iostream> #include <numeric> #include <vector> typedef std::vector<std::vector<int>> matrix; matrix dList(int n, int start) { start--; std::vector<int> a(n); std::iota(a.begin(), a.end(), 0); a[start] = a[0]; a[0] = start; std::sort(a.begin() + 1, a.end()); auto first = a[1]; matrix r; std::function<void(int)> recurse; recurse = [&](int last) { if (last == first) { for (size_t j = 1; j < a.size(); j++) { auto v = a[j]; if (j == v) { return; } } std::vector<int> b; std::transform(a.cbegin(), a.cend(), std::back_inserter(b), [](int v) { return v + 1; }); r.push_back(b); return; } for (int i = last; i >= 1; i--) { std::swap(a[i], a[last]); recurse(last - 1); std::swap(a[i], a[last]); } }; recurse(n - 1); return r; } void printSquare(const matrix &latin, int n) { for (auto &row : latin) { auto it = row.cbegin(); auto end = row.cend(); std::cout << '['; if (it != end) { std::cout << *it; it = std::next(it); } while (it != end) { std::cout << ", " << *it; it = std::next(it); } std::cout << "]\n"; } std::cout << '\n'; } unsigned long reducedLatinSquares(int n, bool echo) { if (n <= 0) { if (echo) { std::cout << "[]\n"; } return 0; } else if (n == 1) { if (echo) { std::cout << "[1]\n"; } return 1; } matrix rlatin; for (int i = 0; i < n; i++) { rlatin.push_back({}); for (int j = 0; j < n; j++) { rlatin[i].push_back(j); } } for (int j = 0; j < n; j++) { rlatin[0][j] = j + 1; } unsigned long count = 0; std::function<void(int)> recurse; recurse = [&](int i) { auto rows = dList(n, i); for (size_t r = 0; r < rows.size(); r++) { rlatin[i - 1] = rows[r]; for (int k = 0; k < i - 1; k++) { for (int j = 1; j < n; j++) { if (rlatin[k][j] == rlatin[i - 1][j]) { if (r < rows.size() - 1) { goto outer; } if (i > 2) { return; } } } } if (i < n) { recurse(i + 1); } else { count++; if (echo) { printSquare(rlatin, n); } } outer: {} } }; recurse(2); return count; } unsigned long factorial(unsigned long n) { if (n <= 0) return 1; unsigned long prod = 1; for (unsigned long i = 2; i <= n; i++) { prod *= i; } return prod; } int main() { std::cout << "The four reduced lating squares of order 4 are:\n"; reducedLatinSquares(4, true); std::cout << "The size of the set of reduced latin squares for the following orders\n"; std::cout << "and hence the total number of latin squares of these orders are:\n\n"; for (int n = 1; n < 7; n++) { auto size = reducedLatinSquares(n, false); auto f = factorial(n - 1); f *= f * n * size; std::cout << "Order " << n << ": Size " << size << " x " << n << "! x " << (n - 1) << "! => Total " << f << '\n'; } return 0; }
Please provide an equivalent version of this Go code in C++.
package main import ( "fmt" "rcu" ) func main() { const limit = 1e9 primes := rcu.Primes(limit) var orm30 [][2]int j := int(1e5) count := 0 var counts []int for i := 0; i < len(primes)-1; i++ { p1 := primes[i] p2 := primes[i+1] if (p2-p1)%18 != 0 { continue } key1 := 1 for _, dig := range rcu.Digits(p1, 10) { key1 *= primes[dig] } key2 := 1 for _, dig := range rcu.Digits(p2, 10) { key2 *= primes[dig] } if key1 == key2 { if count < 30 { orm30 = append(orm30, [2]int{p1, p2}) } if p1 >= j { counts = append(counts, count) j *= 10 } count++ } } counts = append(counts, count) fmt.Println("First 30 Ormiston pairs:") for i := 0; i < 30; i++ { fmt.Printf("%5v ", orm30[i]) if (i+1)%3 == 0 { fmt.Println() } } fmt.Println() j = int(1e5) for i := 0; i < len(counts); i++ { fmt.Printf("%s Ormiston pairs before %s\n", rcu.Commatize(counts[i]), rcu.Commatize(j)) j *= 10 } }
#include <array> #include <iomanip> #include <iostream> #include <utility> #include <primesieve.hpp> class ormiston_pair_generator { public: ormiston_pair_generator() { prime_ = pi_.next_prime(); } std::pair<uint64_t, uint64_t> next_pair() { for (;;) { uint64_t prime = prime_; auto digits = digits_; prime_ = pi_.next_prime(); digits_ = get_digits(prime_); if (digits_ == digits) return std::make_pair(prime, prime_); } } private: static std::array<int, 10> get_digits(uint64_t n) { std::array<int, 10> result = {}; for (; n > 0; n /= 10) ++result[n % 10]; return result; } primesieve::iterator pi_; uint64_t prime_; std::array<int, 10> digits_; }; int main() { ormiston_pair_generator generator; int count = 0; std::cout << "First 30 Ormiston pairs:\n"; for (; count < 30; ++count) { auto [p1, p2] = generator.next_pair(); std::cout << '(' << std::setw(5) << p1 << ", " << std::setw(5) << p2 << ')' << ((count + 1) % 3 == 0 ? '\n' : ' '); } std::cout << '\n'; for (uint64_t limit = 1000000; limit <= 1000000000; ++count) { auto [p1, p2] = generator.next_pair(); if (p1 > limit) { std::cout << "Number of Ormiston pairs < " << limit << ": " << count << '\n'; limit *= 10; } } }
Change the programming language of this snippet from Go to C++ without modifying what it does.
package main import ( "fmt" "regexp" ) var bits = []string{ "0 0 0 1 1 0 1 ", "0 0 1 1 0 0 1 ", "0 0 1 0 0 1 1 ", "0 1 1 1 1 0 1 ", "0 1 0 0 0 1 1 ", "0 1 1 0 0 0 1 ", "0 1 0 1 1 1 1 ", "0 1 1 1 0 1 1 ", "0 1 1 0 1 1 1 ", "0 0 0 1 0 1 1 ", } var ( lhs = make(map[string]int) rhs = make(map[string]int) ) var weights = []int{3, 1, 3, 1, 3, 1, 3, 1, 3, 1, 3, 1} const ( s = "# #" m = " # # " e = "# #" d = "(?:#| ){7}" ) func init() { for i := 0; i <= 9; i++ { lt := make([]byte, 7) rt := make([]byte, 7) for j := 0; j < 14; j += 2 { if bits[i][j] == '1' { lt[j/2] = '#' rt[j/2] = ' ' } else { lt[j/2] = ' ' rt[j/2] = '#' } } lhs[string(lt)] = i rhs[string(rt)] = i } } func reverse(s string) string { b := []byte(s) for i, j := 0, len(b)-1; i < j; i, j = i+1, j-1 { b[i], b[j] = b[j], b[i] } return string(b) } func main() { barcodes := []string{ " # # # ## # ## # ## ### ## ### ## #### # # # ## ## # # ## ## ### # ## ## ### # # # ", " # # # ## ## # #### # # ## # ## # ## # # # ### # ### ## ## ### # # ### ### # # # ", " # # # # # ### # # # # # # # # # # ## # ## # ## # ## # # #### ### ## # # ", " # # ## ## ## ## # # # # ### # ## ## # # # ## ## # ### ## ## # # #### ## # # # ", " # # ### ## # ## ## ### ## # ## # # ## # # ### # ## ## # # ### # ## ## # # # ", " # # # # ## ## # # # # ## ## # # # # # #### # ## # #### #### # # ## # #### # # ", " # # # ## ## # # ## ## # ### ## ## # # # # # # # # ### # # ### # # # # # ", " # # # # ## ## # # ## ## ### # # # # # ### ## ## ### ## ### ### ## # ## ### ## # # ", " # # ### ## ## # # #### # ## # #### # #### # # # # # ### # # ### # # # ### # # # ", " # # # #### ## # #### # # ## ## ### #### # # # # ### # ### ### # # ### # # # ### # # ", } expr := fmt.Sprintf(`^\s*%s(%s)(%s)(%s)(%s)(%s)(%s)%s(%s)(%s)(%s)(%s)(%s)(%s)%s\s*$`, s, d, d, d, d, d, d, m, d, d, d, d, d, d, e) rx := regexp.MustCompile(expr) fmt.Println("UPC-A barcodes:") for i, bc := range barcodes { for j := 0; j <= 1; j++ { if !rx.MatchString(bc) { fmt.Printf("%2d: Invalid format\n", i+1) break } codes := rx.FindStringSubmatch(bc) digits := make([]int, 12) var invalid, ok bool for i := 1; i <= 6; i++ { digits[i-1], ok = lhs[codes[i]] if !ok { invalid = true } digits[i+5], ok = rhs[codes[i+6]] if !ok { invalid = true } } if invalid { if j == 0 { bc = reverse(bc) continue } else { fmt.Printf("%2d: Invalid digit(s)\n", i+1) break } } sum := 0 for i, d := range digits { sum += weights[i] * d } if sum%10 != 0 { fmt.Printf("%2d: Checksum error\n", i+1) break } else { ud := "" if j == 1 { ud = "(upside down)" } fmt.Printf("%2d: %v %s\n", i+1, digits, ud) break } } } }
#include <iostream> #include <locale> #include <map> #include <vector> std::string trim(const std::string &str) { auto s = str; auto it1 = std::find_if(s.rbegin(), s.rend(), [](char ch) { return !std::isspace<char>(ch, std::locale::classic()); }); s.erase(it1.base(), s.end()); auto it2 = std::find_if(s.begin(), s.end(), [](char ch) { return !std::isspace<char>(ch, std::locale::classic()); }); s.erase(s.begin(), it2); return s; } template <typename T> std::ostream &operator<<(std::ostream &os, const std::vector<T> &v) { auto it = v.cbegin(); auto end = v.cend(); os << '['; if (it != end) { os << *it; it = std::next(it); } while (it != end) { os << ", " << *it; it = std::next(it); } return os << ']'; } const std::map<std::string, int> LEFT_DIGITS = { {" ## #", 0}, {" ## #", 1}, {" # ##", 2}, {" #### #", 3}, {" # ##", 4}, {" ## #", 5}, {" # ####", 6}, {" ### ##", 7}, {" ## ###", 8}, {" # ##", 9} }; const std::map<std::string, int> RIGHT_DIGITS = { {"### # ", 0}, {"## ## ", 1}, {"## ## ", 2}, {"# # ", 3}, {"# ### ", 4}, {"# ### ", 5}, {"# # ", 6}, {"# # ", 7}, {"# # ", 8}, {"### # ", 9} }; const std::string END_SENTINEL = "# #"; const std::string MID_SENTINEL = " # # "; void decodeUPC(const std::string &input) { auto decode = [](const std::string &candidate) { using OT = std::vector<int>; OT output; size_t pos = 0; auto part = candidate.substr(pos, END_SENTINEL.length()); if (part == END_SENTINEL) { pos += END_SENTINEL.length(); } else { return std::make_pair(false, OT{}); } for (size_t i = 0; i < 6; i++) { part = candidate.substr(pos, 7); pos += 7; auto e = LEFT_DIGITS.find(part); if (e != LEFT_DIGITS.end()) { output.push_back(e->second); } else { return std::make_pair(false, output); } } part = candidate.substr(pos, MID_SENTINEL.length()); if (part == MID_SENTINEL) { pos += MID_SENTINEL.length(); } else { return std::make_pair(false, OT{}); } for (size_t i = 0; i < 6; i++) { part = candidate.substr(pos, 7); pos += 7; auto e = RIGHT_DIGITS.find(part); if (e != RIGHT_DIGITS.end()) { output.push_back(e->second); } else { return std::make_pair(false, output); } } part = candidate.substr(pos, END_SENTINEL.length()); if (part == END_SENTINEL) { pos += END_SENTINEL.length(); } else { return std::make_pair(false, OT{}); } int sum = 0; for (size_t i = 0; i < output.size(); i++) { if (i % 2 == 0) { sum += 3 * output[i]; } else { sum += output[i]; } } return std::make_pair(sum % 10 == 0, output); }; auto candidate = trim(input); auto out = decode(candidate); if (out.first) { std::cout << out.second << '\n'; } else { std::reverse(candidate.begin(), candidate.end()); out = decode(candidate); if (out.first) { std::cout << out.second << " Upside down\n"; } else if (out.second.size()) { std::cout << "Invalid checksum\n"; } else { std::cout << "Invalid digit(s)\n"; } } } int main() { std::vector<std::string> barcodes = { " # # # ## # ## # ## ### ## ### ## #### # # # ## ## # # ## ## ### # ## ## ### # # # ", " # # # ## ## # #### # # ## # ## # ## # # # ### # ### ## ## ### # # ### ### # # # ", " # # # # # ### # # # # # # # # # # ## # ## # ## # ## # # #### ### ## # # ", " # # ## ## ## ## # # # # ### # ## ## # # # ## ## # ### ## ## # # #### ## # # # ", " # # ### ## # ## ## ### ## # ## # # ## # # ### # ## ## # # ### # ## ## # # # ", " # # # # ## ## # # # # ## ## # # # # # #### # ## # #### #### # # ## # #### # # ", " # # # ## ## # # ## ## # ### ## ## # # # # # # # # ### # # ### # # # # # ", " # # # # ## ## # # ## ## ### # # # # # ### ## ## ### ## ### ### ## # ## ### ## # # ", " # # ### ## ## # # #### # ## # #### # #### # # # # # ### # # ### # # # ### # # # ", " # # # #### ## # #### # # ## ## ### #### # # # # ### # ### ### # # ### # # # ### # # ", }; for (auto &barcode : barcodes) { decodeUPC(barcode); } return 0; }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "bufio" "fmt" "os" "strings" ) type playfairOption int const ( noQ playfairOption = iota iEqualsJ ) type playfair struct { keyword string pfo playfairOption table [5][5]byte } func (p *playfair) init() { var used [26]bool if p.pfo == noQ { used[16] = true } else { used[9] = true } alphabet := strings.ToUpper(p.keyword) + "ABCDEFGHIJKLMNOPQRSTUVWXYZ" for i, j, k := 0, 0, 0; k < len(alphabet); k++ { c := alphabet[k] if c < 'A' || c > 'Z' { continue } d := int(c - 65) if !used[d] { p.table[i][j] = c used[d] = true j++ if j == 5 { i++ if i == 5 { break } j = 0 } } } } func (p *playfair) getCleanText(plainText string) string { plainText = strings.ToUpper(plainText) var cleanText strings.Builder prevByte := byte('\000') for i := 0; i < len(plainText); i++ { nextByte := plainText[i] if nextByte < 'A' || nextByte > 'Z' || (nextByte == 'Q' && p.pfo == noQ) { continue } if nextByte == 'J' && p.pfo == iEqualsJ { nextByte = 'I' } if nextByte != prevByte { cleanText.WriteByte(nextByte) } else { cleanText.WriteByte('X') cleanText.WriteByte(nextByte) } prevByte = nextByte } l := cleanText.Len() if l%2 == 1 { if cleanText.String()[l-1] != 'X' { cleanText.WriteByte('X') } else { cleanText.WriteByte('Z') } } return cleanText.String() } func (p *playfair) findByte(c byte) (int, int) { for i := 0; i < 5; i++ { for j := 0; j < 5; j++ { if p.table[i][j] == c { return i, j } } } return -1, -1 } func (p *playfair) encode(plainText string) string { cleanText := p.getCleanText(plainText) var cipherText strings.Builder l := len(cleanText) for i := 0; i < l; i += 2 { row1, col1 := p.findByte(cleanText[i]) row2, col2 := p.findByte(cleanText[i+1]) switch { case row1 == row2: cipherText.WriteByte(p.table[row1][(col1+1)%5]) cipherText.WriteByte(p.table[row2][(col2+1)%5]) case col1 == col2: cipherText.WriteByte(p.table[(row1+1)%5][col1]) cipherText.WriteByte(p.table[(row2+1)%5][col2]) default: cipherText.WriteByte(p.table[row1][col2]) cipherText.WriteByte(p.table[row2][col1]) } if i < l-1 { cipherText.WriteByte(' ') } } return cipherText.String() } func (p *playfair) decode(cipherText string) string { var decodedText strings.Builder l := len(cipherText) for i := 0; i < l; i += 3 { row1, col1 := p.findByte(cipherText[i]) row2, col2 := p.findByte(cipherText[i+1]) switch { case row1 == row2: temp := 4 if col1 > 0 { temp = col1 - 1 } decodedText.WriteByte(p.table[row1][temp]) temp = 4 if col2 > 0 { temp = col2 - 1 } decodedText.WriteByte(p.table[row2][temp]) case col1 == col2: temp := 4 if row1 > 0 { temp = row1 - 1 } decodedText.WriteByte(p.table[temp][col1]) temp = 4 if row2 > 0 { temp = row2 - 1 } decodedText.WriteByte(p.table[temp][col2]) default: decodedText.WriteByte(p.table[row1][col2]) decodedText.WriteByte(p.table[row2][col1]) } if i < l-1 { decodedText.WriteByte(' ') } } return decodedText.String() } func (p *playfair) printTable() { fmt.Println("The table to be used is :\n") for i := 0; i < 5; i++ { for j := 0; j < 5; j++ { fmt.Printf("%c ", p.table[i][j]) } fmt.Println() } } func main() { scanner := bufio.NewScanner(os.Stdin) fmt.Print("Enter Playfair keyword : ") scanner.Scan() keyword := scanner.Text() var ignoreQ string for ignoreQ != "y" && ignoreQ != "n" { fmt.Print("Ignore Q when building table y/n : ") scanner.Scan() ignoreQ = strings.ToLower(scanner.Text()) } pfo := noQ if ignoreQ == "n" { pfo = iEqualsJ } var table [5][5]byte pf := &playfair{keyword, pfo, table} pf.init() pf.printTable() fmt.Print("\nEnter plain text : ") scanner.Scan() plainText := scanner.Text() if err := scanner.Err(); err != nil { fmt.Fprintln(os.Stderr, "reading standard input:", err) return } encodedText := pf.encode(plainText) fmt.Println("\nEncoded text is :", encodedText) decodedText := pf.decode(encodedText) fmt.Println("Deccoded text is :", decodedText) }
#include <iostream> #include <string> using namespace std; class playfair { public: void doIt( string k, string t, bool ij, bool e ) { createGrid( k, ij ); getTextReady( t, ij, e ); if( e ) doIt( 1 ); else doIt( -1 ); display(); } private: void doIt( int dir ) { int a, b, c, d; string ntxt; for( string::const_iterator ti = _txt.begin(); ti != _txt.end(); ti++ ) { if( getCharPos( *ti++, a, b ) ) if( getCharPos( *ti, c, d ) ) { if( a == c ) { ntxt += getChar( a, b + dir ); ntxt += getChar( c, d + dir ); } else if( b == d ){ ntxt += getChar( a + dir, b ); ntxt += getChar( c + dir, d ); } else { ntxt += getChar( c, b ); ntxt += getChar( a, d ); } } } _txt = ntxt; } void display() { cout << "\n\n OUTPUT:\n=========" << endl; string::iterator si = _txt.begin(); int cnt = 0; while( si != _txt.end() ) { cout << *si; si++; cout << *si << " "; si++; if( ++cnt >= 26 ) cout << endl, cnt = 0; } cout << endl << endl; } char getChar( int a, int b ) { return _m[ (b + 5) % 5 ][ (a + 5) % 5 ]; } bool getCharPos( char l, int &a, int &b ) { for( int y = 0; y < 5; y++ ) for( int x = 0; x < 5; x++ ) if( _m[y][x] == l ) { a = x; b = y; return true; } return false; } void getTextReady( string t, bool ij, bool e ) { for( string::iterator si = t.begin(); si != t.end(); si++ ) { *si = toupper( *si ); if( *si < 65 || *si > 90 ) continue; if( *si == 'J' && ij ) *si = 'I'; else if( *si == 'Q' && !ij ) continue; _txt += *si; } if( e ) { string ntxt = ""; size_t len = _txt.length(); for( size_t x = 0; x < len; x += 2 ) { ntxt += _txt[x]; if( x + 1 < len ) { if( _txt[x] == _txt[x + 1] ) ntxt += 'X'; ntxt += _txt[x + 1]; } } _txt = ntxt; } if( _txt.length() & 1 ) _txt += 'X'; } void createGrid( string k, bool ij ) { if( k.length() < 1 ) k = "KEYWORD"; k += "ABCDEFGHIJKLMNOPQRSTUVWXYZ"; string nk = ""; for( string::iterator si = k.begin(); si != k.end(); si++ ) { *si = toupper( *si ); if( *si < 65 || *si > 90 ) continue; if( ( *si == 'J' && ij ) || ( *si == 'Q' && !ij ) )continue; if( nk.find( *si ) == -1 ) nk += *si; } copy( nk.begin(), nk.end(), &_m[0][0] ); } string _txt; char _m[5][5]; }; int main( int argc, char* argv[] ) { string key, i, txt; bool ij, e; cout << "(E)ncode or (D)ecode? "; getline( cin, i ); e = ( i[0] == 'e' || i[0] == 'E' ); cout << "Enter a en/decryption key: "; getline( cin, key ); cout << "I <-> J (Y/N): "; getline( cin, i ); ij = ( i[0] == 'y' || i[0] == 'Y' ); cout << "Enter the text: "; getline( cin, txt ); playfair pf; pf.doIt( key, txt, ij, e ); return system( "pause" ); }
Convert this Go block to C++, preserving its control flow and logic.
package main import ( "bufio" "fmt" "os" "strings" ) type playfairOption int const ( noQ playfairOption = iota iEqualsJ ) type playfair struct { keyword string pfo playfairOption table [5][5]byte } func (p *playfair) init() { var used [26]bool if p.pfo == noQ { used[16] = true } else { used[9] = true } alphabet := strings.ToUpper(p.keyword) + "ABCDEFGHIJKLMNOPQRSTUVWXYZ" for i, j, k := 0, 0, 0; k < len(alphabet); k++ { c := alphabet[k] if c < 'A' || c > 'Z' { continue } d := int(c - 65) if !used[d] { p.table[i][j] = c used[d] = true j++ if j == 5 { i++ if i == 5 { break } j = 0 } } } } func (p *playfair) getCleanText(plainText string) string { plainText = strings.ToUpper(plainText) var cleanText strings.Builder prevByte := byte('\000') for i := 0; i < len(plainText); i++ { nextByte := plainText[i] if nextByte < 'A' || nextByte > 'Z' || (nextByte == 'Q' && p.pfo == noQ) { continue } if nextByte == 'J' && p.pfo == iEqualsJ { nextByte = 'I' } if nextByte != prevByte { cleanText.WriteByte(nextByte) } else { cleanText.WriteByte('X') cleanText.WriteByte(nextByte) } prevByte = nextByte } l := cleanText.Len() if l%2 == 1 { if cleanText.String()[l-1] != 'X' { cleanText.WriteByte('X') } else { cleanText.WriteByte('Z') } } return cleanText.String() } func (p *playfair) findByte(c byte) (int, int) { for i := 0; i < 5; i++ { for j := 0; j < 5; j++ { if p.table[i][j] == c { return i, j } } } return -1, -1 } func (p *playfair) encode(plainText string) string { cleanText := p.getCleanText(plainText) var cipherText strings.Builder l := len(cleanText) for i := 0; i < l; i += 2 { row1, col1 := p.findByte(cleanText[i]) row2, col2 := p.findByte(cleanText[i+1]) switch { case row1 == row2: cipherText.WriteByte(p.table[row1][(col1+1)%5]) cipherText.WriteByte(p.table[row2][(col2+1)%5]) case col1 == col2: cipherText.WriteByte(p.table[(row1+1)%5][col1]) cipherText.WriteByte(p.table[(row2+1)%5][col2]) default: cipherText.WriteByte(p.table[row1][col2]) cipherText.WriteByte(p.table[row2][col1]) } if i < l-1 { cipherText.WriteByte(' ') } } return cipherText.String() } func (p *playfair) decode(cipherText string) string { var decodedText strings.Builder l := len(cipherText) for i := 0; i < l; i += 3 { row1, col1 := p.findByte(cipherText[i]) row2, col2 := p.findByte(cipherText[i+1]) switch { case row1 == row2: temp := 4 if col1 > 0 { temp = col1 - 1 } decodedText.WriteByte(p.table[row1][temp]) temp = 4 if col2 > 0 { temp = col2 - 1 } decodedText.WriteByte(p.table[row2][temp]) case col1 == col2: temp := 4 if row1 > 0 { temp = row1 - 1 } decodedText.WriteByte(p.table[temp][col1]) temp = 4 if row2 > 0 { temp = row2 - 1 } decodedText.WriteByte(p.table[temp][col2]) default: decodedText.WriteByte(p.table[row1][col2]) decodedText.WriteByte(p.table[row2][col1]) } if i < l-1 { decodedText.WriteByte(' ') } } return decodedText.String() } func (p *playfair) printTable() { fmt.Println("The table to be used is :\n") for i := 0; i < 5; i++ { for j := 0; j < 5; j++ { fmt.Printf("%c ", p.table[i][j]) } fmt.Println() } } func main() { scanner := bufio.NewScanner(os.Stdin) fmt.Print("Enter Playfair keyword : ") scanner.Scan() keyword := scanner.Text() var ignoreQ string for ignoreQ != "y" && ignoreQ != "n" { fmt.Print("Ignore Q when building table y/n : ") scanner.Scan() ignoreQ = strings.ToLower(scanner.Text()) } pfo := noQ if ignoreQ == "n" { pfo = iEqualsJ } var table [5][5]byte pf := &playfair{keyword, pfo, table} pf.init() pf.printTable() fmt.Print("\nEnter plain text : ") scanner.Scan() plainText := scanner.Text() if err := scanner.Err(); err != nil { fmt.Fprintln(os.Stderr, "reading standard input:", err) return } encodedText := pf.encode(plainText) fmt.Println("\nEncoded text is :", encodedText) decodedText := pf.decode(encodedText) fmt.Println("Deccoded text is :", decodedText) }
#include <iostream> #include <string> using namespace std; class playfair { public: void doIt( string k, string t, bool ij, bool e ) { createGrid( k, ij ); getTextReady( t, ij, e ); if( e ) doIt( 1 ); else doIt( -1 ); display(); } private: void doIt( int dir ) { int a, b, c, d; string ntxt; for( string::const_iterator ti = _txt.begin(); ti != _txt.end(); ti++ ) { if( getCharPos( *ti++, a, b ) ) if( getCharPos( *ti, c, d ) ) { if( a == c ) { ntxt += getChar( a, b + dir ); ntxt += getChar( c, d + dir ); } else if( b == d ){ ntxt += getChar( a + dir, b ); ntxt += getChar( c + dir, d ); } else { ntxt += getChar( c, b ); ntxt += getChar( a, d ); } } } _txt = ntxt; } void display() { cout << "\n\n OUTPUT:\n=========" << endl; string::iterator si = _txt.begin(); int cnt = 0; while( si != _txt.end() ) { cout << *si; si++; cout << *si << " "; si++; if( ++cnt >= 26 ) cout << endl, cnt = 0; } cout << endl << endl; } char getChar( int a, int b ) { return _m[ (b + 5) % 5 ][ (a + 5) % 5 ]; } bool getCharPos( char l, int &a, int &b ) { for( int y = 0; y < 5; y++ ) for( int x = 0; x < 5; x++ ) if( _m[y][x] == l ) { a = x; b = y; return true; } return false; } void getTextReady( string t, bool ij, bool e ) { for( string::iterator si = t.begin(); si != t.end(); si++ ) { *si = toupper( *si ); if( *si < 65 || *si > 90 ) continue; if( *si == 'J' && ij ) *si = 'I'; else if( *si == 'Q' && !ij ) continue; _txt += *si; } if( e ) { string ntxt = ""; size_t len = _txt.length(); for( size_t x = 0; x < len; x += 2 ) { ntxt += _txt[x]; if( x + 1 < len ) { if( _txt[x] == _txt[x + 1] ) ntxt += 'X'; ntxt += _txt[x + 1]; } } _txt = ntxt; } if( _txt.length() & 1 ) _txt += 'X'; } void createGrid( string k, bool ij ) { if( k.length() < 1 ) k = "KEYWORD"; k += "ABCDEFGHIJKLMNOPQRSTUVWXYZ"; string nk = ""; for( string::iterator si = k.begin(); si != k.end(); si++ ) { *si = toupper( *si ); if( *si < 65 || *si > 90 ) continue; if( ( *si == 'J' && ij ) || ( *si == 'Q' && !ij ) )continue; if( nk.find( *si ) == -1 ) nk += *si; } copy( nk.begin(), nk.end(), &_m[0][0] ); } string _txt; char _m[5][5]; }; int main( int argc, char* argv[] ) { string key, i, txt; bool ij, e; cout << "(E)ncode or (D)ecode? "; getline( cin, i ); e = ( i[0] == 'e' || i[0] == 'E' ); cout << "Enter a en/decryption key: "; getline( cin, key ); cout << "I <-> J (Y/N): "; getline( cin, i ); ij = ( i[0] == 'y' || i[0] == 'Y' ); cout << "Enter the text: "; getline( cin, txt ); playfair pf; pf.doIt( key, txt, ij, e ); return system( "pause" ); }
Rewrite this program in C++ while keeping its functionality equivalent to the Go version.
package main import ( "fmt" "math/big" ) func harmonic(n int) *big.Rat { sum := new(big.Rat) for i := int64(1); i <= int64(n); i++ { r := big.NewRat(1, i) sum.Add(sum, r) } return sum } func main() { fmt.Println("The first 20 harmonic numbers and the 100th, expressed in rational form, are:") numbers := make([]int, 21) for i := 1; i <= 20; i++ { numbers[i-1] = i } numbers[20] = 100 for _, i := range numbers { fmt.Printf("%3d : %s\n", i, harmonic(i)) } fmt.Println("\nThe first harmonic number to exceed the following integers is:") const limit = 10 for i, n, h := 1, 1, 0.0; i <= limit; n++ { h += 1.0 / float64(n) if h > float64(i) { fmt.Printf("integer = %2d -> n = %6d -> harmonic number = %9.6f (to 6dp)\n", i, n, h) i++ } } }
#include <iomanip> #include <iostream> #include <boost/rational.hpp> #include <boost/multiprecision/gmp.hpp> using integer = boost::multiprecision::mpz_int; using rational = boost::rational<integer>; class harmonic_generator { public: rational next() { rational result = term_; term_ += rational(1, ++n_); return result; } void reset() { n_ = 1; term_ = 1; } private: integer n_ = 1; rational term_ = 1; }; int main() { std::cout << "First 20 harmonic numbers:\n"; harmonic_generator hgen; for (int i = 1; i <= 20; ++i) std::cout << std::setw(2) << i << ". " << hgen.next() << '\n'; rational h; for (int i = 1; i <= 80; ++i) h = hgen.next(); std::cout << "\n100th harmonic number: " << h << "\n\n"; int n = 1; hgen.reset(); for (int i = 1; n <= 10; ++i) { if (hgen.next() > n) std::cout << "Position of first term > " << std::setw(2) << n++ << ": " << i << '\n'; } }
Translate this program into C++ but keep the logic exactly as in Go.
package main import ( "fmt" "io" "log" "math" "math/rand" "os" "time" ) type MinHeapNode struct{ element, index int } type MinHeap struct{ nodes []MinHeapNode } func left(i int) int { return (2*i + 1) } func right(i int) int { return (2*i + 2) } func newMinHeap(nodes []MinHeapNode) *MinHeap { mh := new(MinHeap) mh.nodes = nodes for i := (len(nodes) - 1) / 2; i >= 0; i-- { mh.minHeapify(i) } return mh } func (mh *MinHeap) getMin() MinHeapNode { return mh.nodes[0] } func (mh *MinHeap) replaceMin(x MinHeapNode) { mh.nodes[0] = x mh.minHeapify(0) } func (mh *MinHeap) minHeapify(i int) { l, r := left(i), right(i) smallest := i heapSize := len(mh.nodes) if l < heapSize && mh.nodes[l].element < mh.nodes[i].element { smallest = l } if r < heapSize && mh.nodes[r].element < mh.nodes[smallest].element { smallest = r } if smallest != i { mh.nodes[i], mh.nodes[smallest] = mh.nodes[smallest], mh.nodes[i] mh.minHeapify(smallest) } } func merge(arr []int, l, m, r int) { n1, n2 := m-l+1, r-m tl := make([]int, n1) tr := make([]int, n2) copy(tl, arr[l:]) copy(tr, arr[m+1:]) i, j, k := 0, 0, l for i < n1 && j < n2 { if tl[i] <= tr[j] { arr[k] = tl[i] k++ i++ } else { arr[k] = tr[j] k++ j++ } } for i < n1 { arr[k] = tl[i] k++ i++ } for j < n2 { arr[k] = tr[j] k++ j++ } } func mergeSort(arr []int, l, r int) { if l < r { m := l + (r-l)/2 mergeSort(arr, l, m) mergeSort(arr, m+1, r) merge(arr, l, m, r) } } func mergeFiles(outputFile string, n, k int) { in := make([]*os.File, k) var err error for i := 0; i < k; i++ { fileName := fmt.Sprintf("es%d", i) in[i], err = os.Open(fileName) check(err) } out, err := os.Create(outputFile) check(err) nodes := make([]MinHeapNode, k) i := 0 for ; i < k; i++ { _, err = fmt.Fscanf(in[i], "%d", &nodes[i].element) if err == io.EOF { break } check(err) nodes[i].index = i } hp := newMinHeap(nodes[:i]) count := 0 for count != i { root := hp.getMin() fmt.Fprintf(out, "%d ", root.element) _, err = fmt.Fscanf(in[root.index], "%d", &root.element) if err == io.EOF { root.element = math.MaxInt32 count++ } else { check(err) } hp.replaceMin(root) } for j := 0; j < k; j++ { in[j].Close() } out.Close() } func check(err error) { if err != nil { log.Fatal(err) } } func createInitialRuns(inputFile string, runSize, numWays int) { in, err := os.Open(inputFile) out := make([]*os.File, numWays) for i := 0; i < numWays; i++ { fileName := fmt.Sprintf("es%d", i) out[i], err = os.Create(fileName) check(err) } arr := make([]int, runSize) moreInput := true nextOutputFile := 0 var i int for moreInput { for i = 0; i < runSize; i++ { _, err := fmt.Fscanf(in, "%d", &arr[i]) if err == io.EOF { moreInput = false break } check(err) } mergeSort(arr, 0, i-1) for j := 0; j < i; j++ { fmt.Fprintf(out[nextOutputFile], "%d ", arr[j]) } nextOutputFile++ } for j := 0; j < numWays; j++ { out[j].Close() } in.Close() } func externalSort(inputFile, outputFile string, numWays, runSize int) { createInitialRuns(inputFile, runSize, numWays) mergeFiles(outputFile, runSize, numWays) } func main() { numWays := 4 runSize := 10 inputFile := "input.txt" outputFile := "output.txt" in, err := os.Create(inputFile) check(err) rand.Seed(time.Now().UnixNano()) for i := 0; i < numWays*runSize; i++ { fmt.Fprintf(in, "%d ", rand.Intn(math.MaxInt32)) } in.Close() externalSort(inputFile, outputFile, numWays, runSize) for i := 0; i < numWays; i++ { fileName := fmt.Sprintf("es%d", i) err = os.Remove(fileName) check(err) } }
#include <iostream> #include <fstream> #include <queue> #include <string> #include <algorithm> #include <cstdio> int main(int argc, char* argv[]); void write_vals(int* const, const size_t, const size_t); std::string mergeFiles(size_t); struct Compare { bool operator() ( std::pair<int, int>& p1, std::pair<int, int>& p2 ) { return p1.first >= p2.first; } }; using ipair = std::pair<int,int>; using pairvector = std::vector<ipair>; using MinHeap = std::priority_queue< ipair, pairvector, Compare >; const size_t memsize = 32; const size_t chunksize = memsize / sizeof(int); const std::string tmp_prefix{"tmp_out_"}; const std::string tmp_suffix{".txt"}; const std::string merged_file{"merged.txt"}; void write_vals( int* const values, const size_t size, const size_t chunk ) { std::string output_file = (tmp_prefix + std::to_string(chunk) + tmp_suffix); std::ofstream ofs(output_file.c_str()); for (int i=0; i<size; i++) ofs << values[i] << '\t'; ofs << '\n'; ofs.close(); } std::string mergeFiles(size_t chunks, const std::string& merge_file ) { std::ofstream ofs( merge_file.c_str() ); MinHeap minHeap; std::ifstream* ifs_tempfiles = new std::ifstream[chunks]; for (size_t i = 1; i<=chunks; i++) { int topval = 0; std::string sorted_file = (tmp_prefix + std::to_string(i) + tmp_suffix); ifs_tempfiles[i-1].open( sorted_file.c_str() ); if (ifs_tempfiles[i-1].is_open()) { ifs_tempfiles[i-1] >> topval; ipair top(topval, (i-1)); minHeap.push( top ); } } while (minHeap.size() > 0) { int next_val = 0; ipair min_pair = minHeap.top(); minHeap.pop(); ofs << min_pair.first << ' '; std::flush(ofs); if ( ifs_tempfiles[min_pair.second] >> next_val) { ipair np( next_val, min_pair.second ); minHeap.push( np ); } } for (int i = 1; i <= chunks; i++) { ifs_tempfiles[i-1].close(); } ofs << '\n'; ofs.close(); delete[] ifs_tempfiles; return merged_file; } int main(int argc, char* argv[] ) { if (argc < 2) { std::cerr << "usage: ExternalSort <filename> \n"; return 1; } std::ifstream ifs( argv[1] ); if ( ifs.fail() ) { std::cerr << "error opening " << argv[1] << "\n"; return 2; } int* inputValues = new int[chunksize]; int chunk = 1; int val = 0; int count = 0; bool done = false; std::cout << "internal buffer is " << memsize << " bytes" << "\n"; while (ifs >> val) { done = false; inputValues[count] = val; count++; if (count == chunksize) { std::sort(inputValues, inputValues + count); write_vals(inputValues, count, chunk); chunk ++; count = 0; done = true; } } if (! done) { std::sort(inputValues, inputValues + count); write_vals(inputValues, count, chunk); } else { chunk --; } ifs.close(); delete[] inputValues; if ( chunk == 0 ) std::cout << "no data found\n"; else std::cout << "Sorted output is in file: " << mergeFiles(chunk, merged_file ) << "\n"; return EXIT_SUCCESS; }
Rewrite the snippet below in C++ so it works the same as the original Go code.
package main import ( "fmt" "io" "log" "math" "math/rand" "os" "time" ) type MinHeapNode struct{ element, index int } type MinHeap struct{ nodes []MinHeapNode } func left(i int) int { return (2*i + 1) } func right(i int) int { return (2*i + 2) } func newMinHeap(nodes []MinHeapNode) *MinHeap { mh := new(MinHeap) mh.nodes = nodes for i := (len(nodes) - 1) / 2; i >= 0; i-- { mh.minHeapify(i) } return mh } func (mh *MinHeap) getMin() MinHeapNode { return mh.nodes[0] } func (mh *MinHeap) replaceMin(x MinHeapNode) { mh.nodes[0] = x mh.minHeapify(0) } func (mh *MinHeap) minHeapify(i int) { l, r := left(i), right(i) smallest := i heapSize := len(mh.nodes) if l < heapSize && mh.nodes[l].element < mh.nodes[i].element { smallest = l } if r < heapSize && mh.nodes[r].element < mh.nodes[smallest].element { smallest = r } if smallest != i { mh.nodes[i], mh.nodes[smallest] = mh.nodes[smallest], mh.nodes[i] mh.minHeapify(smallest) } } func merge(arr []int, l, m, r int) { n1, n2 := m-l+1, r-m tl := make([]int, n1) tr := make([]int, n2) copy(tl, arr[l:]) copy(tr, arr[m+1:]) i, j, k := 0, 0, l for i < n1 && j < n2 { if tl[i] <= tr[j] { arr[k] = tl[i] k++ i++ } else { arr[k] = tr[j] k++ j++ } } for i < n1 { arr[k] = tl[i] k++ i++ } for j < n2 { arr[k] = tr[j] k++ j++ } } func mergeSort(arr []int, l, r int) { if l < r { m := l + (r-l)/2 mergeSort(arr, l, m) mergeSort(arr, m+1, r) merge(arr, l, m, r) } } func mergeFiles(outputFile string, n, k int) { in := make([]*os.File, k) var err error for i := 0; i < k; i++ { fileName := fmt.Sprintf("es%d", i) in[i], err = os.Open(fileName) check(err) } out, err := os.Create(outputFile) check(err) nodes := make([]MinHeapNode, k) i := 0 for ; i < k; i++ { _, err = fmt.Fscanf(in[i], "%d", &nodes[i].element) if err == io.EOF { break } check(err) nodes[i].index = i } hp := newMinHeap(nodes[:i]) count := 0 for count != i { root := hp.getMin() fmt.Fprintf(out, "%d ", root.element) _, err = fmt.Fscanf(in[root.index], "%d", &root.element) if err == io.EOF { root.element = math.MaxInt32 count++ } else { check(err) } hp.replaceMin(root) } for j := 0; j < k; j++ { in[j].Close() } out.Close() } func check(err error) { if err != nil { log.Fatal(err) } } func createInitialRuns(inputFile string, runSize, numWays int) { in, err := os.Open(inputFile) out := make([]*os.File, numWays) for i := 0; i < numWays; i++ { fileName := fmt.Sprintf("es%d", i) out[i], err = os.Create(fileName) check(err) } arr := make([]int, runSize) moreInput := true nextOutputFile := 0 var i int for moreInput { for i = 0; i < runSize; i++ { _, err := fmt.Fscanf(in, "%d", &arr[i]) if err == io.EOF { moreInput = false break } check(err) } mergeSort(arr, 0, i-1) for j := 0; j < i; j++ { fmt.Fprintf(out[nextOutputFile], "%d ", arr[j]) } nextOutputFile++ } for j := 0; j < numWays; j++ { out[j].Close() } in.Close() } func externalSort(inputFile, outputFile string, numWays, runSize int) { createInitialRuns(inputFile, runSize, numWays) mergeFiles(outputFile, runSize, numWays) } func main() { numWays := 4 runSize := 10 inputFile := "input.txt" outputFile := "output.txt" in, err := os.Create(inputFile) check(err) rand.Seed(time.Now().UnixNano()) for i := 0; i < numWays*runSize; i++ { fmt.Fprintf(in, "%d ", rand.Intn(math.MaxInt32)) } in.Close() externalSort(inputFile, outputFile, numWays, runSize) for i := 0; i < numWays; i++ { fileName := fmt.Sprintf("es%d", i) err = os.Remove(fileName) check(err) } }
#include <iostream> #include <fstream> #include <queue> #include <string> #include <algorithm> #include <cstdio> int main(int argc, char* argv[]); void write_vals(int* const, const size_t, const size_t); std::string mergeFiles(size_t); struct Compare { bool operator() ( std::pair<int, int>& p1, std::pair<int, int>& p2 ) { return p1.first >= p2.first; } }; using ipair = std::pair<int,int>; using pairvector = std::vector<ipair>; using MinHeap = std::priority_queue< ipair, pairvector, Compare >; const size_t memsize = 32; const size_t chunksize = memsize / sizeof(int); const std::string tmp_prefix{"tmp_out_"}; const std::string tmp_suffix{".txt"}; const std::string merged_file{"merged.txt"}; void write_vals( int* const values, const size_t size, const size_t chunk ) { std::string output_file = (tmp_prefix + std::to_string(chunk) + tmp_suffix); std::ofstream ofs(output_file.c_str()); for (int i=0; i<size; i++) ofs << values[i] << '\t'; ofs << '\n'; ofs.close(); } std::string mergeFiles(size_t chunks, const std::string& merge_file ) { std::ofstream ofs( merge_file.c_str() ); MinHeap minHeap; std::ifstream* ifs_tempfiles = new std::ifstream[chunks]; for (size_t i = 1; i<=chunks; i++) { int topval = 0; std::string sorted_file = (tmp_prefix + std::to_string(i) + tmp_suffix); ifs_tempfiles[i-1].open( sorted_file.c_str() ); if (ifs_tempfiles[i-1].is_open()) { ifs_tempfiles[i-1] >> topval; ipair top(topval, (i-1)); minHeap.push( top ); } } while (minHeap.size() > 0) { int next_val = 0; ipair min_pair = minHeap.top(); minHeap.pop(); ofs << min_pair.first << ' '; std::flush(ofs); if ( ifs_tempfiles[min_pair.second] >> next_val) { ipair np( next_val, min_pair.second ); minHeap.push( np ); } } for (int i = 1; i <= chunks; i++) { ifs_tempfiles[i-1].close(); } ofs << '\n'; ofs.close(); delete[] ifs_tempfiles; return merged_file; } int main(int argc, char* argv[] ) { if (argc < 2) { std::cerr << "usage: ExternalSort <filename> \n"; return 1; } std::ifstream ifs( argv[1] ); if ( ifs.fail() ) { std::cerr << "error opening " << argv[1] << "\n"; return 2; } int* inputValues = new int[chunksize]; int chunk = 1; int val = 0; int count = 0; bool done = false; std::cout << "internal buffer is " << memsize << " bytes" << "\n"; while (ifs >> val) { done = false; inputValues[count] = val; count++; if (count == chunksize) { std::sort(inputValues, inputValues + count); write_vals(inputValues, count, chunk); chunk ++; count = 0; done = true; } } if (! done) { std::sort(inputValues, inputValues + count); write_vals(inputValues, count, chunk); } else { chunk --; } ifs.close(); delete[] inputValues; if ( chunk == 0 ) std::cout << "no data found\n"; else std::cout << "Sorted output is in file: " << mergeFiles(chunk, merged_file ) << "\n"; return EXIT_SUCCESS; }
Generate an equivalent C++ version of this Go code.
package cf type NG4 struct { A1, A int64 B1, B int64 } func (ng NG4) needsIngest() bool { if ng.isDone() { panic("b₁==b==0") } return ng.B1 == 0 || ng.B == 0 || ng.A1/ng.B1 != ng.A/ng.B } func (ng NG4) isDone() bool { return ng.B1 == 0 && ng.B == 0 } func (ng *NG4) ingest(t int64) { ng.A1, ng.A, ng.B1, ng.B = ng.A+ng.A1*t, ng.A1, ng.B+ng.B1*t, ng.B1 } func (ng *NG4) ingestInfinite() { ng.A, ng.B = ng.A1, ng.B1 } func (ng *NG4) egest(t int64) { ng.A1, ng.A, ng.B1, ng.B = ng.B1, ng.B, ng.A1-ng.B1*t, ng.A-ng.B*t } func (ng NG4) ApplyTo(cf ContinuedFraction) ContinuedFraction { return func() NextFn { next := cf() done := false return func() (int64, bool) { if done { return 0, false } for ng.needsIngest() { if t, ok := next(); ok { ng.ingest(t) } else { ng.ingestInfinite() } } t := ng.A1 / ng.B1 ng.egest(t) done = ng.isDone() return t, true } } }
class matrixNG { private: virtual void consumeTerm(){} virtual void consumeTerm(int n){} virtual const bool needTerm(){} protected: int cfn = 0, thisTerm; bool haveTerm = false; friend class NG; }; class NG_4 : public matrixNG { private: int a1, a, b1, b, t; const bool needTerm() { if (b1==0 and b==0) return false; if (b1==0 or b==0) return true; else thisTerm = a/b; if (thisTerm==(int)(a1/b1)){ t=a; a=b; b=t-b*thisTerm; t=a1; a1=b1; b1=t-b1*thisTerm; haveTerm=true; return false; } return true; } void consumeTerm(){a=a1; b=b1;} void consumeTerm(int n){t=a; a=a1; a1=t+a1*n; t=b; b=b1; b1=t+b1*n;} public: NG_4(int a1, int a, int b1, int b): a1(a1), a(a), b1(b1), b(b){} }; class NG : public ContinuedFraction { private: matrixNG* ng; ContinuedFraction* n[2]; public: NG(NG_4* ng, ContinuedFraction* n1): ng(ng){n[0] = n1;} NG(NG_8* ng, ContinuedFraction* n1, ContinuedFraction* n2): ng(ng){n[0] = n1; n[1] = n2;} const int nextTerm() {ng->haveTerm = false; return ng->thisTerm;} const bool moreTerms(){ while(ng->needTerm()) if(n[ng->cfn]->moreTerms()) ng->consumeTerm(n[ng->cfn]->nextTerm()); else ng->consumeTerm(); return ng->haveTerm; } };
Ensure the translated C++ code behaves exactly like the original Go snippet.
package main import ( "fmt" "math" "math/big" "strconv" "strings" ) func calkinWilf(n int) []*big.Rat { cw := make([]*big.Rat, n+1) cw[0] = big.NewRat(1, 1) one := big.NewRat(1, 1) two := big.NewRat(2, 1) for i := 1; i < n; i++ { t := new(big.Rat).Set(cw[i-1]) f, _ := t.Float64() f = math.Floor(f) t.SetFloat64(f) t.Mul(t, two) t.Sub(t, cw[i-1]) t.Add(t, one) t.Inv(t) cw[i] = new(big.Rat).Set(t) } return cw } func toContinued(r *big.Rat) []int { a := r.Num().Int64() b := r.Denom().Int64() var res []int for { res = append(res, int(a/b)) t := a % b a, b = b, t if a == 1 { break } } le := len(res) if le%2 == 0 { res[le-1]-- res = append(res, 1) } return res } func getTermNumber(cf []int) int { b := "" d := "1" for _, n := range cf { b = strings.Repeat(d, n) + b if d == "1" { d = "0" } else { d = "1" } } i, _ := strconv.ParseInt(b, 2, 64) return int(i) } func commatize(n int) string { s := fmt.Sprintf("%d", n) if n < 0 { s = s[1:] } le := len(s) for i := le - 3; i >= 1; i -= 3 { s = s[0:i] + "," + s[i:] } if n >= 0 { return s } return "-" + s } func main() { cw := calkinWilf(20) fmt.Println("The first 20 terms of the Calkin-Wilf sequnence are:") for i := 1; i <= 20; i++ { fmt.Printf("%2d: %s\n", i, cw[i-1].RatString()) } fmt.Println() r := big.NewRat(83116, 51639) cf := toContinued(r) tn := getTermNumber(cf) fmt.Printf("%s is the %sth term of the sequence.\n", r.RatString(), commatize(tn)) }
#include <iostream> #include <vector> #include <boost/rational.hpp> using rational = boost::rational<unsigned long>; unsigned long floor(const rational& r) { return r.numerator()/r.denominator(); } rational calkin_wilf_next(const rational& term) { return 1UL/(2UL * floor(term) + 1UL - term); } std::vector<unsigned long> continued_fraction(const rational& r) { unsigned long a = r.numerator(); unsigned long b = r.denominator(); std::vector<unsigned long> result; do { result.push_back(a/b); unsigned long c = a; a = b; b = c % b; } while (a != 1); if (result.size() > 0 && result.size() % 2 == 0) { --result.back(); result.push_back(1); } return result; } unsigned long term_number(const rational& r) { unsigned long result = 0; unsigned long d = 1; unsigned long p = 0; for (unsigned long n : continued_fraction(r)) { for (unsigned long i = 0; i < n; ++i, ++p) result |= (d << p); d = !d; } return result; } int main() { rational term = 1; std::cout << "First 20 terms of the Calkin-Wilf sequence are:\n"; for (int i = 1; i <= 20; ++i) { std::cout << std::setw(2) << i << ": " << term << '\n'; term = calkin_wilf_next(term); } rational r(83116, 51639); std::cout << r << " is the " << term_number(r) << "th term of the sequence.\n"; }
Change the following Go code into C++ without altering its purpose.
package main import ( "fmt" "math" "math/big" "strconv" "strings" ) func calkinWilf(n int) []*big.Rat { cw := make([]*big.Rat, n+1) cw[0] = big.NewRat(1, 1) one := big.NewRat(1, 1) two := big.NewRat(2, 1) for i := 1; i < n; i++ { t := new(big.Rat).Set(cw[i-1]) f, _ := t.Float64() f = math.Floor(f) t.SetFloat64(f) t.Mul(t, two) t.Sub(t, cw[i-1]) t.Add(t, one) t.Inv(t) cw[i] = new(big.Rat).Set(t) } return cw } func toContinued(r *big.Rat) []int { a := r.Num().Int64() b := r.Denom().Int64() var res []int for { res = append(res, int(a/b)) t := a % b a, b = b, t if a == 1 { break } } le := len(res) if le%2 == 0 { res[le-1]-- res = append(res, 1) } return res } func getTermNumber(cf []int) int { b := "" d := "1" for _, n := range cf { b = strings.Repeat(d, n) + b if d == "1" { d = "0" } else { d = "1" } } i, _ := strconv.ParseInt(b, 2, 64) return int(i) } func commatize(n int) string { s := fmt.Sprintf("%d", n) if n < 0 { s = s[1:] } le := len(s) for i := le - 3; i >= 1; i -= 3 { s = s[0:i] + "," + s[i:] } if n >= 0 { return s } return "-" + s } func main() { cw := calkinWilf(20) fmt.Println("The first 20 terms of the Calkin-Wilf sequnence are:") for i := 1; i <= 20; i++ { fmt.Printf("%2d: %s\n", i, cw[i-1].RatString()) } fmt.Println() r := big.NewRat(83116, 51639) cf := toContinued(r) tn := getTermNumber(cf) fmt.Printf("%s is the %sth term of the sequence.\n", r.RatString(), commatize(tn)) }
#include <iostream> #include <vector> #include <boost/rational.hpp> using rational = boost::rational<unsigned long>; unsigned long floor(const rational& r) { return r.numerator()/r.denominator(); } rational calkin_wilf_next(const rational& term) { return 1UL/(2UL * floor(term) + 1UL - term); } std::vector<unsigned long> continued_fraction(const rational& r) { unsigned long a = r.numerator(); unsigned long b = r.denominator(); std::vector<unsigned long> result; do { result.push_back(a/b); unsigned long c = a; a = b; b = c % b; } while (a != 1); if (result.size() > 0 && result.size() % 2 == 0) { --result.back(); result.push_back(1); } return result; } unsigned long term_number(const rational& r) { unsigned long result = 0; unsigned long d = 1; unsigned long p = 0; for (unsigned long n : continued_fraction(r)) { for (unsigned long i = 0; i < n; ++i, ++p) result |= (d << p); d = !d; } return result; } int main() { rational term = 1; std::cout << "First 20 terms of the Calkin-Wilf sequence are:\n"; for (int i = 1; i <= 20; ++i) { std::cout << std::setw(2) << i << ": " << term << '\n'; term = calkin_wilf_next(term); } rational r(83116, 51639); std::cout << r << " is the " << term_number(r) << "th term of the sequence.\n"; }
Write the same algorithm in C++ as shown in this Go implementation.
package main import ( "fmt" big "github.com/ncw/gmp" "rcu" ) func main() { fact := big.NewInt(1) sum := 0.0 first := int64(0) firstRatio := 0.0 fmt.Println("The mean proportion of zero digits in factorials up to the following are:") for n := int64(1); n <= 50000; n++ { fact.Mul(fact, big.NewInt(n)) bytes := []byte(fact.String()) digits := len(bytes) zeros := 0 for _, b := range bytes { if b == '0' { zeros++ } } sum += float64(zeros)/float64(digits) ratio := sum / float64(n) if n == 100 || n == 1000 || n == 10000 { fmt.Printf("%6s = %12.10f\n", rcu.Commatize(int(n)), ratio) } if first > 0 && ratio >= 0.16 { first = 0 firstRatio = 0.0 } else if first == 0 && ratio < 0.16 { first = n firstRatio = ratio } } fmt.Printf("%6s = %12.10f", rcu.Commatize(int(first)), firstRatio) fmt.Println(" (stays below 0.16 after this)") fmt.Printf("%6s = %12.10f\n", "50,000", sum / 50000) }
#include <array> #include <chrono> #include <iomanip> #include <iostream> #include <vector> auto init_zc() { std::array<int, 1000> zc; zc.fill(0); zc[0] = 3; for (int x = 1; x <= 9; ++x) { zc[x] = 2; zc[10 * x] = 2; zc[100 * x] = 2; for (int y = 10; y <= 90; y += 10) { zc[y + x] = 1; zc[10 * y + x] = 1; zc[10 * (y + x)] = 1; } } return zc; } template <typename clock_type> auto elapsed(const std::chrono::time_point<clock_type>& t0) { auto t1 = clock_type::now(); auto duration = std::chrono::duration_cast<std::chrono::milliseconds>(t1 - t0); return duration.count(); } int main() { auto zc = init_zc(); auto t0 = std::chrono::high_resolution_clock::now(); int trail = 1, first = 0; double total = 0; std::vector<int> rfs{1}; std::cout << std::fixed << std::setprecision(10); for (int f = 2; f <= 50000; ++f) { int carry = 0, d999, zeroes = (trail - 1) * 3, len = rfs.size(); for (int j = trail - 1; j < len || carry != 0; ++j) { if (j < len) carry += rfs[j] * f; d999 = carry % 1000; if (j < len) rfs[j] = d999; else rfs.push_back(d999); zeroes += zc[d999]; carry /= 1000; } while (rfs[trail - 1] == 0) ++trail; d999 = rfs.back(); d999 = d999 < 100 ? (d999 < 10 ? 2 : 1) : 0; zeroes -= d999; int digits = rfs.size() * 3 - d999; total += double(zeroes) / digits; double ratio = total / f; if (ratio >= 0.16) first = 0; else if (first == 0) first = f; if (f == 100 || f == 1000 || f == 10000) { std::cout << "Mean proportion of zero digits in factorials to " << f << " is " << ratio << ". (" << elapsed(t0) << "ms)\n"; } } std::cout << "The mean proportion dips permanently below 0.16 at " << first << ". (" << elapsed(t0) << "ms)\n"; }
Translate the given Go code snippet into C++ without altering its behavior.
package main import ( "fmt" "math" "math/rand" "time" ) type xy struct { x, y float64 } const n = 1000 const scale = 100. func d(p1, p2 xy) float64 { return math.Hypot(p2.x-p1.x, p2.y-p1.y) } func main() { rand.Seed(time.Now().Unix()) points := make([]xy, n) for i := range points { points[i] = xy{rand.Float64() * scale, rand.Float64() * scale} } p1, p2 := closestPair(points) fmt.Println(p1, p2) fmt.Println("distance:", d(p1, p2)) } func closestPair(points []xy) (p1, p2 xy) { if len(points) < 2 { panic("at least two points expected") } min := 2 * scale for i, q1 := range points[:len(points)-1] { for _, q2 := range points[i+1:] { if dq := d(q1, q2); dq < min { p1, p2 = q1, q2 min = dq } } } return }
#include <iostream> #include <vector> #include <utility> #include <cmath> #include <random> #include <chrono> #include <algorithm> #include <iterator> typedef std::pair<double, double> point_t; typedef std::pair<point_t, point_t> points_t; double distance_between(const point_t& a, const point_t& b) { return std::sqrt(std::pow(b.first - a.first, 2) + std::pow(b.second - a.second, 2)); } std::pair<double, points_t> find_closest_brute(const std::vector<point_t>& points) { if (points.size() < 2) { return { -1, { { 0, 0 }, { 0, 0 } } }; } auto minDistance = std::abs(distance_between(points.at(0), points.at(1))); points_t minPoints = { points.at(0), points.at(1) }; for (auto i = std::begin(points); i != (std::end(points) - 1); ++i) { for (auto j = i + 1; j < std::end(points); ++j) { auto newDistance = std::abs(distance_between(*i, *j)); if (newDistance < minDistance) { minDistance = newDistance; minPoints.first = *i; minPoints.second = *j; } } } return { minDistance, minPoints }; } std::pair<double, points_t> find_closest_optimized(const std::vector<point_t>& xP, const std::vector<point_t>& yP) { if (xP.size() <= 3) { return find_closest_brute(xP); } auto N = xP.size(); auto xL = std::vector<point_t>(); auto xR = std::vector<point_t>(); std::copy(std::begin(xP), std::begin(xP) + (N / 2), std::back_inserter(xL)); std::copy(std::begin(xP) + (N / 2), std::end(xP), std::back_inserter(xR)); auto xM = xP.at((N-1) / 2).first; auto yL = std::vector<point_t>(); auto yR = std::vector<point_t>(); std::copy_if(std::begin(yP), std::end(yP), std::back_inserter(yL), [&xM](const point_t& p) { return p.first <= xM; }); std::copy_if(std::begin(yP), std::end(yP), std::back_inserter(yR), [&xM](const point_t& p) { return p.first > xM; }); auto p1 = find_closest_optimized(xL, yL); auto p2 = find_closest_optimized(xR, yR); auto minPair = (p1.first <= p2.first) ? p1 : p2; auto yS = std::vector<point_t>(); std::copy_if(std::begin(yP), std::end(yP), std::back_inserter(yS), [&minPair, &xM](const point_t& p) { return std::abs(xM - p.first) < minPair.first; }); auto result = minPair; for (auto i = std::begin(yS); i != (std::end(yS) - 1); ++i) { for (auto k = i + 1; k != std::end(yS) && ((k->second - i->second) < minPair.first); ++k) { auto newDistance = std::abs(distance_between(*k, *i)); if (newDistance < result.first) { result = { newDistance, { *k, *i } }; } } } return result; } void print_point(const point_t& point) { std::cout << "(" << point.first << ", " << point.second << ")"; } int main(int argc, char * argv[]) { std::default_random_engine re(std::chrono::system_clock::to_time_t( std::chrono::system_clock::now())); std::uniform_real_distribution<double> urd(-500.0, 500.0); std::vector<point_t> points(100); std::generate(std::begin(points), std::end(points), [&urd, &re]() { return point_t { 1000 + urd(re), 1000 + urd(re) }; }); auto answer = find_closest_brute(points); std::sort(std::begin(points), std::end(points), [](const point_t& a, const point_t& b) { return a.first < b.first; }); auto xP = points; std::sort(std::begin(points), std::end(points), [](const point_t& a, const point_t& b) { return a.second < b.second; }); auto yP = points; std::cout << "Min distance (brute): " << answer.first << " "; print_point(answer.second.first); std::cout << ", "; print_point(answer.second.second); answer = find_closest_optimized(xP, yP); std::cout << "\nMin distance (optimized): " << answer.first << " "; print_point(answer.second.first); std::cout << ", "; print_point(answer.second.second); return 0; }
Transform the following Go implementation into C++, maintaining the same output and logic.
package main import ( "fmt" "unsafe" ) func main() { myVar := 3.14 myPointer := &myVar fmt.Println("Address:", myPointer, &myVar) fmt.Printf("Address: %p %p\n", myPointer, &myVar) var addr64 int64 var addr32 int32 ptr := unsafe.Pointer(myPointer) if unsafe.Sizeof(ptr) <= unsafe.Sizeof(addr64) { addr64 = int64(uintptr(ptr)) fmt.Printf("Pointer stored in int64: %#016x\n", addr64) } if unsafe.Sizeof(ptr) <= unsafe.Sizeof(addr32) { addr32 = int32(uintptr(ptr)) fmt.Printf("Pointer stored in int32: %#08x\n", addr32) } addr := uintptr(ptr) fmt.Printf("Pointer stored in uintptr: %#08x\n", addr) fmt.Println("value as float:", myVar) i := (*int32)(unsafe.Pointer(&myVar)) fmt.Printf("value as int32: %#08x\n", *i) }
int i; void* address_of_i = &i;
Please provide an equivalent version of this Go code in C++.
package main type animal struct { alive bool } type dog struct { animal obedienceTrained bool } type cat struct { animal litterBoxTrained bool } type lab struct { dog color string } type collie struct { dog catchesFrisbee bool } func main() { var pet lab pet.alive = true pet.obedienceTrained = false pet.color = "yellow" }
class Animal { }; class Dog: public Animal { }; class Lab: public Dog { }; class Collie: public Dog { }; class Cat: public Animal { };
Transform the following Go implementation into C++, maintaining the same output and logic.
var x map[string]int x = make(map[string]int) x = make(map[string]int, 42) x["foo"] = 3 y1 := x["bar"] y2, ok := x["bar"] delete(x, "foo") x = map[string]int{ "foo": 2, "bar": 42, "baz": -1, }
#include <map>
Write the same code in C++ as shown below in Go.
package main import ( "fmt" "math/big" "rcu" ) func main() { const LIMIT = 11000 primes := rcu.Primes(LIMIT) facts := make([]*big.Int, LIMIT) facts[0] = big.NewInt(1) for i := int64(1); i < LIMIT; i++ { facts[i] = new(big.Int) facts[i].Mul(facts[i-1], big.NewInt(i)) } sign := int64(1) f := new(big.Int) zero := new(big.Int) fmt.Println(" n: Wilson primes") fmt.Println("--------------------") for n := 1; n < 12; n++ { fmt.Printf("%2d: ", n) sign = -sign for _, p := range primes { if p < n { continue } f.Mul(facts[n-1], facts[p-n]) f.Sub(f, big.NewInt(sign)) p2 := int64(p * p) bp2 := big.NewInt(p2) if f.Rem(f, bp2).Cmp(zero) == 0 { fmt.Printf("%d ", p) } } fmt.Println() } }
#include <iomanip> #include <iostream> #include <vector> #include <gmpxx.h> std::vector<int> generate_primes(int limit) { std::vector<bool> sieve(limit >> 1, true); for (int p = 3, s = 9; s < limit; p += 2) { if (sieve[p >> 1]) { for (int q = s; q < limit; q += p << 1) sieve[q >> 1] = false; } s += (p + 1) << 2; } std::vector<int> primes; if (limit > 2) primes.push_back(2); for (int i = 1; i < sieve.size(); ++i) { if (sieve[i]) primes.push_back((i << 1) + 1); } return primes; } int main() { using big_int = mpz_class; const int limit = 11000; std::vector<big_int> f{1}; f.reserve(limit); big_int factorial = 1; for (int i = 1; i < limit; ++i) { factorial *= i; f.push_back(factorial); } std::vector<int> primes = generate_primes(limit); std::cout << " n | Wilson primes\n--------------------\n"; for (int n = 1, s = -1; n <= 11; ++n, s = -s) { std::cout << std::setw(2) << n << " |"; for (int p : primes) { if (p >= n && (f[n - 1] * f[p - n] - s) % (p * p) == 0) std::cout << ' ' << p; } std::cout << '\n'; } }
Generate a C++ translation of this Go snippet without changing its computational steps.
package main import ( "fmt" "math" "rcu" ) var maxDepth = 6 var maxBase = 36 var c = rcu.PrimeSieve(int(math.Pow(float64(maxBase), float64(maxDepth))), true) var digits = "0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" var maxStrings [][][]int var mostBases = -1 func maxSlice(a []int) int { max := 0 for _, e := range a { if e > max { max = e } } return max } func maxInt(a, b int) int { if a > b { return a } return b } func process(indices []int) { minBase := maxInt(2, maxSlice(indices)+1) if maxBase - minBase + 1 < mostBases { return } var bases []int for b := minBase; b <= maxBase; b++ { n := 0 for _, i := range indices { n = n*b + i } if !c[n] { bases = append(bases, b) } } count := len(bases) if count > mostBases { mostBases = count indices2 := make([]int, len(indices)) copy(indices2, indices) maxStrings = [][][]int{[][]int{indices2, bases}} } else if count == mostBases { indices2 := make([]int, len(indices)) copy(indices2, indices) maxStrings = append(maxStrings, [][]int{indices2, bases}) } } func printResults() { fmt.Printf("%d\n", len(maxStrings[0][1])) for _, m := range maxStrings { s := "" for _, i := range m[0] { s = s + string(digits[i]) } fmt.Printf("%s -> %v\n", s, m[1]) } } func nestedFor(indices []int, length, level int) { if level == len(indices) { process(indices) } else { indices[level] = 0 if level == 0 { indices[level] = 1 } for indices[level] < length { nestedFor(indices, length, level+1) indices[level]++ } } } func main() { for depth := 1; depth <= maxDepth; depth++ { fmt.Print(depth, " character strings which are prime in most bases: ") maxStrings = maxStrings[:0] mostBases = -1 indices := make([]int, depth) nestedFor(indices, maxBase, 0) printResults() fmt.Println() } }
#include <algorithm> #include <cmath> #include <cstdint> #include <cstdlib> #include <cstring> #include <iostream> #include <string> #include <vector> #include <primesieve.hpp> class prime_sieve { public: explicit prime_sieve(uint64_t limit); bool is_prime(uint64_t n) const { return n == 2 || ((n & 1) == 1 && sieve[n >> 1]); } private: std::vector<bool> sieve; }; prime_sieve::prime_sieve(uint64_t limit) : sieve((limit + 1) / 2, false) { primesieve::iterator iter; uint64_t prime = iter.next_prime(); while ((prime = iter.next_prime()) <= limit) { sieve[prime >> 1] = true; } } template <typename T> void print(std::ostream& out, const std::vector<T>& v) { if (!v.empty()) { out << '['; auto i = v.begin(); out << *i++; for (; i != v.end(); ++i) out << ", " << *i; out << ']'; } } std::string to_string(const std::vector<unsigned int>& v) { static constexpr char digits[] = "0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ"; std::string str; for (auto i : v) str += digits[i]; return str; } bool increment(std::vector<unsigned int>& digits, unsigned int max_base) { for (auto i = digits.rbegin(); i != digits.rend(); ++i) { if (*i + 1 != max_base) { ++*i; return true; } *i = 0; } return false; } void multi_base_primes(unsigned int max_base, unsigned int max_length) { prime_sieve sieve(static_cast<uint64_t>(std::pow(max_base, max_length))); for (unsigned int length = 1; length <= max_length; ++length) { std::cout << length << "-character strings which are prime in most bases: "; unsigned int most_bases = 0; std::vector< std::pair<std::vector<unsigned int>, std::vector<unsigned int>>> max_strings; std::vector<unsigned int> digits(length, 0); digits[0] = 1; std::vector<unsigned int> bases; do { auto max = std::max_element(digits.begin(), digits.end()); unsigned int min_base = 2; if (max != digits.end()) min_base = std::max(min_base, *max + 1); if (most_bases > max_base - min_base + 1) continue; bases.clear(); for (unsigned int b = min_base; b <= max_base; ++b) { if (max_base - b + 1 + bases.size() < most_bases) break; uint64_t n = 0; for (auto d : digits) n = n * b + d; if (sieve.is_prime(n)) bases.push_back(b); } if (bases.size() > most_bases) { most_bases = bases.size(); max_strings.clear(); } if (bases.size() == most_bases) max_strings.emplace_back(digits, bases); } while (increment(digits, max_base)); std::cout << most_bases << '\n'; for (const auto& m : max_strings) { std::cout << to_string(m.first) << " -> "; print(std::cout, m.second); std::cout << '\n'; } std::cout << '\n'; } } int main(int argc, char** argv) { unsigned int max_base = 36; unsigned int max_length = 4; for (int arg = 1; arg + 1 < argc; ++arg) { if (strcmp(argv[arg], "-max_base") == 0) max_base = strtoul(argv[++arg], nullptr, 10); else if (strcmp(argv[arg], "-max_length") == 0) max_length = strtoul(argv[++arg], nullptr, 10); } if (max_base > 62) { std::cerr << "Max base cannot be greater than 62.\n"; return EXIT_FAILURE; } if (max_base < 2) { std::cerr << "Max base cannot be less than 2.\n"; return EXIT_FAILURE; } multi_base_primes(max_base, max_length); return EXIT_SUCCESS; }
Keep all operations the same but rewrite the snippet in C++.
package main import ( "github.com/fogleman/gg" "math" ) const tau = 2 * math.Pi func hsb2rgb(hue, sat, bri float64) (r, g, b int) { u := int(bri*255 + 0.5) if sat == 0 { r, g, b = u, u, u } else { h := (hue - math.Floor(hue)) * 6 f := h - math.Floor(h) p := int(bri*(1-sat)*255 + 0.5) q := int(bri*(1-sat*f)*255 + 0.5) t := int(bri*(1-sat*(1-f))*255 + 0.5) switch int(h) { case 0: r, g, b = u, t, p case 1: r, g, b = q, u, p case 2: r, g, b = p, u, t case 3: r, g, b = p, q, u case 4: r, g, b = t, p, u case 5: r, g, b = u, p, q } } return } func colorWheel(dc *gg.Context) { width, height := dc.Width(), dc.Height() centerX, centerY := width/2, height/2 radius := centerX if centerY < radius { radius = centerY } for y := 0; y < height; y++ { dy := float64(y - centerY) for x := 0; x < width; x++ { dx := float64(x - centerX) dist := math.Sqrt(dx*dx + dy*dy) if dist <= float64(radius) { theta := math.Atan2(dy, dx) hue := (theta + math.Pi) / tau r, g, b := hsb2rgb(hue, 1, 1) dc.SetRGB255(r, g, b) dc.SetPixel(x, y) } } } } func main() { const width, height = 480, 480 dc := gg.NewContext(width, height) dc.SetRGB(1, 1, 1) dc.Clear() colorWheel(dc) dc.SavePNG("color_wheel.png") }
#include "colorwheelwidget.h" #include <QPainter> #include <QPaintEvent> #include <cmath> namespace { QColor hsvToRgb(int h, double s, double v) { double hp = h/60.0; double c = s * v; double x = c * (1 - std::abs(std::fmod(hp, 2) - 1)); double m = v - c; double r = 0, g = 0, b = 0; if (hp <= 1) { r = c; g = x; } else if (hp <= 2) { r = x; g = c; } else if (hp <= 3) { g = c; b = x; } else if (hp <= 4) { g = x; b = c; } else if (hp <= 5) { r = x; b = c; } else { r = c; b = x; } r += m; g += m; b += m; return QColor(r * 255, g * 255, b * 255); } } ColorWheelWidget::ColorWheelWidget(QWidget *parent) : QWidget(parent) { setWindowTitle(tr("Color Wheel")); resize(400, 400); } void ColorWheelWidget::paintEvent(QPaintEvent *event) { QPainter painter(this); painter.setRenderHint(QPainter::Antialiasing); const QColor backgroundColor(0, 0, 0); const QColor white(255, 255, 255); painter.fillRect(event->rect(), backgroundColor); const int margin = 10; const double diameter = std::min(width(), height()) - 2*margin; QPointF center(width()/2.0, height()/2.0); QRectF rect(center.x() - diameter/2.0, center.y() - diameter/2.0, diameter, diameter); for (int angle = 0; angle < 360; ++angle) { QColor color(hsvToRgb(angle, 1.0, 1.0)); QRadialGradient gradient(center, diameter/2.0); gradient.setColorAt(0, white); gradient.setColorAt(1, color); QBrush brush(gradient); QPen pen(brush, 1.0); painter.setPen(pen); painter.setBrush(brush); painter.drawPie(rect, angle * 16, 16); } }
Generate a C++ translation of this Go snippet without changing its computational steps.
package main import ( "image" "image/color" "image/gif" "log" "math" "os" ) func setBackgroundColor(img *image.Paletted, w, h int, ci uint8) { for x := 0; x < w; x++ { for y := 0; y < h; y++ { img.SetColorIndex(x, y, ci) } } } func hsb2rgb(hue, sat, bri float64) (r, g, b int) { u := int(bri*255 + 0.5) if sat == 0 { r, g, b = u, u, u } else { h := (hue - math.Floor(hue)) * 6 f := h - math.Floor(h) p := int(bri*(1-sat)*255 + 0.5) q := int(bri*(1-sat*f)*255 + 0.5) t := int(bri*(1-sat*(1-f))*255 + 0.5) switch int(h) { case 0: r, g, b = u, t, p case 1: r, g, b = q, u, p case 2: r, g, b = p, u, t case 3: r, g, b = p, q, u case 4: r, g, b = t, p, u case 5: r, g, b = u, p, q } } return } func main() { const degToRad = math.Pi / 180 const nframes = 100 const delay = 4 w, h := 640, 640 anim := gif.GIF{LoopCount: nframes} rect := image.Rect(0, 0, w, h) palette := make([]color.Color, nframes+1) palette[0] = color.White for i := 1; i <= nframes; i++ { r, g, b := hsb2rgb(float64(i)/nframes, 1, 1) palette[i] = color.RGBA{uint8(r), uint8(g), uint8(b), 255} } for f := 1; f <= nframes; f++ { img := image.NewPaletted(rect, palette) setBackgroundColor(img, w, h, 0) for y := 0; y < h; y++ { for x := 0; x < w; x++ { fx, fy := float64(x), float64(y) value := math.Sin(fx / 16) value += math.Sin(fy / 8) value += math.Sin((fx + fy) / 16) value += math.Sin(math.Sqrt(fx*fx+fy*fy) / 8) value += 4 value /= 8 _, rem := math.Modf(value + float64(f)/float64(nframes)) ci := uint8(nframes*rem) + 1 img.SetColorIndex(x, y, ci) } } anim.Delay = append(anim.Delay, delay) anim.Image = append(anim.Image, img) } file, err := os.Create("plasma.gif") if err != nil { log.Fatal(err) } defer file.Close() if err2 := gif.EncodeAll(file, &anim); err != nil { log.Fatal(err2) } }
#include <windows.h> #include <math.h> #include <string> const int BMP_SIZE = 240, MY_TIMER = 987654; class myBitmap { public: myBitmap() : pen( NULL ), brush( NULL ), clr( 0 ), wid( 1 ) {} ~myBitmap() { DeleteObject( pen ); DeleteObject( brush ); DeleteDC( hdc ); DeleteObject( bmp ); } bool create( int w, int h ) { BITMAPINFO bi; ZeroMemory( &bi, sizeof( bi ) ); bi.bmiHeader.biSize = sizeof( bi.bmiHeader ); bi.bmiHeader.biBitCount = sizeof( DWORD ) * 8; bi.bmiHeader.biCompression = BI_RGB; bi.bmiHeader.biPlanes = 1; bi.bmiHeader.biWidth = w; bi.bmiHeader.biHeight = -h; HDC dc = GetDC( GetConsoleWindow() ); bmp = CreateDIBSection( dc, &bi, DIB_RGB_COLORS, &pBits, NULL, 0 ); if( !bmp ) return false; hdc = CreateCompatibleDC( dc ); SelectObject( hdc, bmp ); ReleaseDC( GetConsoleWindow(), dc ); width = w; height = h; return true; } void clear( BYTE clr = 0 ) { memset( pBits, clr, width * height * sizeof( DWORD ) ); } void setBrushColor( DWORD bClr ) { if( brush ) DeleteObject( brush ); brush = CreateSolidBrush( bClr ); SelectObject( hdc, brush ); } void setPenColor( DWORD c ) { clr = c; createPen(); } void setPenWidth( int w ) { wid = w; createPen(); } void saveBitmap( std::string path ) { BITMAPFILEHEADER fileheader; BITMAPINFO infoheader; BITMAP bitmap; DWORD wb; GetObject( bmp, sizeof( bitmap ), &bitmap ); DWORD* dwpBits = new DWORD[bitmap.bmWidth * bitmap.bmHeight]; ZeroMemory( dwpBits, bitmap.bmWidth * bitmap.bmHeight * sizeof( DWORD ) ); ZeroMemory( &infoheader, sizeof( BITMAPINFO ) ); ZeroMemory( &fileheader, sizeof( BITMAPFILEHEADER ) ); infoheader.bmiHeader.biBitCount = sizeof( DWORD ) * 8; infoheader.bmiHeader.biCompression = BI_RGB; infoheader.bmiHeader.biPlanes = 1; infoheader.bmiHeader.biSize = sizeof( infoheader.bmiHeader ); infoheader.bmiHeader.biHeight = bitmap.bmHeight; infoheader.bmiHeader.biWidth = bitmap.bmWidth; infoheader.bmiHeader.biSizeImage = bitmap.bmWidth * bitmap.bmHeight * sizeof( DWORD ); fileheader.bfType = 0x4D42; fileheader.bfOffBits = sizeof( infoheader.bmiHeader ) + sizeof( BITMAPFILEHEADER ); fileheader.bfSize = fileheader.bfOffBits + infoheader.bmiHeader.biSizeImage; GetDIBits( hdc, bmp, 0, height, ( LPVOID )dwpBits, &infoheader, DIB_RGB_COLORS ); HANDLE file = CreateFile( path.c_str(), GENERIC_WRITE, 0, NULL, CREATE_ALWAYS, FILE_ATTRIBUTE_NORMAL, NULL ); WriteFile( file, &fileheader, sizeof( BITMAPFILEHEADER ), &wb, NULL ); WriteFile( file, &infoheader.bmiHeader, sizeof( infoheader.bmiHeader ), &wb, NULL ); WriteFile( file, dwpBits, bitmap.bmWidth * bitmap.bmHeight * 4, &wb, NULL ); CloseHandle( file ); delete [] dwpBits; } HDC getDC() const { return hdc; } DWORD* bits() { return ( DWORD* )pBits; } private: void createPen() { if( pen ) DeleteObject( pen ); pen = CreatePen( PS_SOLID, wid, clr ); SelectObject( hdc, pen ); } HBITMAP bmp; HDC hdc; HPEN pen; HBRUSH brush; void *pBits; int width, height, wid; DWORD clr; }; class plasma { public: plasma() { currentTime = 0; _WD = BMP_SIZE >> 1; _WV = BMP_SIZE << 1; _bmp.create( BMP_SIZE, BMP_SIZE ); _bmp.clear(); plasma1 = new BYTE[BMP_SIZE * BMP_SIZE * 4]; plasma2 = new BYTE[BMP_SIZE * BMP_SIZE * 4]; int i, j, dst = 0; double temp; for( j = 0; j < BMP_SIZE * 2; j++ ) { for( i = 0; i < BMP_SIZE * 2; i++ ) { plasma1[dst] = ( BYTE )( 128.0 + 127.0 * ( cos( ( double )hypot( BMP_SIZE - j, BMP_SIZE - i ) / 64.0 ) ) ); plasma2[dst] = ( BYTE )( ( sin( ( sqrt( 128.0 + ( BMP_SIZE - i ) * ( BMP_SIZE - i ) + ( BMP_SIZE - j ) * ( BMP_SIZE - j ) ) - 4.0 ) / 32.0 ) + 1 ) * 90.0 ); dst++; } } } void update() { DWORD dst; BYTE a, c1,c2, c3; currentTime += ( double )( rand() % 2 + 1 ); int x1 = _WD + ( int )( ( _WD - 1 ) * sin( currentTime / 137 ) ), x2 = _WD + ( int )( ( _WD - 1 ) * sin( -currentTime / 75 ) ), x3 = _WD + ( int )( ( _WD - 1 ) * sin( -currentTime / 125 ) ), y1 = _WD + ( int )( ( _WD - 1 ) * cos( currentTime / 123 ) ), y2 = _WD + ( int )( ( _WD - 1 ) * cos( -currentTime / 85 ) ), y3 = _WD + ( int )( ( _WD - 1 ) * cos( -currentTime / 108 ) ); int src1 = y1 * _WV + x1, src2 = y2 * _WV + x2, src3 = y3 * _WV + x3; DWORD* bits = _bmp.bits(); for( int j = 0; j < BMP_SIZE; j++ ) { dst = j * BMP_SIZE; for( int i= 0; i < BMP_SIZE; i++ ) { a = plasma2[src1] + plasma1[src2] + plasma2[src3]; c1 = a << 1; c2 = a << 2; c3 = a << 3; bits[dst + i] = RGB( c1, c2, c3 ); src1++; src2++; src3++; } src1 += BMP_SIZE; src2 += BMP_SIZE; src3 += BMP_SIZE; } draw(); } void setHWND( HWND hwnd ) { _hwnd = hwnd; } private: void draw() { HDC dc = _bmp.getDC(), wdc = GetDC( _hwnd ); BitBlt( wdc, 0, 0, BMP_SIZE, BMP_SIZE, dc, 0, 0, SRCCOPY ); ReleaseDC( _hwnd, wdc ); } myBitmap _bmp; HWND _hwnd; float _ang; BYTE *plasma1, *plasma2; double currentTime; int _WD, _WV; }; class wnd { public: wnd() { _inst = this; } int wnd::Run( HINSTANCE hInst ) { _hInst = hInst; _hwnd = InitAll(); SetTimer( _hwnd, MY_TIMER, 15, NULL ); _plasma.setHWND( _hwnd ); ShowWindow( _hwnd, SW_SHOW ); UpdateWindow( _hwnd ); MSG msg; ZeroMemory( &msg, sizeof( msg ) ); while( msg.message != WM_QUIT ) { if( PeekMessage( &msg, NULL, 0, 0, PM_REMOVE ) != 0 ) { TranslateMessage( &msg ); DispatchMessage( &msg ); } } return UnregisterClass( "_MY_PLASMA_", _hInst ); } private: void wnd::doPaint( HDC dc ) { _plasma.update(); } void wnd::doTimer() { _plasma.update(); } static int WINAPI wnd::WndProc( HWND hWnd, UINT msg, WPARAM wParam, LPARAM lParam ) { switch( msg ) { case WM_PAINT: { PAINTSTRUCT ps; _inst->doPaint( BeginPaint( hWnd, &ps ) ); EndPaint( hWnd, &ps ); return 0; } case WM_DESTROY: PostQuitMessage( 0 ); break; case WM_TIMER: _inst->doTimer(); break; default: return DefWindowProc( hWnd, msg, wParam, lParam ); } return 0; } HWND InitAll() { WNDCLASSEX wcex; ZeroMemory( &wcex, sizeof( wcex ) ); wcex.cbSize = sizeof( WNDCLASSEX ); wcex.style = CS_HREDRAW | CS_VREDRAW; wcex.lpfnWndProc = ( WNDPROC )WndProc; wcex.hInstance = _hInst; wcex.hCursor = LoadCursor( NULL, IDC_ARROW ); wcex.hbrBackground = ( HBRUSH )( COLOR_WINDOW + 1 ); wcex.lpszClassName = "_MY_PLASMA_"; RegisterClassEx( &wcex ); RECT rc = { 0, 0, BMP_SIZE, BMP_SIZE }; AdjustWindowRect( &rc, WS_SYSMENU | WS_CAPTION, FALSE ); int w = rc.right - rc.left, h = rc.bottom - rc.top; return CreateWindow( "_MY_PLASMA_", ".: Plasma -- PJorente :.", WS_SYSMENU, CW_USEDEFAULT, 0, w, h, NULL, NULL, _hInst, NULL ); } static wnd* _inst; HINSTANCE _hInst; HWND _hwnd; plasma _plasma; }; wnd* wnd::_inst = 0; int APIENTRY WinMain( HINSTANCE hInstance, HINSTANCE hPrevInstance, LPTSTR lpCmdLine, int nCmdShow ) { wnd myWnd; return myWnd.Run( hInstance ); }
Rewrite the snippet below in C++ so it works the same as the original Go code.
package main import ( "fmt" "strconv" "strings" ) type sandpile struct{ a [9]int } var neighbors = [][]int{ {1, 3}, {0, 2, 4}, {1, 5}, {0, 4, 6}, {1, 3, 5, 7}, {2, 4, 8}, {3, 7}, {4, 6, 8}, {5, 7}, } func newSandpile(a [9]int) *sandpile { return &sandpile{a} } func (s *sandpile) plus(other *sandpile) *sandpile { b := [9]int{} for i := 0; i < 9; i++ { b[i] = s.a[i] + other.a[i] } return &sandpile{b} } func (s *sandpile) isStable() bool { for _, e := range s.a { if e > 3 { return false } } return true } func (s *sandpile) topple() { for i := 0; i < 9; i++ { if s.a[i] > 3 { s.a[i] -= 4 for _, j := range neighbors[i] { s.a[j]++ } return } } } func (s *sandpile) String() string { var sb strings.Builder for i := 0; i < 3; i++ { for j := 0; j < 3; j++ { sb.WriteString(strconv.Itoa(s.a[3*i+j]) + " ") } sb.WriteString("\n") } return sb.String() } func main() { fmt.Println("Avalanche of topplings:\n") s4 := newSandpile([9]int{4, 3, 3, 3, 1, 2, 0, 2, 3}) fmt.Println(s4) for !s4.isStable() { s4.topple() fmt.Println(s4) } fmt.Println("Commutative additions:\n") s1 := newSandpile([9]int{1, 2, 0, 2, 1, 1, 0, 1, 3}) s2 := newSandpile([9]int{2, 1, 3, 1, 0, 1, 0, 1, 0}) s3_a := s1.plus(s2) for !s3_a.isStable() { s3_a.topple() } s3_b := s2.plus(s1) for !s3_b.isStable() { s3_b.topple() } fmt.Printf("%s\nplus\n\n%s\nequals\n\n%s\n", s1, s2, s3_a) fmt.Printf("and\n\n%s\nplus\n\n%s\nalso equals\n\n%s\n", s2, s1, s3_b) fmt.Println("Addition of identity sandpile:\n") s3 := newSandpile([9]int{3, 3, 3, 3, 3, 3, 3, 3, 3}) s3_id := newSandpile([9]int{2, 1, 2, 1, 0, 1, 2, 1, 2}) s4 = s3.plus(s3_id) for !s4.isStable() { s4.topple() } fmt.Printf("%s\nplus\n\n%s\nequals\n\n%s\n", s3, s3_id, s4) fmt.Println("Addition of identities:\n") s5 := s3_id.plus(s3_id) for !s5.isStable() { s5.topple() } fmt.Printf("%s\nplus\n\n%s\nequals\n\n%s", s3_id, s3_id, s5) }
#include <algorithm> #include <array> #include <cassert> #include <initializer_list> #include <iostream> constexpr size_t sp_rows = 3; constexpr size_t sp_columns = 3; constexpr size_t sp_cells = sp_rows * sp_columns; constexpr int sp_limit = 4; class abelian_sandpile { friend std::ostream& operator<<(std::ostream&, const abelian_sandpile&); public: abelian_sandpile(); explicit abelian_sandpile(std::initializer_list<int> init); void stabilize(); bool is_stable() const; void topple(); abelian_sandpile& operator+=(const abelian_sandpile&); bool operator==(const abelian_sandpile&); private: int& cell_value(size_t row, size_t column) { return cells_[cell_index(row, column)]; } static size_t cell_index(size_t row, size_t column) { return row * sp_columns + column; } static size_t row_index(size_t cell_index) { return cell_index/sp_columns; } static size_t column_index(size_t cell_index) { return cell_index % sp_columns; } std::array<int, sp_cells> cells_; }; abelian_sandpile::abelian_sandpile() { cells_.fill(0); } abelian_sandpile::abelian_sandpile(std::initializer_list<int> init) { assert(init.size() == sp_cells); std::copy(init.begin(), init.end(), cells_.begin()); } abelian_sandpile& abelian_sandpile::operator+=(const abelian_sandpile& other) { for (size_t i = 0; i < sp_cells; ++i) cells_[i] += other.cells_[i]; stabilize(); return *this; } bool abelian_sandpile::operator==(const abelian_sandpile& other) { return cells_ == other.cells_; } bool abelian_sandpile::is_stable() const { return std::none_of(cells_.begin(), cells_.end(), [](int a) { return a >= sp_limit; }); } void abelian_sandpile::topple() { for (size_t i = 0; i < sp_cells; ++i) { if (cells_[i] >= sp_limit) { cells_[i] -= sp_limit; size_t row = row_index(i); size_t column = column_index(i); if (row > 0) ++cell_value(row - 1, column); if (row + 1 < sp_rows) ++cell_value(row + 1, column); if (column > 0) ++cell_value(row, column - 1); if (column + 1 < sp_columns) ++cell_value(row, column + 1); break; } } } void abelian_sandpile::stabilize() { while (!is_stable()) topple(); } abelian_sandpile operator+(const abelian_sandpile& a, const abelian_sandpile& b) { abelian_sandpile c(a); c += b; return c; } std::ostream& operator<<(std::ostream& out, const abelian_sandpile& as) { for (size_t i = 0; i < sp_cells; ++i) { if (i > 0) out << (as.column_index(i) == 0 ? '\n' : ' '); out << as.cells_[i]; } return out << '\n'; } int main() { std::cout << std::boolalpha; std::cout << "Avalanche:\n"; abelian_sandpile sp{4,3,3, 3,1,2, 0,2,3}; while (!sp.is_stable()) { std::cout << sp << "stable? " << sp.is_stable() << "\n\n"; sp.topple(); } std::cout << sp << "stable? " << sp.is_stable() << "\n\n"; std::cout << "Commutativity:\n"; abelian_sandpile s1{1,2,0, 2,1,1, 0,1,3}; abelian_sandpile s2{2,1,3, 1,0,1, 0,1,0}; abelian_sandpile sum1(s1 + s2); abelian_sandpile sum2(s2 + s1); std::cout << "s1 + s2 equals s2 + s1? " << (sum1 == sum2) << "\n\n"; std::cout << "s1 + s2 = \n" << sum1; std::cout << "\ns2 + s1 = \n" << sum2; std::cout << '\n'; std::cout << "Identity:\n"; abelian_sandpile s3{3,3,3, 3,3,3, 3,3,3}; abelian_sandpile s3_id{2,1,2, 1,0,1, 2,1,2}; abelian_sandpile sum3(s3 + s3_id); abelian_sandpile sum4(s3_id + s3_id); std::cout << "s3 + s3_id equals s3? " << (sum3 == s3) << '\n'; std::cout << "s3_id + s3_id equals s3_id? " << (sum4 == s3_id) << "\n\n"; std::cout << "s3 + s3_id = \n" << sum3; std::cout << "\ns3_id + s3_id = \n" << sum4; return 0; }
Rewrite the snippet below in C++ so it works the same as the original Go code.
package main import ( "fmt" "strconv" "strings" ) type sandpile struct{ a [9]int } var neighbors = [][]int{ {1, 3}, {0, 2, 4}, {1, 5}, {0, 4, 6}, {1, 3, 5, 7}, {2, 4, 8}, {3, 7}, {4, 6, 8}, {5, 7}, } func newSandpile(a [9]int) *sandpile { return &sandpile{a} } func (s *sandpile) plus(other *sandpile) *sandpile { b := [9]int{} for i := 0; i < 9; i++ { b[i] = s.a[i] + other.a[i] } return &sandpile{b} } func (s *sandpile) isStable() bool { for _, e := range s.a { if e > 3 { return false } } return true } func (s *sandpile) topple() { for i := 0; i < 9; i++ { if s.a[i] > 3 { s.a[i] -= 4 for _, j := range neighbors[i] { s.a[j]++ } return } } } func (s *sandpile) String() string { var sb strings.Builder for i := 0; i < 3; i++ { for j := 0; j < 3; j++ { sb.WriteString(strconv.Itoa(s.a[3*i+j]) + " ") } sb.WriteString("\n") } return sb.String() } func main() { fmt.Println("Avalanche of topplings:\n") s4 := newSandpile([9]int{4, 3, 3, 3, 1, 2, 0, 2, 3}) fmt.Println(s4) for !s4.isStable() { s4.topple() fmt.Println(s4) } fmt.Println("Commutative additions:\n") s1 := newSandpile([9]int{1, 2, 0, 2, 1, 1, 0, 1, 3}) s2 := newSandpile([9]int{2, 1, 3, 1, 0, 1, 0, 1, 0}) s3_a := s1.plus(s2) for !s3_a.isStable() { s3_a.topple() } s3_b := s2.plus(s1) for !s3_b.isStable() { s3_b.topple() } fmt.Printf("%s\nplus\n\n%s\nequals\n\n%s\n", s1, s2, s3_a) fmt.Printf("and\n\n%s\nplus\n\n%s\nalso equals\n\n%s\n", s2, s1, s3_b) fmt.Println("Addition of identity sandpile:\n") s3 := newSandpile([9]int{3, 3, 3, 3, 3, 3, 3, 3, 3}) s3_id := newSandpile([9]int{2, 1, 2, 1, 0, 1, 2, 1, 2}) s4 = s3.plus(s3_id) for !s4.isStable() { s4.topple() } fmt.Printf("%s\nplus\n\n%s\nequals\n\n%s\n", s3, s3_id, s4) fmt.Println("Addition of identities:\n") s5 := s3_id.plus(s3_id) for !s5.isStable() { s5.topple() } fmt.Printf("%s\nplus\n\n%s\nequals\n\n%s", s3_id, s3_id, s5) }
#include <algorithm> #include <array> #include <cassert> #include <initializer_list> #include <iostream> constexpr size_t sp_rows = 3; constexpr size_t sp_columns = 3; constexpr size_t sp_cells = sp_rows * sp_columns; constexpr int sp_limit = 4; class abelian_sandpile { friend std::ostream& operator<<(std::ostream&, const abelian_sandpile&); public: abelian_sandpile(); explicit abelian_sandpile(std::initializer_list<int> init); void stabilize(); bool is_stable() const; void topple(); abelian_sandpile& operator+=(const abelian_sandpile&); bool operator==(const abelian_sandpile&); private: int& cell_value(size_t row, size_t column) { return cells_[cell_index(row, column)]; } static size_t cell_index(size_t row, size_t column) { return row * sp_columns + column; } static size_t row_index(size_t cell_index) { return cell_index/sp_columns; } static size_t column_index(size_t cell_index) { return cell_index % sp_columns; } std::array<int, sp_cells> cells_; }; abelian_sandpile::abelian_sandpile() { cells_.fill(0); } abelian_sandpile::abelian_sandpile(std::initializer_list<int> init) { assert(init.size() == sp_cells); std::copy(init.begin(), init.end(), cells_.begin()); } abelian_sandpile& abelian_sandpile::operator+=(const abelian_sandpile& other) { for (size_t i = 0; i < sp_cells; ++i) cells_[i] += other.cells_[i]; stabilize(); return *this; } bool abelian_sandpile::operator==(const abelian_sandpile& other) { return cells_ == other.cells_; } bool abelian_sandpile::is_stable() const { return std::none_of(cells_.begin(), cells_.end(), [](int a) { return a >= sp_limit; }); } void abelian_sandpile::topple() { for (size_t i = 0; i < sp_cells; ++i) { if (cells_[i] >= sp_limit) { cells_[i] -= sp_limit; size_t row = row_index(i); size_t column = column_index(i); if (row > 0) ++cell_value(row - 1, column); if (row + 1 < sp_rows) ++cell_value(row + 1, column); if (column > 0) ++cell_value(row, column - 1); if (column + 1 < sp_columns) ++cell_value(row, column + 1); break; } } } void abelian_sandpile::stabilize() { while (!is_stable()) topple(); } abelian_sandpile operator+(const abelian_sandpile& a, const abelian_sandpile& b) { abelian_sandpile c(a); c += b; return c; } std::ostream& operator<<(std::ostream& out, const abelian_sandpile& as) { for (size_t i = 0; i < sp_cells; ++i) { if (i > 0) out << (as.column_index(i) == 0 ? '\n' : ' '); out << as.cells_[i]; } return out << '\n'; } int main() { std::cout << std::boolalpha; std::cout << "Avalanche:\n"; abelian_sandpile sp{4,3,3, 3,1,2, 0,2,3}; while (!sp.is_stable()) { std::cout << sp << "stable? " << sp.is_stable() << "\n\n"; sp.topple(); } std::cout << sp << "stable? " << sp.is_stable() << "\n\n"; std::cout << "Commutativity:\n"; abelian_sandpile s1{1,2,0, 2,1,1, 0,1,3}; abelian_sandpile s2{2,1,3, 1,0,1, 0,1,0}; abelian_sandpile sum1(s1 + s2); abelian_sandpile sum2(s2 + s1); std::cout << "s1 + s2 equals s2 + s1? " << (sum1 == sum2) << "\n\n"; std::cout << "s1 + s2 = \n" << sum1; std::cout << "\ns2 + s1 = \n" << sum2; std::cout << '\n'; std::cout << "Identity:\n"; abelian_sandpile s3{3,3,3, 3,3,3, 3,3,3}; abelian_sandpile s3_id{2,1,2, 1,0,1, 2,1,2}; abelian_sandpile sum3(s3 + s3_id); abelian_sandpile sum4(s3_id + s3_id); std::cout << "s3 + s3_id equals s3? " << (sum3 == s3) << '\n'; std::cout << "s3_id + s3_id equals s3_id? " << (sum4 == s3_id) << "\n\n"; std::cout << "s3 + s3_id = \n" << sum3; std::cout << "\ns3_id + s3_id = \n" << sum4; return 0; }
Change the following Go code into C++ without altering its purpose.
package main import ( "fmt" "rcu" "strconv" ) func contains(a []int, n int) bool { for _, e := range a { if e == n { return true } } return false } func main() { for b := 2; b <= 36; b++ { if rcu.IsPrime(b) { continue } count := 0 var rhonda []int for n := 1; count < 15; n++ { digits := rcu.Digits(n, b) if !contains(digits, 0) { var anyEven = false for _, d := range digits { if d%2 == 0 { anyEven = true break } } if b != 10 || (contains(digits, 5) && anyEven) { calc1 := 1 for _, d := range digits { calc1 *= d } calc2 := b * rcu.SumInts(rcu.PrimeFactors(n)) if calc1 == calc2 { rhonda = append(rhonda, n) count++ } } } } if len(rhonda) > 0 { fmt.Printf("\nFirst 15 Rhonda numbers in base %d:\n", b) rhonda2 := make([]string, len(rhonda)) counts2 := make([]int, len(rhonda)) for i, r := range rhonda { rhonda2[i] = fmt.Sprintf("%d", r) counts2[i] = len(rhonda2[i]) } rhonda3 := make([]string, len(rhonda)) counts3 := make([]int, len(rhonda)) for i, r := range rhonda { rhonda3[i] = strconv.FormatInt(int64(r), b) counts3[i] = len(rhonda3[i]) } maxLen2 := rcu.MaxInts(counts2) maxLen3 := rcu.MaxInts(counts3) maxLen := maxLen2 if maxLen3 > maxLen { maxLen = maxLen3 } maxLen++ fmt.Printf("In base 10: %*s\n", maxLen, rhonda2) fmt.Printf("In base %-2d: %*s\n", b, maxLen, rhonda3) } } }
#include <algorithm> #include <cassert> #include <iomanip> #include <iostream> int digit_product(int base, int n) { int product = 1; for (; n != 0; n /= base) product *= n % base; return product; } int prime_factor_sum(int n) { int sum = 0; for (; (n & 1) == 0; n >>= 1) sum += 2; for (int p = 3; p * p <= n; p += 2) for (; n % p == 0; n /= p) sum += p; if (n > 1) sum += n; return sum; } bool is_prime(int n) { if (n < 2) return false; if (n % 2 == 0) return n == 2; if (n % 3 == 0) return n == 3; for (int p = 5; p * p <= n; p += 4) { if (n % p == 0) return false; p += 2; if (n % p == 0) return false; } return true; } bool is_rhonda(int base, int n) { return digit_product(base, n) == base * prime_factor_sum(n); } std::string to_string(int base, int n) { assert(base <= 36); static constexpr char digits[] = "0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ"; std::string str; for (; n != 0; n /= base) str += digits[n % base]; std::reverse(str.begin(), str.end()); return str; } int main() { const int limit = 15; for (int base = 2; base <= 36; ++base) { if (is_prime(base)) continue; std::cout << "First " << limit << " Rhonda numbers to base " << base << ":\n"; int numbers[limit]; for (int n = 1, count = 0; count < limit; ++n) { if (is_rhonda(base, n)) numbers[count++] = n; } std::cout << "In base 10:"; for (int i = 0; i < limit; ++i) std::cout << ' ' << numbers[i]; std::cout << "\nIn base " << base << ':'; for (int i = 0; i < limit; ++i) std::cout << ' ' << to_string(base, numbers[i]); std::cout << "\n\n"; } }
Convert this Go snippet to C++ and keep its semantics consistent.
package main import "fmt" type point struct { x, y float64 } type circle struct { x, y, r float64 } type printer interface { print() } func (p *point) print() { fmt.Println(p.x, p.y) } func (c *circle) print() { fmt.Println(c.x, c.y, c.r) } func main() { var i printer i = newPoint(3, 4) i.print() i = newCircle(5, 12, 13) i.print() } func (p *point) getX() float64 { return p.x } func (p *point) getY() float64 { return p.y } func (p *point) setX(v float64) { p.x = v } func (p *point) setY(v float64) { p.y = v } func (c *circle) getX() float64 { return c.x } func (c *circle) getY() float64 { return c.y } func (c *circle) getR() float64 { return c.r } func (c *circle) setX(v float64) { c.x = v } func (c *circle) setY(v float64) { c.y = v } func (c *circle) setR(v float64) { c.r = v } func (p *point) clone() *point { r := *p; return &r } func (c *circle) clone() *circle { r := *c; return &r } func (p *point) set(q *point) { *p = *q } func (c *circle) set(d *circle) { *c = *d } func newPoint(x, y float64) *point { return &point{x, y} } func newCircle(x, y, r float64) *circle { return &circle{x, y, r} }
#include <cstdio> #include <cstdlib> class Point { protected: int x, y; public: Point(int x0 = 0, int y0 = 0) : x(x0), y(y0) {} Point(const Point &p) : x(p.x), y(p.y) {} virtual ~Point() {} const Point& operator=(const Point &p) { if (this != &p) { x = p.x; y = p.y; } return *this; } int getX() { return x; } int getY() { return y; } void setX(int x0) { x = x0; } void setY(int y0) { y = y0; } virtual void print() { printf("Point\n"); } }; class Circle: public Point { private: int r; public: Circle(Point p, int r0 = 0) : Point(p), r(r0) {} Circle(int x0 = 0, int y0 = 0, int r0 = 0) : Point(x0, y0), r(r0) {} virtual ~Circle() {} const Circle& operator=(const Circle &c) { if (this != &c) { x = c.x; y = c.y; r = c.r; } return *this; } int getR() { return r; } void setR(int r0) { r = r0; } virtual void print() { printf("Circle\n"); } }; int main() { Point *p = new Point(); Point *c = new Circle(); p->print(); c->print(); delete p; delete c; return EXIT_SUCCESS; }
Convert this Go block to C++, preserving its control flow and logic.
package romap type Romap struct{ imap map[byte]int } func New(m map[byte]int) *Romap { if m == nil { return nil } return &Romap{m} } func (rom *Romap) Get(key byte) (int, bool) { i, ok := rom.imap[key] return i, ok } func (rom *Romap) Reset(key byte) { _, ok := rom.imap[key] if ok { rom.imap[key] = 0 } }
#include <iostream> #include <map> #include <utility> using namespace std; template<typename T> class FixedMap : private T { T m_defaultValues; public: FixedMap(T map) : T(map), m_defaultValues(move(map)){} using T::cbegin; using T::cend; using T::empty; using T::find; using T::size; using T::at; using T::begin; using T::end; auto& operator[](typename T::key_type&& key) { return this->at(forward<typename T::key_type>(key)); } void erase(typename T::key_type&& key) { T::operator[](key) = m_defaultValues.at(key); } void clear() { T::operator=(m_defaultValues); } }; auto PrintMap = [](const auto &map) { for(auto &[key, value] : map) { cout << "{" << key << " : " << value << "} "; } cout << "\n\n"; }; int main(void) { cout << "Map intialized with values\n"; FixedMap<map<string, int>> fixedMap ({ {"a", 1}, {"b", 2}}); PrintMap(fixedMap); cout << "Change the values of the keys\n"; fixedMap["a"] = 55; fixedMap["b"] = 56; PrintMap(fixedMap); cout << "Reset the 'a' key\n"; fixedMap.erase("a"); PrintMap(fixedMap); cout << "Change the values the again\n"; fixedMap["a"] = 88; fixedMap["b"] = 99; PrintMap(fixedMap); cout << "Reset all keys\n"; fixedMap.clear(); PrintMap(fixedMap); try { cout << "Try to add a new key\n"; fixedMap["newKey"] = 99; } catch (exception &ex) { cout << "error: " << ex.what(); } }
Translate the given Go code snippet into C++ without altering its behavior.
package main import ( "bytes" "fmt" "io/ioutil" "log" "unicode/utf8" ) func contains(list []int, value int) bool { for _, v := range list { if v == value { return true } } return false } func main() { wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) var words []string for _, bword := range bwords { s := string(bword) if utf8.RuneCountInString(s) > 10 { words = append(words, s) } } vowelIndices := []int{0, 4, 8, 14, 20} wordGroups := make([][]string, 12) for _, word := range words { letters := make([]int, 26) for _, c := range word { index := c - 97 if index >= 0 && index < 26 { letters[index]++ } } eligible := true uc := 0 for i := 0; i < 26; i++ { if !contains(vowelIndices, i) { if letters[i] > 1 { eligible = false break } else if letters[i] == 1 { uc++ } } } if eligible { wordGroups[uc] = append(wordGroups[uc], word) } } for i := 11; i >= 0; i-- { count := len(wordGroups[i]) if count > 0 { s := "s" if count == 1 { s = "" } fmt.Printf("%d word%s found with %d unique consonants:\n", count, s, i) for j := 0; j < count; j++ { fmt.Printf("%-15s", wordGroups[i][j]) if j > 0 && (j+1)%5 == 0 { fmt.Println() } } fmt.Println() if count%5 != 0 { fmt.Println() } } } }
#include <bitset> #include <cctype> #include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> #include <map> #include <string> #include <vector> size_t consonants(const std::string& word) { std::bitset<26> bits; size_t bit = 0; for (char ch : word) { ch = std::tolower(static_cast<unsigned char>(ch)); if (ch < 'a' || ch > 'z') continue; switch (ch) { case 'a': case 'e': case 'i': case 'o': case 'u': break; default: bit = ch - 'a'; if (bits.test(bit)) return 0; bits.set(bit); break; } } return bits.count(); } int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string word; std::map<size_t, std::vector<std::string>, std::greater<int>> map; while (getline(in, word)) { if (word.size() <= 10) continue; size_t count = consonants(word); if (count != 0) map[count].push_back(word); } const int columns = 4; for (const auto& p : map) { std::cout << p.first << " consonants (" << p.second.size() << "):\n"; int n = 0; for (const auto& word : p.second) { std::cout << std::left << std::setw(18) << word; ++n; if (n % columns == 0) std::cout << '\n'; } if (n % columns != 0) std::cout << '\n'; std::cout << '\n'; } return EXIT_SUCCESS; }
Change the following Go code into C++ without altering its purpose.
package main import ( "bytes" "fmt" "io/ioutil" "log" "strings" ) func isPrime(n int) bool { if n < 2 { return false } if n%2 == 0 { return n == 2 } if n%3 == 0 { return n == 3 } d := 5 for d*d <= n { if n%d == 0 { return false } d += 2 if n%d == 0 { return false } d += 4 } return true } func main() { var primeRunes []rune for i := 33; i < 256; i += 2 { if isPrime(i) { primeRunes = append(primeRunes, rune(i)) } } primeString := string(primeRunes) wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) fmt.Println("Prime words in", wordList, "are:") for _, bword := range bwords { word := string(bword) ok := true for _, c := range word { if !strings.ContainsRune(primeString, c) { ok = false break } } if ok { fmt.Println(word) } } }
#include <algorithm> #include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> #include <string> #include "prime_sieve.hpp" int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string line; prime_sieve sieve(UCHAR_MAX); auto is_prime = [&sieve](unsigned char c){ return sieve.is_prime(c); }; int n = 0; while (getline(in, line)) { if (std::all_of(line.begin(), line.end(), is_prime)) { ++n; std::cout << std::right << std::setw(2) << n << ": " << std::left << std::setw(10) << line; if (n % 4 == 0) std::cout << '\n'; } } return EXIT_SUCCESS; }
Change the programming language of this snippet from Go to C++ without modifying what it does.
package main import ( "bytes" "fmt" "io/ioutil" "log" "strings" ) func isPrime(n int) bool { if n < 2 { return false } if n%2 == 0 { return n == 2 } if n%3 == 0 { return n == 3 } d := 5 for d*d <= n { if n%d == 0 { return false } d += 2 if n%d == 0 { return false } d += 4 } return true } func main() { var primeRunes []rune for i := 33; i < 256; i += 2 { if isPrime(i) { primeRunes = append(primeRunes, rune(i)) } } primeString := string(primeRunes) wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) fmt.Println("Prime words in", wordList, "are:") for _, bword := range bwords { word := string(bword) ok := true for _, c := range word { if !strings.ContainsRune(primeString, c) { ok = false break } } if ok { fmt.Println(word) } } }
#include <algorithm> #include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> #include <string> #include "prime_sieve.hpp" int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string line; prime_sieve sieve(UCHAR_MAX); auto is_prime = [&sieve](unsigned char c){ return sieve.is_prime(c); }; int n = 0; while (getline(in, line)) { if (std::all_of(line.begin(), line.end(), is_prime)) { ++n; std::cout << std::right << std::setw(2) << n << ": " << std::left << std::setw(10) << line; if (n % 4 == 0) std::cout << '\n'; } } return EXIT_SUCCESS; }
Convert this Go block to C++, preserving its control flow and logic.
package main import ( "bytes" "fmt" "io/ioutil" "log" "strings" ) func isPrime(n int) bool { if n < 2 { return false } if n%2 == 0 { return n == 2 } if n%3 == 0 { return n == 3 } d := 5 for d*d <= n { if n%d == 0 { return false } d += 2 if n%d == 0 { return false } d += 4 } return true } func main() { var primeRunes []rune for i := 33; i < 256; i += 2 { if isPrime(i) { primeRunes = append(primeRunes, rune(i)) } } primeString := string(primeRunes) wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) fmt.Println("Prime words in", wordList, "are:") for _, bword := range bwords { word := string(bword) ok := true for _, c := range word { if !strings.ContainsRune(primeString, c) { ok = false break } } if ok { fmt.Println(word) } } }
#include <algorithm> #include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> #include <string> #include "prime_sieve.hpp" int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string line; prime_sieve sieve(UCHAR_MAX); auto is_prime = [&sieve](unsigned char c){ return sieve.is_prime(c); }; int n = 0; while (getline(in, line)) { if (std::all_of(line.begin(), line.end(), is_prime)) { ++n; std::cout << std::right << std::setw(2) << n << ": " << std::left << std::setw(10) << line; if (n % 4 == 0) std::cout << '\n'; } } return EXIT_SUCCESS; }
Produce a functionally identical C++ code for the snippet given in Go.
package main import ( "bytes" "fmt" "io/ioutil" "log" "strings" ) func isPrime(n int) bool { if n < 2 { return false } if n%2 == 0 { return n == 2 } if n%3 == 0 { return n == 3 } d := 5 for d*d <= n { if n%d == 0 { return false } d += 2 if n%d == 0 { return false } d += 4 } return true } func main() { var primeRunes []rune for i := 33; i < 256; i += 2 { if isPrime(i) { primeRunes = append(primeRunes, rune(i)) } } primeString := string(primeRunes) wordList := "unixdict.txt" b, err := ioutil.ReadFile(wordList) if err != nil { log.Fatal("Error reading file") } bwords := bytes.Fields(b) fmt.Println("Prime words in", wordList, "are:") for _, bword := range bwords { word := string(bword) ok := true for _, c := range word { if !strings.ContainsRune(primeString, c) { ok = false break } } if ok { fmt.Println(word) } } }
#include <algorithm> #include <cstdlib> #include <fstream> #include <iomanip> #include <iostream> #include <string> #include "prime_sieve.hpp" int main(int argc, char** argv) { const char* filename(argc < 2 ? "unixdict.txt" : argv[1]); std::ifstream in(filename); if (!in) { std::cerr << "Cannot open file '" << filename << "'.\n"; return EXIT_FAILURE; } std::string line; prime_sieve sieve(UCHAR_MAX); auto is_prime = [&sieve](unsigned char c){ return sieve.is_prime(c); }; int n = 0; while (getline(in, line)) { if (std::all_of(line.begin(), line.end(), is_prime)) { ++n; std::cout << std::right << std::setw(2) << n << ": " << std::left << std::setw(10) << line; if (n % 4 == 0) std::cout << '\n'; } } return EXIT_SUCCESS; }
Keep all operations the same but rewrite the snippet in C++.
package main import ( "fmt" "math" "rcu" ) func divisorCount(n int) int { k := 1 if n%2 == 1 { k = 2 } count := 0 sqrt := int(math.Sqrt(float64(n))) for i := 1; i <= sqrt; i += k { if n%i == 0 { count++ j := n / i if j != i { count++ } } } return count } func main() { var numbers50 []int count := 0 for n := 1; count < 50000; n++ { dc := divisorCount(n) if n == 1 || dc == 8 { count++ if count <= 50 { numbers50 = append(numbers50, n) if count == 50 { rcu.PrintTable(numbers50, 10, 3, false) } } else if count == 500 { fmt.Printf("\n500th  : %s", rcu.Commatize(n)) } else if count == 5000 { fmt.Printf("\n5,000th : %s", rcu.Commatize(n)) } else if count == 50000 { fmt.Printf("\n50,000th: %s\n", rcu.Commatize(n)) } } } }
#include <iomanip> #include <iostream> unsigned int divisor_count(unsigned int n) { unsigned int total = 1; for (; (n & 1) == 0; n >>= 1) ++total; for (unsigned int p = 3; p * p <= n; p += 2) { unsigned int count = 1; for (; n % p == 0; n /= p) ++count; total *= count; } if (n > 1) total *= 2; return total; } int main() { std::cout.imbue(std::locale("")); std::cout << "First 50 numbers which are the cube roots of the products of " "their proper divisors:\n"; for (unsigned int n = 1, count = 0; count < 50000; ++n) { if (n == 1 || divisor_count(n) == 8) { ++count; if (count <= 50) std::cout << std::setw(3) << n << (count % 10 == 0 ? '\n' : ' '); else if (count == 500 || count == 5000 || count == 50000) std::cout << std::setw(6) << count << "th: " << n << '\n'; } } }
Convert this Go snippet to C++ and keep its semantics consistent.
package main import ( "fmt" "rcu" ) func main() { const limit = 1e10 primes := rcu.Primes(limit) var orm25 []int j := int(1e9) count := 0 var counts []int for i := 0; i < len(primes)-2; i++ { p1 := primes[i] p2 := primes[i+1] p3 := primes[i+2] if (p2-p1)%18 != 0 || (p3-p2)%18 != 0 { continue } key1 := 1 for _, dig := range rcu.Digits(p1, 10) { key1 *= primes[dig] } key2 := 1 for _, dig := range rcu.Digits(p2, 10) { key2 *= primes[dig] } if key1 != key2 { continue } key3 := 1 for _, dig := range rcu.Digits(p3, 10) { key3 *= primes[dig] } if key2 == key3 { if count < 25 { orm25 = append(orm25, p1) } if p1 >= j { counts = append(counts, count) j *= 10 } count++ } } counts = append(counts, count) fmt.Println("Smallest members of first 25 Ormiston triples:") for i := 0; i < 25; i++ { fmt.Printf("%8v ", orm25[i]) if (i+1)%5 == 0 { fmt.Println() } } fmt.Println() j = int(1e9) for i := 0; i < len(counts); i++ { fmt.Printf("%s Ormiston triples before %s\n", rcu.Commatize(counts[i]), rcu.Commatize(j)) j *= 10 fmt.Println() } }
#include <array> #include <iostream> #include <primesieve.hpp> class ormiston_triple_generator { public: ormiston_triple_generator() { for (int i = 0; i < 2; ++i) { primes_[i] = pi_.next_prime(); digits_[i] = get_digits(primes_[i]); } } std::array<uint64_t, 3> next_triple() { for (;;) { uint64_t prime = pi_.next_prime(); auto digits = get_digits(prime); bool is_triple = digits == digits_[0] && digits == digits_[1]; uint64_t prime0 = primes_[0]; primes_[0] = primes_[1]; primes_[1] = prime; digits_[0] = digits_[1]; digits_[1] = digits; if (is_triple) return {prime0, primes_[0], primes_[1]}; } } private: static std::array<int, 10> get_digits(uint64_t n) { std::array<int, 10> result = {}; for (; n > 0; n /= 10) ++result[n % 10]; return result; } primesieve::iterator pi_; std::array<uint64_t, 2> primes_; std::array<std::array<int, 10>, 2> digits_; }; int main() { ormiston_triple_generator generator; int count = 0; std::cout << "Smallest members of first 25 Ormiston triples:\n"; for (; count < 25; ++count) { auto primes = generator.next_triple(); std::cout << primes[0] << ((count + 1) % 5 == 0 ? '\n' : ' '); } std::cout << '\n'; for (uint64_t limit = 1000000000; limit <= 10000000000; ++count) { auto primes = generator.next_triple(); if (primes[2] > limit) { std::cout << "Number of Ormiston triples < " << limit << ": " << count << '\n'; limit *= 10; } } }
Write a version of this Go function in C++ with identical behavior.
package main import ( "fmt" "rcu" ) func main() { const limit = 1e10 primes := rcu.Primes(limit) var orm25 []int j := int(1e9) count := 0 var counts []int for i := 0; i < len(primes)-2; i++ { p1 := primes[i] p2 := primes[i+1] p3 := primes[i+2] if (p2-p1)%18 != 0 || (p3-p2)%18 != 0 { continue } key1 := 1 for _, dig := range rcu.Digits(p1, 10) { key1 *= primes[dig] } key2 := 1 for _, dig := range rcu.Digits(p2, 10) { key2 *= primes[dig] } if key1 != key2 { continue } key3 := 1 for _, dig := range rcu.Digits(p3, 10) { key3 *= primes[dig] } if key2 == key3 { if count < 25 { orm25 = append(orm25, p1) } if p1 >= j { counts = append(counts, count) j *= 10 } count++ } } counts = append(counts, count) fmt.Println("Smallest members of first 25 Ormiston triples:") for i := 0; i < 25; i++ { fmt.Printf("%8v ", orm25[i]) if (i+1)%5 == 0 { fmt.Println() } } fmt.Println() j = int(1e9) for i := 0; i < len(counts); i++ { fmt.Printf("%s Ormiston triples before %s\n", rcu.Commatize(counts[i]), rcu.Commatize(j)) j *= 10 fmt.Println() } }
#include <array> #include <iostream> #include <primesieve.hpp> class ormiston_triple_generator { public: ormiston_triple_generator() { for (int i = 0; i < 2; ++i) { primes_[i] = pi_.next_prime(); digits_[i] = get_digits(primes_[i]); } } std::array<uint64_t, 3> next_triple() { for (;;) { uint64_t prime = pi_.next_prime(); auto digits = get_digits(prime); bool is_triple = digits == digits_[0] && digits == digits_[1]; uint64_t prime0 = primes_[0]; primes_[0] = primes_[1]; primes_[1] = prime; digits_[0] = digits_[1]; digits_[1] = digits; if (is_triple) return {prime0, primes_[0], primes_[1]}; } } private: static std::array<int, 10> get_digits(uint64_t n) { std::array<int, 10> result = {}; for (; n > 0; n /= 10) ++result[n % 10]; return result; } primesieve::iterator pi_; std::array<uint64_t, 2> primes_; std::array<std::array<int, 10>, 2> digits_; }; int main() { ormiston_triple_generator generator; int count = 0; std::cout << "Smallest members of first 25 Ormiston triples:\n"; for (; count < 25; ++count) { auto primes = generator.next_triple(); std::cout << primes[0] << ((count + 1) % 5 == 0 ? '\n' : ' '); } std::cout << '\n'; for (uint64_t limit = 1000000000; limit <= 10000000000; ++count) { auto primes = generator.next_triple(); if (primes[2] > limit) { std::cout << "Number of Ormiston triples < " << limit << ": " << count << '\n'; limit *= 10; } } }
Can you help me rewrite this code in C++ instead of Go, keeping it the same logically?
package main import ( "fmt" "strings" ) func btoi(b bool) int { if b { return 1 } return 0 } func evolve(l, rule int) { fmt.Printf(" Rule #%d:\n", rule) cells := "O" for x := 0; x < l; x++ { cells = addNoCells(cells) width := 40 + (len(cells) >> 1) fmt.Printf("%*s\n", width, cells) cells = step(cells, rule) } } func step(cells string, rule int) string { newCells := new(strings.Builder) for i := 0; i < len(cells)-2; i++ { bin := 0 b := uint(2) for n := i; n < i+3; n++ { bin += btoi(cells[n] == 'O') << b b >>= 1 } a := '.' if rule&(1<<uint(bin)) != 0 { a = 'O' } newCells.WriteRune(a) } return newCells.String() } func addNoCells(cells string) string { l, r := "O", "O" if cells[0] == 'O' { l = "." } if cells[len(cells)-1] == 'O' { r = "." } cells = l + cells + r cells = l + cells + r return cells } func main() { for _, r := range []int{90, 30} { evolve(25, r) fmt.Println() } }
#include <iostream> #include <iomanip> #include <string> class oo { public: void evolve( int l, int rule ) { std::string cells = "O"; std::cout << " Rule #" << rule << ":\n"; for( int x = 0; x < l; x++ ) { addNoCells( cells ); std::cout << std::setw( 40 + ( static_cast<int>( cells.length() ) >> 1 ) ) << cells << "\n"; step( cells, rule ); } } private: void step( std::string& cells, int rule ) { int bin; std::string newCells; for( size_t i = 0; i < cells.length() - 2; i++ ) { bin = 0; for( size_t n = i, b = 2; n < i + 3; n++, b >>= 1 ) { bin += ( ( cells[n] == 'O' ? 1 : 0 ) << b ); } newCells.append( 1, rule & ( 1 << bin ) ? 'O' : '.' ); } cells = newCells; } void addNoCells( std::string& s ) { char l = s.at( 0 ) == 'O' ? '.' : 'O', r = s.at( s.length() - 1 ) == 'O' ? '.' : 'O'; s = l + s + r; s = l + s + r; } }; int main( int argc, char* argv[] ) { oo o; o.evolve( 35, 90 ); std::cout << "\n"; return 0; }
Preserve the algorithm and functionality while converting the code from Go to C++.
package main import ( "fmt" "strings" ) func btoi(b bool) int { if b { return 1 } return 0 } func evolve(l, rule int) { fmt.Printf(" Rule #%d:\n", rule) cells := "O" for x := 0; x < l; x++ { cells = addNoCells(cells) width := 40 + (len(cells) >> 1) fmt.Printf("%*s\n", width, cells) cells = step(cells, rule) } } func step(cells string, rule int) string { newCells := new(strings.Builder) for i := 0; i < len(cells)-2; i++ { bin := 0 b := uint(2) for n := i; n < i+3; n++ { bin += btoi(cells[n] == 'O') << b b >>= 1 } a := '.' if rule&(1<<uint(bin)) != 0 { a = 'O' } newCells.WriteRune(a) } return newCells.String() } func addNoCells(cells string) string { l, r := "O", "O" if cells[0] == 'O' { l = "." } if cells[len(cells)-1] == 'O' { r = "." } cells = l + cells + r cells = l + cells + r return cells } func main() { for _, r := range []int{90, 30} { evolve(25, r) fmt.Println() } }
#include <iostream> #include <iomanip> #include <string> class oo { public: void evolve( int l, int rule ) { std::string cells = "O"; std::cout << " Rule #" << rule << ":\n"; for( int x = 0; x < l; x++ ) { addNoCells( cells ); std::cout << std::setw( 40 + ( static_cast<int>( cells.length() ) >> 1 ) ) << cells << "\n"; step( cells, rule ); } } private: void step( std::string& cells, int rule ) { int bin; std::string newCells; for( size_t i = 0; i < cells.length() - 2; i++ ) { bin = 0; for( size_t n = i, b = 2; n < i + 3; n++, b >>= 1 ) { bin += ( ( cells[n] == 'O' ? 1 : 0 ) << b ); } newCells.append( 1, rule & ( 1 << bin ) ? 'O' : '.' ); } cells = newCells; } void addNoCells( std::string& s ) { char l = s.at( 0 ) == 'O' ? '.' : 'O', r = s.at( s.length() - 1 ) == 'O' ? '.' : 'O'; s = l + s + r; s = l + s + r; } }; int main( int argc, char* argv[] ) { oo o; o.evolve( 35, 90 ); std::cout << "\n"; return 0; }
Port the following code from Go to C++ with equivalent syntax and logic.
package main import ( "fmt" "github.com/atotto/clipboard" "io/ioutil" "log" "os" "runtime" "strconv" "strings" ) func check(err error) { if err != nil { clipboard.WriteAll("") log.Fatal(err) } } func interpret(source string) { source2 := source if runtime.GOOS == "windows" { source2 = strings.ReplaceAll(source, "\r\n", "\n") } lines := strings.Split(source2, "\n") le := len(lines) for i := 0; i < le; i++ { lines[i] = strings.TrimSpace(lines[i]) switch lines[i] { case "Copy": if i == le-1 { log.Fatal("There are no lines after the Copy command.") } i++ err := clipboard.WriteAll(lines[i]) check(err) case "CopyFile": if i == le-1 { log.Fatal("There are no lines after the CopyFile command.") } i++ if lines[i] == "TheF*ckingCode" { err := clipboard.WriteAll(source) check(err) } else { bytes, err := ioutil.ReadFile(lines[i]) check(err) err = clipboard.WriteAll(string(bytes)) check(err) } case "Duplicate": if i == le-1 { log.Fatal("There are no lines after the Duplicate command.") } i++ times, err := strconv.Atoi(lines[i]) check(err) if times < 0 { log.Fatal("Can't duplicate text a negative number of times.") } text, err := clipboard.ReadAll() check(err) err = clipboard.WriteAll(strings.Repeat(text, times+1)) check(err) case "Pasta!": text, err := clipboard.ReadAll() check(err) fmt.Println(text) return default: if lines[i] == "" { continue } log.Fatal("Unknown command, " + lines[i]) } } } func main() { if len(os.Args) != 2 { log.Fatal("There should be exactly one command line argument, the CopyPasta file path.") } bytes, err := ioutil.ReadFile(os.Args[1]) check(err) interpret(string(bytes)) err = clipboard.WriteAll("") check(err) }
#include <fstream> #include <iostream> #include <sstream> #include <streambuf> #include <string> #include <stdlib.h> using namespace std; void fatal_error(string errtext, char *argv[]) { cout << "%" << errtext << endl; cout << "usage: " << argv[0] << " [filename.cp]" << endl; exit(1); } string& ltrim(string& str, const string& chars = "\t\n\v\f\r ") { str.erase(0, str.find_first_not_of(chars)); return str; } string& rtrim(string& str, const string& chars = "\t\n\v\f\r ") { str.erase(str.find_last_not_of(chars) + 1); return str; } string& trim(string& str, const string& chars = "\t\n\v\f\r ") { return ltrim(rtrim(str, chars), chars); } int main(int argc, char *argv[]) { string fname = ""; string source = ""; try { fname = argv[1]; ifstream t(fname); t.seekg(0, ios::end); source.reserve(t.tellg()); t.seekg(0, ios::beg); source.assign((istreambuf_iterator<char>(t)), istreambuf_iterator<char>()); } catch(const exception& e) { fatal_error("error while trying to read from specified file", argv); } string clipboard = ""; int loc = 0; string remaining = source; string line = ""; string command = ""; stringstream ss; while(remaining.find("\n") != string::npos) { line = remaining.substr(0, remaining.find("\n")); command = trim(line); remaining = remaining.substr(remaining.find("\n") + 1); try { if(line == "Copy") { line = remaining.substr(0, remaining.find("\n")); remaining = remaining.substr(remaining.find("\n") + 1); clipboard += line; } else if(line == "CopyFile") { line = remaining.substr(0, remaining.find("\n")); remaining = remaining.substr(remaining.find("\n") + 1); if(line == "TheF*ckingCode") clipboard += source; else { string filetext = ""; ifstream t(line); t.seekg(0, ios::end); filetext.reserve(t.tellg()); t.seekg(0, ios::beg); filetext.assign((istreambuf_iterator<char>(t)), istreambuf_iterator<char>()); clipboard += filetext; } } else if(line == "Duplicate") { line = remaining.substr(0, remaining.find("\n")); remaining = remaining.substr(remaining.find("\n") + 1); int amount = stoi(line); string origClipboard = clipboard; for(int i = 0; i < amount - 1; i++) { clipboard += origClipboard; } } else if(line == "Pasta!") { cout << clipboard << endl; return 0; } else { ss << (loc + 1); fatal_error("unknown command '" + command + "' encounter on line " + ss.str(), argv); } } catch(const exception& e) { ss << (loc + 1); fatal_error("error while executing command '" + command + "' on line " + ss.str(), argv); } loc += 2; } return 0; }
Convert the following code from Go to C++, ensuring the logic remains intact.
package main import ( "fmt" "rcu" ) const limit = 100000 func nonTwinSums(twins []int) []int { sieve := make([]bool, limit+1) for i := 0; i < len(twins); i++ { for j := i; j < len(twins); j++ { sum := twins[i] + twins[j] if sum > limit { break } sieve[sum] = true } } var res []int for i := 2; i < limit; i += 2 { if !sieve[i] { res = append(res, i) } } return res } func main() { primes := rcu.Primes(limit)[2:] twins := []int{3} for i := 0; i < len(primes)-1; i++ { if primes[i+1]-primes[i] == 2 { if twins[len(twins)-1] != primes[i] { twins = append(twins, primes[i]) } twins = append(twins, primes[i+1]) } } fmt.Println("Non twin prime sums:") ntps := nonTwinSums(twins) rcu.PrintTable(ntps, 10, 4, false) fmt.Println("Found", len(ntps)) fmt.Println("\nNon twin prime sums (including 1):") twins = append([]int{1}, twins...) ntps = nonTwinSums(twins) rcu.PrintTable(ntps, 10, 4, false) fmt.Println("Found", len(ntps)) }
#include <iomanip> #include <iostream> #include <vector> std::vector<bool> prime_sieve(int limit) { std::vector<bool> sieve(limit, true); if (limit > 0) sieve[0] = false; if (limit > 1) sieve[1] = false; for (int i = 4; i < limit; i += 2) sieve[i] = false; for (int p = 3, sq = 9; sq < limit; p += 2) { if (sieve[p]) { for (int q = sq; q < limit; q += p << 1) sieve[q] = false; } sq += (p + 1) << 2; } return sieve; } void print_non_twin_prime_sums(const std::vector<bool>& sums) { int count = 0; for (size_t i = 2; i < sums.size(); i += 2) { if (!sums[i]) { ++count; std::cout << std::setw(4) << i << (count % 10 == 0 ? '\n' : ' '); } } std::cout << "\nFound " << count << '\n'; } int main() { const int limit = 100001; std::vector<bool> sieve = prime_sieve(limit + 2); for (size_t i = 0; i < limit; ++i) { if (sieve[i] && !((i > 1 && sieve[i - 2]) || sieve[i + 2])) sieve[i] = false; } std::vector<bool> twin_prime_sums(limit, false); for (size_t i = 0; i < limit; ++i) { if (sieve[i]) { for (size_t j = i; i + j < limit; ++j) { if (sieve[j]) twin_prime_sums[i + j] = true; } } } std::cout << "Non twin prime sums:\n"; print_non_twin_prime_sums(twin_prime_sums); sieve[1] = true; for (size_t i = 1; i + 1 < limit; ++i) { if (sieve[i]) twin_prime_sums[i + 1] = true; } std::cout << "\nNon twin prime sums (including 1):\n"; print_non_twin_prime_sums(twin_prime_sums); }
Transform the following Go implementation into C++, maintaining the same output and logic.
package main import ( "fmt" "rcu" ) const limit = 100000 func nonTwinSums(twins []int) []int { sieve := make([]bool, limit+1) for i := 0; i < len(twins); i++ { for j := i; j < len(twins); j++ { sum := twins[i] + twins[j] if sum > limit { break } sieve[sum] = true } } var res []int for i := 2; i < limit; i += 2 { if !sieve[i] { res = append(res, i) } } return res } func main() { primes := rcu.Primes(limit)[2:] twins := []int{3} for i := 0; i < len(primes)-1; i++ { if primes[i+1]-primes[i] == 2 { if twins[len(twins)-1] != primes[i] { twins = append(twins, primes[i]) } twins = append(twins, primes[i+1]) } } fmt.Println("Non twin prime sums:") ntps := nonTwinSums(twins) rcu.PrintTable(ntps, 10, 4, false) fmt.Println("Found", len(ntps)) fmt.Println("\nNon twin prime sums (including 1):") twins = append([]int{1}, twins...) ntps = nonTwinSums(twins) rcu.PrintTable(ntps, 10, 4, false) fmt.Println("Found", len(ntps)) }
#include <iomanip> #include <iostream> #include <vector> std::vector<bool> prime_sieve(int limit) { std::vector<bool> sieve(limit, true); if (limit > 0) sieve[0] = false; if (limit > 1) sieve[1] = false; for (int i = 4; i < limit; i += 2) sieve[i] = false; for (int p = 3, sq = 9; sq < limit; p += 2) { if (sieve[p]) { for (int q = sq; q < limit; q += p << 1) sieve[q] = false; } sq += (p + 1) << 2; } return sieve; } void print_non_twin_prime_sums(const std::vector<bool>& sums) { int count = 0; for (size_t i = 2; i < sums.size(); i += 2) { if (!sums[i]) { ++count; std::cout << std::setw(4) << i << (count % 10 == 0 ? '\n' : ' '); } } std::cout << "\nFound " << count << '\n'; } int main() { const int limit = 100001; std::vector<bool> sieve = prime_sieve(limit + 2); for (size_t i = 0; i < limit; ++i) { if (sieve[i] && !((i > 1 && sieve[i - 2]) || sieve[i + 2])) sieve[i] = false; } std::vector<bool> twin_prime_sums(limit, false); for (size_t i = 0; i < limit; ++i) { if (sieve[i]) { for (size_t j = i; i + j < limit; ++j) { if (sieve[j]) twin_prime_sums[i + j] = true; } } } std::cout << "Non twin prime sums:\n"; print_non_twin_prime_sums(twin_prime_sums); sieve[1] = true; for (size_t i = 1; i + 1 < limit; ++i) { if (sieve[i]) twin_prime_sums[i + 1] = true; } std::cout << "\nNon twin prime sums (including 1):\n"; print_non_twin_prime_sums(twin_prime_sums); }
Change the following Go code into C++ without altering its purpose.
package main import "fmt" var g = [][]int{ 0: {1}, 1: {2}, 2: {0}, 3: {1, 2, 4}, 4: {3, 5}, 5: {2, 6}, 6: {5}, 7: {4, 6, 7}, } func main() { fmt.Println(kosaraju(g)) } func kosaraju(g [][]int) []int { vis := make([]bool, len(g)) L := make([]int, len(g)) x := len(L) t := make([][]int, len(g)) var Visit func(int) Visit = func(u int) { if !vis[u] { vis[u] = true for _, v := range g[u] { Visit(v) t[v] = append(t[v], u) } x-- L[x] = u } } for u := range g { Visit(u) } c := make([]int, len(g)) var Assign func(int, int) Assign = func(u, root int) { if vis[u] { vis[u] = false c[u] = root for _, v := range t[u] { Assign(v, root) } } } for _, u := range L { Assign(u, u) } return c }
#include <functional> #include <iostream> #include <ostream> #include <vector> template<typename T> std::ostream& operator<<(std::ostream& os, const std::vector<T>& v) { auto it = v.cbegin(); auto end = v.cend(); os << "["; if (it != end) { os << *it; it = std::next(it); } while (it != end) { os << ", " << *it; it = std::next(it); } return os << "]"; } std::vector<int> kosaraju(std::vector<std::vector<int>>& g) { auto size = g.size(); std::vector<bool> vis(size); std::vector<int> l(size); auto x = size; std::vector<std::vector<int>> t(size); std::function<void(int)> visit; visit = [&](int u) { if (!vis[u]) { vis[u] = true; for (auto v : g[u]) { visit(v); t[v].push_back(u); } l[--x] = u; } }; for (int i = 0; i < g.size(); ++i) { visit(i); } std::vector<int> c(size); std::function<void(int, int)> assign; assign = [&](int u, int root) { if (vis[u]) { vis[u] = false; c[u] = root; for (auto v : t[u]) { assign(v, root); } } }; for (auto u : l) { assign(u, u); } return c; } std::vector<std::vector<int>> g = { {1}, {2}, {0}, {1, 2, 4}, {3, 5}, {2, 6}, {5}, {4, 6, 7}, }; int main() { using namespace std; cout << kosaraju(g) << endl; return 0; }
Convert the following code from Go to C++, ensuring the logic remains intact.
package main import ( "fmt" "math" ) type mwriter struct { value float64 log string } func (m mwriter) bind(f func(v float64) mwriter) mwriter { n := f(m.value) n.log = m.log + n.log return n } func unit(v float64, s string) mwriter { return mwriter{v, fmt.Sprintf("  %-17s: %g\n", s, v)} } func root(v float64) mwriter { return unit(math.Sqrt(v), "Took square root") } func addOne(v float64) mwriter { return unit(v+1, "Added one") } func half(v float64) mwriter { return unit(v/2, "Divided by two") } func main() { mw1 := unit(5, "Initial value") mw2 := mw1.bind(root).bind(addOne).bind(half) fmt.Println("The Golden Ratio is", mw2.value) fmt.Println("\nThis was derived as follows:-") fmt.Println(mw2.log) }
#include <cmath> #include <iostream> #include <string> using namespace std; struct LoggingMonad { double Value; string Log; }; auto operator>>(const LoggingMonad& monad, auto f) { auto result = f(monad.Value); return LoggingMonad{result.Value, monad.Log + "\n" + result.Log}; } auto Root = [](double x){ return sqrt(x); }; auto AddOne = [](double x){ return x + 1; }; auto Half = [](double x){ return x / 2.0; }; auto MakeWriter = [](auto f, string message) { return [=](double x){return LoggingMonad(f(x), message);}; }; auto writerRoot = MakeWriter(Root, "Taking square root"); auto writerAddOne = MakeWriter(AddOne, "Adding 1"); auto writerHalf = MakeWriter(Half, "Dividing by 2"); int main() { auto result = LoggingMonad{5, "Starting with 5"} >> writerRoot >> writerAddOne >> writerHalf; cout << result.Log << "\nResult: " << result.Value; }
Translate this program into C++ but keep the logic exactly as in Go.
package main import ( "fmt" "os" "sort" "strings" "text/template" ) func main() { const t = `[[[{{index .P 1}}, {{index .P 2}}], [{{index .P 3}}, {{index .P 4}}, {{index .P 1}}], {{index .P 5}}]] ` type S struct { P map[int]string } var s S s.P = map[int]string{ 0: "'Payload#0'", 1: "'Payload#1'", 2: "'Payload#2'", 3: "'Payload#3'", 4: "'Payload#4'", 5: "'Payload#5'", 6: "'Payload#6'", } tmpl := template.Must(template.New("").Parse(t)) tmpl.Execute(os.Stdout, s) var unused []int for k, _ := range s.P { if !strings.Contains(t, fmt.Sprintf("{{index .P %d}}", k)) { unused = append(unused, k) } } sort.Ints(unused) fmt.Println("\nThe unused payloads have indices of :", unused) }
#include <iostream> #include <set> #include <tuple> #include <vector> using namespace std; template<typename P> void PrintPayloads(const P &payloads, int index, bool isLast) { if(index < 0 || index >= (int)size(payloads)) cout << "null"; else cout << "'" << payloads[index] << "'"; if (!isLast) cout << ", "; } template<typename P, typename... Ts> void PrintPayloads(const P &payloads, tuple<Ts...> const& nestedTuple, bool isLast = true) { std::apply ( [&payloads, isLast](Ts const&... tupleArgs) { size_t n{0}; cout << "["; (PrintPayloads(payloads, tupleArgs, (++n == sizeof...(Ts)) ), ...); cout << "]"; cout << (isLast ? "\n" : ",\n"); }, nestedTuple ); } void FindUniqueIndexes(set<int> &indexes, int index) { indexes.insert(index); } template<typename... Ts> void FindUniqueIndexes(set<int> &indexes, std::tuple<Ts...> const& nestedTuple) { std::apply ( [&indexes](Ts const&... tupleArgs) { (FindUniqueIndexes(indexes, tupleArgs),...); }, nestedTuple ); } template<typename P> void PrintUnusedPayloads(const set<int> &usedIndexes, const P &payloads) { for(size_t i = 0; i < size(payloads); i++) { if(usedIndexes.find(i) == usedIndexes.end() ) cout << payloads[i] << "\n"; } } int main() { vector payloads {"Payload#0", "Payload#1", "Payload#2", "Payload#3", "Payload#4", "Payload#5", "Payload#6"}; const char *shortPayloads[] {"Payload#0", "Payload#1", "Payload#2", "Payload#3"}; auto tpl = make_tuple(make_tuple( make_tuple(1, 2), make_tuple(3, 4, 1), 5)); cout << "Mapping indexes to payloads:\n"; PrintPayloads(payloads, tpl); cout << "\nFinding unused payloads:\n"; set<int> usedIndexes; FindUniqueIndexes(usedIndexes, tpl); PrintUnusedPayloads(usedIndexes, payloads); cout << "\nMapping to some out of range payloads:\n"; PrintPayloads(shortPayloads, tpl); return 0; }
Change the programming language of this snippet from Go to C++ without modifying what it does.
package main import "fmt" type Outer struct { field int Inner struct { field int } } func (o *Outer) outerMethod() { fmt.Println("Outer's field has a value of", o.field) } func (o *Outer) innerMethod() { fmt.Println("Inner's field has a value of", o.Inner.field) } func main() { o := &Outer{field: 43} o.Inner.field = 42 o.innerMethod() o.outerMethod() p := &Outer{ field: 45, Inner: struct { field int }{ field: 44, }, } p.innerMethod() p.outerMethod() }
#include <iostream> #include <vector> class Outer { int m_privateField; public: Outer(int value) : m_privateField{value}{} class Inner { int m_innerValue; public: Inner(int innerValue) : m_innerValue{innerValue}{} int AddOuter(Outer outer) const { return outer.m_privateField + m_innerValue; } }; }; int main() { Outer::Inner inner{42}; Outer outer{1}; auto sum = inner.AddOuter(outer); std::cout << "sum: " << sum << "\n"; std::vector<int> vec{1,2,3}; std::vector<int>::iterator itr = vec.begin(); std::cout << "vec[0] = " << *itr << "\n"; }
Can you help me rewrite this code in C++ instead of Go, keeping it the same logically?
package main import ( "fmt" "time" ) func main() { start := time.Now() for a := 3; ; a++ { for b := a + 1; ; b++ { c := 1000 - a - b if c <= b { break } if a*a+b*b == c*c { fmt.Printf("a = %d, b = %d, c = %d\n", a, b, c) fmt.Println("a + b + c =", a+b+c) fmt.Println("a * b * c =", a*b*c) fmt.Println("\nTook", time.Since(start)) return } } } }
#include <cmath> #include <concepts> #include <iostream> #include <numeric> #include <optional> #include <tuple> using namespace std; optional<tuple<int, int ,int>> FindPerimeterTriplet(int perimeter) { unsigned long long perimeterULL = perimeter; auto max_M = (unsigned long long)sqrt(perimeter/2) + 1; for(unsigned long long m = 2; m < max_M; ++m) { for(unsigned long long n = 1 + m % 2; n < m; n+=2) { if(gcd(m,n) != 1) { continue; } auto a = m * m - n * n; auto b = 2 * m * n; auto c = m * m + n * n; auto primitive = a + b + c; auto factor = perimeterULL / primitive; if(primitive * factor == perimeterULL) { if(b<a) swap(a, b); return tuple{a * factor, b * factor, c * factor}; } } } return nullopt; } int main() { auto t1 = FindPerimeterTriplet(1000); if(t1) { auto [a, b, c] = *t1; cout << "[" << a << ", " << b << ", " << c << "]\n"; cout << "a * b * c = " << a * b * c << "\n"; } else { cout << "Perimeter not found\n"; } }